NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F046515

Metagenome / Metatranscriptome Family F046515

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046515
Family Type Metagenome / Metatranscriptome
Number of Sequences 151
Average Sequence Length 46 residues
Representative Sequence MKGRILDRVVAAEREHRSVALATDLATGRQLLLDGEHAEGDLALPD
Number of Associated Samples 124
Number of Associated Scaffolds 151

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.34 %
% of genes near scaffold ends (potentially truncated) 99.34 %
% of genes from short scaffolds (< 2000 bps) 89.40 %
Associated GOLD sequencing projects 117
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.338 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(51.656 % of family members)
Environment Ontology (ENVO) Unclassified
(50.993 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(43.046 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.22%    β-sheet: 21.62%    Coil/Unstructured: 62.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 151 Family Scaffolds
PF02625XdhC_CoxI 68.87
PF05762VWA_CoxE 28.48
PF01502PRA-CH 0.66
PF07728AAA_5 0.66
PF03450CO_deh_flav_C 0.66
PF03576Peptidase_S58 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 151 Family Scaffolds
COG1975Molybdoenzyme maturation factor PaoD (Mo cofactor insertion), XdhC/CoxF familyPosttranslational modification, protein turnover, chaperones [O] 68.87
COG3191L-aminopeptidase/D-esteraseAmino acid transport and metabolism [E] 1.32
COG0139Phosphoribosyl-AMP cyclohydrolaseAmino acid transport and metabolism [E] 0.66


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.34 %
UnclassifiedrootN/A0.66 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001867|JGI12627J18819_10368898All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus582Open in IMG/M
3300003351|JGI26346J50198_1004509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1327Open in IMG/M
3300005435|Ga0070714_101142451All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales759Open in IMG/M
3300005587|Ga0066654_10933998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales500Open in IMG/M
3300005764|Ga0066903_104363736All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium756Open in IMG/M
3300006175|Ga0070712_101071806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae699Open in IMG/M
3300006755|Ga0079222_12079643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales561Open in IMG/M
3300007076|Ga0075435_100974888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales740Open in IMG/M
3300009090|Ga0099827_11107531All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria688Open in IMG/M
3300009525|Ga0116220_10192372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium882Open in IMG/M
3300009698|Ga0116216_10989554All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria503Open in IMG/M
3300010048|Ga0126373_12418788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales585Open in IMG/M
3300010360|Ga0126372_10715112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium980Open in IMG/M
3300010360|Ga0126372_10916335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales881Open in IMG/M
3300010362|Ga0126377_10140139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00882260Open in IMG/M
3300010362|Ga0126377_12669614All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria574Open in IMG/M
3300010376|Ga0126381_100343687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00882060Open in IMG/M
3300010376|Ga0126381_102959060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales675Open in IMG/M
3300010398|Ga0126383_11197408All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium849Open in IMG/M
3300010400|Ga0134122_11039064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales806Open in IMG/M
3300011120|Ga0150983_12009557All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium1011Open in IMG/M
3300012180|Ga0153974_1144460All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria557Open in IMG/M
3300012202|Ga0137363_10642524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium897Open in IMG/M
3300012224|Ga0134028_1094326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales657Open in IMG/M
3300012349|Ga0137387_10757486All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria702Open in IMG/M
3300012363|Ga0137390_10829814All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales881Open in IMG/M
3300012363|Ga0137390_11741585All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria556Open in IMG/M
3300012376|Ga0134032_1262898All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria561Open in IMG/M
3300012469|Ga0150984_117945361All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria612Open in IMG/M
3300012927|Ga0137416_10414198All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium1144Open in IMG/M
3300012930|Ga0137407_10360629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium1340Open in IMG/M
3300015241|Ga0137418_10960932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales622Open in IMG/M
3300016270|Ga0182036_10170703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881568Open in IMG/M
3300016294|Ga0182041_10033616All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00883313Open in IMG/M
3300016341|Ga0182035_11238714All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088667Open in IMG/M
3300016357|Ga0182032_11228874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales645Open in IMG/M
3300016357|Ga0182032_11665474All Organisms → cellular organisms → Bacteria → Proteobacteria556Open in IMG/M
3300016387|Ga0182040_10026043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00883342Open in IMG/M
3300016387|Ga0182040_11171316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales646Open in IMG/M
3300016404|Ga0182037_10082695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00882259Open in IMG/M
3300016422|Ga0182039_10043582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00883001Open in IMG/M
3300016422|Ga0182039_10279712All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881373Open in IMG/M
3300016422|Ga0182039_11083611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales721Open in IMG/M
3300017822|Ga0187802_10068529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881314Open in IMG/M
3300017822|Ga0187802_10333610All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria594Open in IMG/M
3300017926|Ga0187807_1259627Not Available571Open in IMG/M
3300017970|Ga0187783_10300300All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881171Open in IMG/M
3300018433|Ga0066667_11499777All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales596Open in IMG/M
3300018482|Ga0066669_12228862All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria520Open in IMG/M
3300020199|Ga0179592_10174874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088978Open in IMG/M
3300020581|Ga0210399_10138957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00882004Open in IMG/M
3300020583|Ga0210401_10288081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881502Open in IMG/M
3300021151|Ga0179584_1196721All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088831Open in IMG/M
3300021178|Ga0210408_11044717All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria630Open in IMG/M
3300021180|Ga0210396_10375633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881251Open in IMG/M
3300021181|Ga0210388_10552384All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881009Open in IMG/M
3300021377|Ga0213874_10350031All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria566Open in IMG/M
3300021401|Ga0210393_11034957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088664Open in IMG/M
3300021432|Ga0210384_10054028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00883640Open in IMG/M
3300021475|Ga0210392_10335209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881091Open in IMG/M
3300022522|Ga0242659_1001256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00882583Open in IMG/M
3300022533|Ga0242662_10211464All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria615Open in IMG/M
3300022533|Ga0242662_10289475All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria543Open in IMG/M
3300022708|Ga0242670_1018063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales818Open in IMG/M
3300022709|Ga0222756_1006929All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium1212Open in IMG/M
3300022713|Ga0242677_1058722All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria581Open in IMG/M
3300022716|Ga0242673_1084492All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria590Open in IMG/M
3300025898|Ga0207692_11157510All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria513Open in IMG/M
3300025905|Ga0207685_10553676All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria612Open in IMG/M
3300025915|Ga0207693_10655432All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088815Open in IMG/M
3300025915|Ga0207693_10809171All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales722Open in IMG/M
3300026340|Ga0257162_1046848All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria546Open in IMG/M
3300026494|Ga0257159_1100350All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria507Open in IMG/M
3300026498|Ga0257156_1025195All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881193Open in IMG/M
3300026508|Ga0257161_1004150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00882474Open in IMG/M
3300027070|Ga0208365_1028665All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales730Open in IMG/M
3300027521|Ga0209524_1084284All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales668Open in IMG/M
3300027701|Ga0209447_10043787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881237Open in IMG/M
3300030730|Ga0307482_1202060All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria604Open in IMG/M
3300030738|Ga0265462_12061878All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria557Open in IMG/M
3300031446|Ga0170820_10387097All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria519Open in IMG/M
3300031469|Ga0170819_13837196All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria611Open in IMG/M
3300031474|Ga0170818_107718112All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria620Open in IMG/M
3300031544|Ga0318534_10077110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881891Open in IMG/M
3300031561|Ga0318528_10213029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881034Open in IMG/M
3300031561|Ga0318528_10770711All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria514Open in IMG/M
3300031572|Ga0318515_10549163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales615Open in IMG/M
3300031668|Ga0318542_10009460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00883633Open in IMG/M
3300031668|Ga0318542_10741386All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria514Open in IMG/M
3300031680|Ga0318574_10015578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00883592Open in IMG/M
3300031680|Ga0318574_10347471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088865Open in IMG/M
3300031713|Ga0318496_10544725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales641Open in IMG/M
3300031720|Ga0307469_11841304All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria585Open in IMG/M
3300031724|Ga0318500_10388748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales692Open in IMG/M
3300031736|Ga0318501_10784420All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria527Open in IMG/M
3300031747|Ga0318502_10876004All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria545Open in IMG/M
3300031751|Ga0318494_10807734All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria549Open in IMG/M
3300031763|Ga0318537_10301142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales593Open in IMG/M
3300031764|Ga0318535_10444130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales578Open in IMG/M
3300031777|Ga0318543_10063301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881535Open in IMG/M
3300031779|Ga0318566_10332509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088751Open in IMG/M
3300031780|Ga0318508_1258591All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria501Open in IMG/M
3300031781|Ga0318547_10076993All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881861Open in IMG/M
3300031793|Ga0318548_10101507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881378Open in IMG/M
3300031793|Ga0318548_10374702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088698Open in IMG/M
3300031796|Ga0318576_10382810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088665Open in IMG/M
3300031796|Ga0318576_10576367All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria530Open in IMG/M
3300031798|Ga0318523_10495332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales605Open in IMG/M
3300031799|Ga0318565_10039109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00882172Open in IMG/M
3300031819|Ga0318568_11000974All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria516Open in IMG/M
3300031832|Ga0318499_10207525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088763Open in IMG/M
3300031832|Ga0318499_10250110All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria688Open in IMG/M
3300031846|Ga0318512_10132411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881193Open in IMG/M
3300031859|Ga0318527_10035054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881891Open in IMG/M
3300031893|Ga0318536_10639335All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria531Open in IMG/M
3300031897|Ga0318520_10011259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00883916Open in IMG/M
3300031897|Ga0318520_10272250All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881015Open in IMG/M
3300031897|Ga0318520_10305542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088959Open in IMG/M
3300031912|Ga0306921_11556454All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria720Open in IMG/M
3300031942|Ga0310916_10329817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881295Open in IMG/M
3300031942|Ga0310916_11745908All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria502Open in IMG/M
3300031945|Ga0310913_10520072All Organisms → cellular organisms → Bacteria → Proteobacteria845Open in IMG/M
3300031945|Ga0310913_10586098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales791Open in IMG/M
3300031946|Ga0310910_10045029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00883082Open in IMG/M
3300031947|Ga0310909_10548891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088967Open in IMG/M
3300031954|Ga0306926_11470494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088787Open in IMG/M
3300031981|Ga0318531_10395518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales625Open in IMG/M
3300032001|Ga0306922_11730129All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales618Open in IMG/M
3300032001|Ga0306922_11928720All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria577Open in IMG/M
3300032001|Ga0306922_12376400All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria506Open in IMG/M
3300032010|Ga0318569_10485205All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria576Open in IMG/M
3300032025|Ga0318507_10276590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088729Open in IMG/M
3300032035|Ga0310911_10744985All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria567Open in IMG/M
3300032039|Ga0318559_10280437All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088772Open in IMG/M
3300032042|Ga0318545_10111560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088962Open in IMG/M
3300032042|Ga0318545_10179900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales755Open in IMG/M
3300032043|Ga0318556_10409452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088709Open in IMG/M
3300032044|Ga0318558_10328621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088757Open in IMG/M
3300032044|Ga0318558_10676848All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria516Open in IMG/M
3300032059|Ga0318533_10088039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00882130Open in IMG/M
3300032063|Ga0318504_10519600All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales571Open in IMG/M
3300032064|Ga0318510_10118962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881021Open in IMG/M
3300032066|Ga0318514_10764016All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria514Open in IMG/M
3300032076|Ga0306924_11137946All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales848Open in IMG/M
3300032076|Ga0306924_11763383All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales646Open in IMG/M
3300032091|Ga0318577_10467722All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales601Open in IMG/M
3300032205|Ga0307472_100395039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881154Open in IMG/M
3300032261|Ga0306920_103380216All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria593Open in IMG/M
3300033289|Ga0310914_10680843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium924Open in IMG/M
3300033289|Ga0310914_11376103All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales608Open in IMG/M
3300033290|Ga0318519_10961340All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria529Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil51.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.58%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.62%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.30%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.31%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.65%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.99%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.99%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.99%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.32%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.32%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.32%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.32%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.66%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.66%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.66%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.66%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.66%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.66%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.66%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.66%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300003351Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012180Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaGHost-AssociatedOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012224Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012376Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021151Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300022522Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022708Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022709Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022713Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022716Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026340Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-AEnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026498Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-AEnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300027070Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes)EnvironmentalOpen in IMG/M
3300027521Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027701Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12627J18819_1036889833300001867Forest SoilMKGRILDRIVAAEREHRSVALATDLATGRQLLFEGEHAEGDLALDEAALEKLREA
JGI26346J50198_100450933300003351Bog Forest SoilMKGRILDAVIAAGRASRSVALATDLATGRQLLVDEASIEGDLALNAAALAEI
Ga0070714_10114245133300005435Agricultural SoilMKGRILDRVVAAEREHRSVALATDLATGRQLLFEGEHAEG
Ga0066654_1093399813300005587SoilMKGRILDRVVAAARDHRSVAVATDLATGRQLLLDGEQPEGDLALDDTALDRI
Ga0066903_10436373633300005764Tropical Forest SoilMKGRTLDHVVAAARDHRSVALATNLTTGRQLLLDGDQVE
Ga0070712_10107180613300006175Corn, Switchgrass And Miscanthus RhizosphereMKGRILDRVVAAEREHRSVALATDLATGRQLLFEGEHAEGD
Ga0079222_1207964333300006755Agricultural SoilMKGRILDRVVAAEREHRSVALATDLATGRQLLLDDERPEGDLTLDDGALE
Ga0075435_10097488813300007076Populus RhizosphereMKARILDQVVAAEREHRSVALATDLTTGRQLLFEGGQAEGDLALDDAAL
Ga0099827_1110753113300009090Vadose Zone SoilMKGYILDRVVAAEREHRSVALATDLATGRQLLLDGEHAEG
Ga0116220_1019237213300009525Peatlands SoilMKGRILDRVVAAEREHRSVALATNLATGRQLLLDGEHAEGDLALDDAVLERVR
Ga0116216_1098955413300009698Peatlands SoilMKGRILDRVVAAEREHRSVALATDLATGRQLLLDGEHAE
Ga0126373_1241878833300010048Tropical Forest SoilMKGRTLDHVVAAARGHRSVALATDLHTGRQLLLDGE
Ga0126372_1071511213300010360Tropical Forest SoilMKGRILDRVVTAAREHRSVALATDLSTGQQVLFDGTQADGDLTLDDA
Ga0126372_1091633513300010360Tropical Forest SoilMKGRTLDHVVAAARDHRSVALATDLRTGRQLLLDSEQVEGDLALEDSALDRVRNAWRS
Ga0126377_1014013943300010362Tropical Forest SoilMKRPVLDAIVAAGRDSRSVALATDLASGRQLLVDE
Ga0126377_1266961423300010362Tropical Forest SoilMKGHTLDHVVAAARDHRSVALATDLTTGRQLLLDGE
Ga0126381_10034368743300010376Tropical Forest SoilMKGRTLDHVVAAARDHRSVALATNLTTGRQLLLDGDQV
Ga0126381_10295906013300010376Tropical Forest SoilMKGRTLDHVVAAARDHRSVALATDLTTGRQLLLDGEQAEGDLALEGAALDK
Ga0126383_1119740833300010398Tropical Forest SoilMKGRILDRVVAAEREHRSVALATELVTGRQLLLEDERTEGDLALDDAALE
Ga0134122_1103906413300010400Terrestrial SoilMKGRILDRVVAAEREHRSVALATDLATGRQLLFEGEHA
Ga0150983_1200955713300011120Forest SoilMKGRILDRVVAAEREHRSVALATDLATGRQMLLDGGHAEG
Ga0153974_114446013300012180Attine Ant Fungus GardensMKERTLDHVVGAARDHRSVALATDLETGQQLLLDGRDADG
Ga0137363_1064252413300012202Vadose Zone SoilMKGRILDRVVAAERDHRSVALATDLATGRQLLFEGEHAEGDLALDDAALDR
Ga0134028_109432613300012224Grasslands SoilMKGRILDRVVAAEREHRSVALATDLATGRQLLFEGEHAEGDLAFDD
Ga0137387_1075748613300012349Vadose Zone SoilMKGRILDAVMAAGRDSRSVALATDLATGRQLFVDGGST
Ga0137390_1082981413300012363Vadose Zone SoilMKGRILDRVVAAERDHRSVALATDLATGRQALVDEASTEGDLTLDAAALAEVRQALH
Ga0137390_1174158523300012363Vadose Zone SoilMKGRILDKVVAAERAHRSVALATDLATGRQLLFDGEHAEGDLTLDDAALDGVR
Ga0134032_126289823300012376Grasslands SoilMKGRILDRVVAAEREHRSVAIASDLATGRQLLFEGEHAE
Ga0150984_11794536113300012469Avena Fatua RhizosphereMKGRILDRLVAAEREHRSVALATDLATGGQLLLDGDDVDGDLTLDEAALDRTR
Ga0137416_1041419813300012927Vadose Zone SoilMKARILDAVIAAGRESGSVALATDLATGRQVLVDG
Ga0137407_1036062933300012930Vadose Zone SoilMKGRILDHLVAAEREHRSVALATDLATGRQLLLDREQAEGDLALDTAALDRVRE
Ga0137418_1096093213300015241Vadose Zone SoilMKGRILDHLVAAEREHRSVALATDLATGRQLLLDREQAEGDLELDTAALDRVRE
Ga0182036_1017070313300016270SoilMKGRILDRVVAAEREHRSVALATDLATGRQLLLDGEHAEGDLALDDAVLDR
Ga0182041_1003361663300016294SoilMKGRILDRVVAAERDHRSVALATELASGRQLLLDGEQPEGDLTLD
Ga0182035_1123871433300016341SoilMRGRVLDALIGTSRESRSAALATDLATGRQLLVDEDRAE
Ga0182032_1122887413300016357SoilMKGRILDRVVAAEREHRSVALATDLATGRQLLLDGEHAEGDLALDDGVLDRV
Ga0182032_1166547413300016357SoilMKGSILDRLVAAGRGHRSVALATDLATGRQLLLDGDRGEGDLVLDEAALGAMREA
Ga0182040_1002604313300016387SoilMKGRILDAVISAGRESRSVALATNLATGRQVLVDGASAEGE
Ga0182040_1117131633300016387SoilMKGRTLDRLVAAEREHRSVALATDLATGRQLLLDGEHAEGDLALDD
Ga0182037_1008269513300016404SoilMKGRVLDAVIAAGHETRSIALATDLATGRQLLLDGEHAE
Ga0182039_1004358253300016422SoilMKGRILDHVVAAARDHRSVALATDLATGRQLLLDGDQVEGDLALDDPALDRVREAW
Ga0182039_1027971213300016422SoilMKGRILDRVVAAEREHRSVALATDLATGWQLLLEGEHVEGDLVLDDT
Ga0182039_1108361133300016422SoilMKGRILDHVVTAARDHRSVALATDLATGKQLLLDGEQ
Ga0187802_1006852933300017822Freshwater SedimentMKGRILDAVIAAGRESRSVALATDLATGRQLLVDDG
Ga0187802_1033361023300017822Freshwater SedimentMKGRILDRVVAAEREHRSVALATNLATGRQLLLDGEHAEG
Ga0187807_125962713300017926Freshwater SedimentMKGAILDRVVAAARAHRSVALATDLASGRQLLLDAAAAEGD
Ga0187783_1030030013300017970Tropical PeatlandMKGRTLDHVVAAARDHRSVALATDLTTGRQLLLDG
Ga0066667_1149977733300018433Grasslands SoilMKGRILDRVVAAARDHRSVAVATDLATGRQLLLDGEQAEGDLAL
Ga0066669_1222886223300018482Grasslands SoilMKGRILDRVVAAARDHRSVAVATDLATGRQLLLDGEQPEGDLALDDT
Ga0179592_1017487433300020199Vadose Zone SoilMKGRILDHLVAAEREHRSVALATDLATGRQLLLDREQAEGDLALDTA
Ga0210399_1013895713300020581SoilMKGRILDHVVAAARDHRSVALATDLTAGRQLLLDGDQVDGDLALDVAALDKVRETW
Ga0210401_1028808133300020583SoilMKGRILDQVLAAEREHRSVALATDLATGRQLLFEGEHAEGDLALD
Ga0179584_119672133300021151Vadose Zone SoilMKGRILDRVVAAKREHRSVALATDLATGRQLLIEGEHAEGDLALD
Ga0210408_1104471723300021178SoilMKGRILDHLVAAEREHRSVALATDLATGRQLLLDREQAEG
Ga0210396_1037563333300021180SoilMKGRILDRIVAAEREHRSVALATDLATGRQLLFEGEH
Ga0210388_1055238413300021181SoilMKGRILDRIVAAEREHRSVALATDLATGRQLLFEGEHAE
Ga0213874_1035003113300021377Plant RootsMKGRILDRVVAAEREHRSVALATDLATGRQLLFEGDDAEGDLTLDDAAL
Ga0210393_1103495733300021401SoilMKGRILDQVLAAEREHRSVALATDLATGRQMLLDGEH
Ga0210384_1005402863300021432SoilMKGRILDHLVAAEREHRSVALATDLATGRQLLLDREQAEGDLALDT
Ga0210392_1033520933300021475SoilMKGRILDQVLAAEREHRSVALATDLATGRQLLFEGEHAE
Ga0242659_100125653300022522SoilMKGRILDHVVAAARDHRSLALATNLATGRQLLLDGDHAEGDLTLE
Ga0242662_1021146413300022533SoilMKGRTLDHVVAAARDHRSVALATDLAAGRQLLLDGEHAEGDLAIVGAALDMVREVWR
Ga0242662_1028947513300022533SoilMKRGILDRLVGAGRGHRSAALATELATGRQLLLDGDR
Ga0242670_101806313300022708SoilMKGRILDQVLAAEREHRSVALATDLATGRQLLFEGEHAEGDLALDDAAFDRVR
Ga0222756_100692913300022709SoilMKSRILDHVVAAARDHRSLALATNLATGRQLLLDGDHAEGDLTLEDAALVRVREAW
Ga0242677_105872223300022713SoilMKGRILDRVVAAEREHRSVALATDLATGRQLLFEGVHAEGDLALDDAALDRVRE
Ga0242673_108449233300022716SoilMKSRILDHVVAAARDHRSLALATNLATGRQLLLDGDHAEGDLTLEDA
Ga0207692_1115751013300025898Corn, Switchgrass And Miscanthus RhizosphereMKGRILDQVLAAEREHRSVALATDLATGRQLLFEGEHAEGDLALDDAA
Ga0207685_1055367613300025905Corn, Switchgrass And Miscanthus RhizosphereMKGRTLDRVVSAEREHRSVALATDLATGRQLLLEGEHAEGDLTLDDAALNRVREAW
Ga0207693_1065543233300025915Corn, Switchgrass And Miscanthus RhizosphereMKGRILDRVVAAEREHRSVALATDLATGRQLLFEGE
Ga0207693_1080917133300025915Corn, Switchgrass And Miscanthus RhizosphereMKGRILDRVVAAEREHRSVALATDLATGRQLLFEGEHAEGDLALDDAAL
Ga0257162_104684813300026340SoilMKGRILDRVVAAERDHRSVALATDLATGRQLLFEGEHAEGDLALDDAALD
Ga0257159_110035013300026494SoilMKGRILDQVLAAEREHRSVALATDLATGRQLLFEGEHAEGGLTLDDAALDRVREAW
Ga0257156_102519533300026498SoilMKGRILDRVVAAERDHRSVALATDLATGRQLLFEGEHAEGDLALDDAALDRVRQAW
Ga0257161_100415013300026508SoilMKGRILDQVLAAEREHRSVALATDLATGRQLLFEGEHAEGDLALDDAAL
Ga0208365_102866533300027070Forest SoilMRGRTLDHVVGAVRDHRSVALATDLKTGQQLLLDGRN
Ga0209524_108428433300027521Forest SoilMKGRILDQVLAAEREHRSVALATDLATGRQLLFEGEHAEGDLA
Ga0209447_1004378713300027701Bog Forest SoilMKGRTLDHVVAAARDHRSVALATDLATGRQLLLDGDQ
Ga0307482_120206013300030730Hardwood Forest SoilMKGRMLDQVVAAARDHRSVALATDLAAGRQLLLDGEHAEGDLAIDGAALDKVRE
Ga0265462_1206187833300030738SoilMKGRILDRVVAAEREHRSVALATNLATGRQLLLDAEQAEG
Ga0170820_1038709723300031446Forest SoilMKGRVLDAVIAAGRESRSVALATDLATGRQLLVDDGAAEGELVRTKKNK
Ga0170819_1383719613300031469Forest SoilMKGRTLDRVVAAARDHRSVALATDLTAGRQLLLDGEQVEGDLALDGAALDKVRE
Ga0170818_10771811233300031474Forest SoilMKGRTLDAVIAAGRESRSLALATDLATGRQLLVDEDK
Ga0318534_1007711013300031544SoilMKGRMLDHVVAAARDHRSVALATDLAAGQQLLLDGEHAEGDLALDGAALDMVRDVW
Ga0318528_1021302933300031561SoilMKGRTLDHVVAAARDHRSVALATDLGTGRQLLLDGDRVEGDLAIDDQ
Ga0318528_1077071113300031561SoilMKGRTLDHVVAAARDHRSVALATDLTTGRQLLLDGEQAEGDL
Ga0318515_1054916313300031572SoilMKGRILDRVVAAEREHRSVALATDLATGRQLLLDGEHAEGDLALPD
Ga0318542_1000946063300031668SoilMKGRILDHVVAAARDHRSVALATDLASGRQLLLDAEQVEGDLALDDP
Ga0318542_1074138613300031668SoilMKGRTLDHVVAAARDHRSVALATDLATGRQLLLDGEQAEGDLALED
Ga0318574_1001557813300031680SoilMKGRILDRVVAAEREHRSIALATDLATGRQLLLDGEHAEGDLALPD
Ga0318574_1034747133300031680SoilMKGRILDHVVAAARDHRSVALATDLTAGWQLLFDGDQVE
Ga0318496_1054472513300031713SoilMKGRILDRVVAAEREHRSVALATDLATGRQLLLDGEHAEGD
Ga0307469_1184130413300031720Hardwood Forest SoilMKGRVLDAVVAAGRESRSLALATDLATGRQLLVDDDAAEGELALDPAAL
Ga0318500_1038874833300031724SoilMKGRTLDRLVAAEREHRSVALATDLATGRQLLLDGEHAEGDLALDDAVLD
Ga0318501_1078442013300031736SoilMKGRMLDHVVAAARDHRSVALATDLAVGRQLLLDGEQAEGDL
Ga0318502_1087600433300031747SoilMKGRMLDHVVAAARDHRSVALATDLAAGRQLLLDGEHAEGELTIDGAALDM
Ga0318494_1080773423300031751SoilMKGRILDRVVAAEREHRSVALATDLATGRQLLLDGEHAEGDLALPDAVLD
Ga0318537_1030114213300031763SoilMKGRTLDHVVAAARDHRSVALATDLTTGRQLLLDGEQAEGDLALDGAA
Ga0318535_1044413013300031764SoilMKGRILDAVISAGRESRSVALATNLATGRQALVDGASAE
Ga0318543_1006330113300031777SoilMKGRILDHVVAAARDHRSVALATDLTTGRQLLLDGEQVE
Ga0318566_1033250933300031779SoilMKGRILDRVVAAEREHRSVALATDLATGWQLLLEGEHVEGDLVLDDTA
Ga0318508_125859113300031780SoilMKGRILDRVVAAERDHRSVALATELASGRQLLLDGEQPE
Ga0318547_1007699313300031781SoilMKGRMLDQVVAAARDHRSVALATDLAAGRQLLLDGEHAEGELTIDGAALD
Ga0318548_1010150733300031793SoilMKGRILDRVVAAGRDHRSVALATDLASGRQLLLDGEQPEGDLTLDDGALEK
Ga0318548_1037470213300031793SoilMKGRILDHVVTAARDHRSVALATDLATGKQLLLDGEQVEGDLAL
Ga0318576_1038281013300031796SoilMKGRILDAVISAGGESRSVALATNLATGRQVLVDGASAEGELA
Ga0318576_1057636713300031796SoilMKGRILDRVVAAEREHRSVVLATDLATGRQLLLEGEHEEGDLALDAAVLD
Ga0318523_1049533213300031798SoilMKGRILDHVVTAARDHRSVALATDLATGKQLLLDDDQVEGDLALDGATFD
Ga0318565_1003910913300031799SoilMKGRMLDHVVAAARDHRSVALATDLAVGRQLLLDGEQAEGDLALDGAALDM
Ga0318568_1100097413300031819SoilMKGRILDHVVTAARDHRSVALATDLATGKQLLLDDD
Ga0318499_1020752533300031832SoilMKGRILDRVVAAEREHRSIALATDLATGRQLLLDGEHAEGDLALPDAVLSL
Ga0318499_1025011013300031832SoilMKGRILDHVVTAARDHRSVALATDLATGKQLLLDGEQIEGDLTLDDTM
Ga0318512_1013241133300031846SoilMKGRVLDAVIAAGHETRSIALATDLATGRQLLVDD
Ga0318527_1003505413300031859SoilMKGRMLDQVVAAARDHRSVALATDLAAGRQLLLDGEHAEGELTIDGAALDMVREVW
Ga0318536_1063933533300031893SoilMKGRILDHVVTAARDHRSVALATDLATGKQLLLDDDQVEG
Ga0318520_1001125913300031897SoilMKRRILDRVVAAEREHRSVALATDLATGRQLVLDGEHAEGDLALDDGVLDR
Ga0318520_1027225013300031897SoilMKGRILDRVVAAERDHRSVALATELASGRQLLLDGEQPEGDLTLDDGALEKVREVWRTG
Ga0318520_1030554233300031897SoilMKGRILDRVVAAEREHRSVALATDLATGWQLLLEGEHVEGDLVLDDTAIEKVRE
Ga0306921_1155645413300031912SoilMKGRILDRVVAAEREHRSVALATELATGRQLLLESEHAEGDLALDDAALD
Ga0310916_1032981733300031942SoilMKGRILDHVVAAARDHRSVALATDLATGRQLLLDGEQVEGD
Ga0310916_1174590823300031942SoilMKGRILDRVAAAGRDHRSVALATDLASGRQLLLDGEQPEGDLTLDDGALEKVREV
Ga0310913_1052007213300031945SoilMKGRILDHVVAAARDHRSVALATDLATGRQLLLDGDQVEGDLALDD
Ga0310913_1058609833300031945SoilMKGRILDHVVTAARDHRSVALATDLATGKQLLLDGEQIEGDLTLDDTMLDRV
Ga0310910_1004502953300031946SoilMKGRILDRVVAAERDHRSVALATELASGRQLLLDGEQPEGDLTLDDGALEKVREVW
Ga0310909_1054889113300031947SoilMKGRILDRVAAAGRDHRSVALATDLASGRQLLLDGEQPEGDLTL
Ga0306926_1147049413300031954SoilMKGRTLDHVVAAARDHRSVALATDLGTGRQLLLDGDRVEGDL
Ga0318531_1039551833300031981SoilMKGRILDRIVAAEREHRSVALATDLATGRQMLFEGEQAEGDLTLEHAALERVR
Ga0306922_1173012933300032001SoilMKGRILDHVVAAARDHRSVALATDLTAGWQLLFDGD
Ga0306922_1192872013300032001SoilMKGRILDRVVAAESEHRSVALATDLATGRQLLFEGEQVDGDLTLDDVALDTVREVW
Ga0306922_1237640013300032001SoilMKGRILDHVVTAARDHRSVALATDLATGKQLLLDGE
Ga0318569_1048520513300032010SoilMKGRILDHVVAAARDHRSVALATDLTAGWQLLFDGDQVEGDLALDGAALDKVRETWRS
Ga0318507_1027659013300032025SoilMKGRMLDHVVAAARDHRSVALATDLAAGRQLLLDGEHAE
Ga0310911_1074498533300032035SoilMKGRILDHVVTAARDHRSVALATDLATGKQLLLDGEQVEGDLALDGATFDKV
Ga0318559_1028043733300032039SoilMKGRMLDHVVAAARDHRSVALATDLAAGRQLLLDGEHAEGELTIDGAALDMVRE
Ga0318545_1011156013300032042SoilMKGRILDRIVAAEREHRSVALATDLATGRQMLFEGEQAEGDLTLEHA
Ga0318545_1017990013300032042SoilMKGRTLDRLVAAEREHRSVALATDLATGRQLLLDGEHAEGDLA
Ga0318556_1040945213300032043SoilMKGRILDQVVAAEREHRSVALATDLATGSQLLFEGEHAEGDLTLDDAALDRV
Ga0318558_1032862133300032044SoilMKGRTLDHVVAAARDHRSVALATDLGTGRQLLLDGDRVEGDLAIDDQTLDRL
Ga0318558_1067684823300032044SoilMKGRILDRVVAAEREHRSVALATDLATGRQLLLEGKHVEGDLVLDD
Ga0318533_1008803913300032059SoilMKGRTLDHVVAAARDHRSVALATDLATGRQLLLDGEQ
Ga0318504_1051960013300032063SoilMKGRTLDRLVAAEREHRSVALATDLATGRQLLLDG
Ga0318510_1011896233300032064SoilMKGRMLDHVVAAARDHRSVALATDLAAGRQLLLDGEHAEGELTIDGAALD
Ga0318514_1076401613300032066SoilMKGRILDHVVAAARDHRSVALATDLATGRQLLLDGEQVE
Ga0306924_1113794633300032076SoilMKGRILDHVVAAARDHRSVALATDLATGRQLLLDGDQVEGDLALDDPALDRV
Ga0306924_1176338313300032076SoilMKGRILDRVVAAEREHRSVALATDLATGRQLLLEGEH
Ga0318577_1046772213300032091SoilMKGRILDRVVAAEREHRSIALATDLATGRQLLLDGE
Ga0307472_10039503933300032205Hardwood Forest SoilMKGRILDHVVAAARDHRSVALATDLTTGFQALLDGQQVEGDLELDEIALDRVREV
Ga0306920_10338021623300032261SoilMKGRILDRVVAAESEHRSVALATDLATGRQLLFEGEQVDGDLTLDDVAL
Ga0310914_1068084313300033289SoilMKGRILDRVLAAEREHRSVALATDLASGRQLLFDGEH
Ga0310914_1137610333300033289SoilMKGRTLDHVVAAARDHRSVALATDLATGRQLLLDGEQAEGDLALEDS
Ga0318519_1096134013300033290SoilMKGRTLDHVVAAARDHRSVALATNLTTGRQLLLDGDQVEGDLALDDAALDTVRG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.