NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F046484

Metagenome / Metatranscriptome Family F046484

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046484
Family Type Metagenome / Metatranscriptome
Number of Sequences 151
Average Sequence Length 131 residues
Representative Sequence VPEAADKSAGEPSKKSKLAKFIQEYHGALSTLFLGVAGLIATSIWQYRQSVTAAKQAASEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQTADQRFGVLLSLTRGAILDPELAVSYALELGKDN
Number of Associated Samples 142
Number of Associated Scaffolds 151

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 22.46 %
% of genes near scaffold ends (potentially truncated) 90.73 %
% of genes from short scaffolds (< 2000 bps) 84.77 %
Associated GOLD sequencing projects 131
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.391 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.921 % of family members)
Environment Ontology (ENVO) Unclassified
(31.126 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(36.424 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 64.52%    β-sheet: 0.00%    Coil/Unstructured: 35.48%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 151 Family Scaffolds
PF02517Rce1-like 8.61
PF13167GTP-bdg_N 0.66
PF13505OMP_b-brl 0.66
PF00596Aldolase_II 0.66
PF05175MTS 0.66
PF00271Helicase_C 0.66
PF00166Cpn10 0.66
PF13482RNase_H_2 0.66
PF05359DUF748 0.66
PF12681Glyoxalase_2 0.66
PF01915Glyco_hydro_3_C 0.66
PF00849PseudoU_synth_2 0.66
PF07332Phage_holin_3_6 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 151 Family Scaffolds
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 8.61
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 8.61
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 0.66
COG0564Pseudouridine synthase RluA, 23S rRNA- or tRNA-specificTranslation, ribosomal structure and biogenesis [J] 0.66
COG1187Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605Translation, ribosomal structure and biogenesis [J] 0.66
COG1472Periplasmic beta-glucosidase and related glycosidasesCarbohydrate transport and metabolism [G] 0.66
COG2982Uncharacterized conserved protein AsmA involved in outer membrane biogenesisCell wall/membrane/envelope biogenesis [M] 0.66

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.39 %
UnclassifiedrootN/A8.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004153|Ga0063455_100283098All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium895Open in IMG/M
3300004156|Ga0062589_100863554All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium828Open in IMG/M
3300004480|Ga0062592_100518331All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium990Open in IMG/M
3300004643|Ga0062591_100373939All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1164Open in IMG/M
3300004643|Ga0062591_101540145All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium667Open in IMG/M
3300005330|Ga0070690_101333904All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium576Open in IMG/M
3300005335|Ga0070666_10529460All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium856Open in IMG/M
3300005337|Ga0070682_100420300All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1016Open in IMG/M
3300005338|Ga0068868_100213379All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1614Open in IMG/M
3300005365|Ga0070688_101673449All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300005367|Ga0070667_101699537All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium594Open in IMG/M
3300005435|Ga0070714_102177085All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium540Open in IMG/M
3300005436|Ga0070713_101055462All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium785Open in IMG/M
3300005438|Ga0070701_10878764All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium617Open in IMG/M
3300005466|Ga0070685_10079124All Organisms → cellular organisms → Bacteria1967Open in IMG/M
3300005471|Ga0070698_101402935All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium649Open in IMG/M
3300005530|Ga0070679_101212047All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium700Open in IMG/M
3300005548|Ga0070665_101079933All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium814Open in IMG/M
3300005577|Ga0068857_102212482All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium540Open in IMG/M
3300005614|Ga0068856_100282060All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1678Open in IMG/M
3300005712|Ga0070764_10016143All Organisms → cellular organisms → Bacteria3695Open in IMG/M
3300005841|Ga0068863_101806778All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium621Open in IMG/M
3300005841|Ga0068863_101902280All Organisms → cellular organisms → Bacteria → Proteobacteria605Open in IMG/M
3300005843|Ga0068860_100929025All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium887Open in IMG/M
3300005844|Ga0068862_100352829All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1365Open in IMG/M
3300005993|Ga0080027_10128900All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium962Open in IMG/M
3300006046|Ga0066652_101789355All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300006176|Ga0070765_101566135All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium620Open in IMG/M
3300006358|Ga0068871_100949808All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium799Open in IMG/M
3300006953|Ga0074063_13749419All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300009078|Ga0105106_10631749All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium766Open in IMG/M
3300009093|Ga0105240_10975381All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium908Open in IMG/M
3300009098|Ga0105245_10581244All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1145Open in IMG/M
3300009162|Ga0075423_11941169All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium636Open in IMG/M
3300009176|Ga0105242_11200748All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium778Open in IMG/M
3300009176|Ga0105242_12593121All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300009177|Ga0105248_11672882All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium721Open in IMG/M
3300009545|Ga0105237_10710797All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1011Open in IMG/M
3300010352|Ga0116247_10235105All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1499Open in IMG/M
3300010359|Ga0126376_12394597All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium575Open in IMG/M
3300010362|Ga0126377_12996438All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium545Open in IMG/M
3300010371|Ga0134125_12378238All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium576Open in IMG/M
3300010399|Ga0134127_13607780All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium508Open in IMG/M
3300010400|Ga0134122_11752732All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium651Open in IMG/M
3300010403|Ga0134123_11561375All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium706Open in IMG/M
3300010869|Ga0126359_1319115All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium612Open in IMG/M
3300010869|Ga0126359_1345477All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2481Open in IMG/M
3300011443|Ga0137457_1019073All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1777Open in IMG/M
3300012122|Ga0137332_1043321All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300012891|Ga0157305_10210347All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium563Open in IMG/M
3300012901|Ga0157288_10051281All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium961Open in IMG/M
3300012902|Ga0157291_10035934All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1097Open in IMG/M
3300012912|Ga0157306_10472564All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium508Open in IMG/M
3300012913|Ga0157298_10285624All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium577Open in IMG/M
3300012929|Ga0137404_10130803All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2065Open in IMG/M
3300012944|Ga0137410_11322689All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium624Open in IMG/M
3300012988|Ga0164306_11916774All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium515Open in IMG/M
3300013296|Ga0157374_12965845All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300014325|Ga0163163_11851109All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium664Open in IMG/M
3300014326|Ga0157380_12926057All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium544Open in IMG/M
3300014498|Ga0182019_10773696All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium685Open in IMG/M
3300014502|Ga0182021_12209713All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium662Open in IMG/M
3300014839|Ga0182027_11509966All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium660Open in IMG/M
3300015359|Ga0134085_10575841All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300015371|Ga0132258_13558143All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1066Open in IMG/M
3300015374|Ga0132255_103279129All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium690Open in IMG/M
3300016294|Ga0182041_11084218All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium727Open in IMG/M
3300016730|Ga0181515_1389028All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium653Open in IMG/M
3300018920|Ga0190273_10841654All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium734Open in IMG/M
3300019356|Ga0173481_10822162All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300019361|Ga0173482_10717198All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium519Open in IMG/M
3300020034|Ga0193753_10111938All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1347Open in IMG/M
3300021180|Ga0210396_10573523All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium983Open in IMG/M
3300021406|Ga0210386_10269540All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1455Open in IMG/M
3300021407|Ga0210383_11137667All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium658Open in IMG/M
3300021474|Ga0210390_11121684All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium638Open in IMG/M
3300022519|Ga0224543_1001479All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium931Open in IMG/M
3300024232|Ga0247664_1149235All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300024317|Ga0247660_1013024All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1282Open in IMG/M
3300025504|Ga0208356_1043357All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium909Open in IMG/M
3300025903|Ga0207680_10745505All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium702Open in IMG/M
3300025910|Ga0207684_11025610All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium689Open in IMG/M
3300025914|Ga0207671_10445517All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1031Open in IMG/M
3300025924|Ga0207694_10015416All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales5763Open in IMG/M
3300025927|Ga0207687_11912739All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium507Open in IMG/M
3300025936|Ga0207670_10981109All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium710Open in IMG/M
3300025960|Ga0207651_10228838All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1508Open in IMG/M
3300025961|Ga0207712_11680857All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium569Open in IMG/M
3300025972|Ga0207668_10937692All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium772Open in IMG/M
3300025972|Ga0207668_11244043All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium669Open in IMG/M
3300025986|Ga0207658_10311216All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1360Open in IMG/M
3300026041|Ga0207639_10682160All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium952Open in IMG/M
3300026088|Ga0207641_11818699All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium611Open in IMG/M
3300026281|Ga0209863_10085847All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium928Open in IMG/M
3300026281|Ga0209863_10231458All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300027735|Ga0209261_10086785All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium807Open in IMG/M
3300027867|Ga0209167_10596383All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium605Open in IMG/M
3300027909|Ga0209382_12257859All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300028379|Ga0268266_10622074All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1038Open in IMG/M
3300028381|Ga0268264_10863749All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium907Open in IMG/M
3300028811|Ga0307292_10498157All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium522Open in IMG/M
3300029980|Ga0302298_10290449All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium544Open in IMG/M
3300029984|Ga0311332_10739170All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium783Open in IMG/M
3300030000|Ga0311337_11016220All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium723Open in IMG/M
3300030010|Ga0302299_10344866All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium768Open in IMG/M
3300030114|Ga0311333_11304421All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium622Open in IMG/M
3300030294|Ga0311349_10086363All Organisms → cellular organisms → Bacteria2909Open in IMG/M
3300030294|Ga0311349_11515500All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium622Open in IMG/M
3300031184|Ga0307499_10335586All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium508Open in IMG/M
3300031226|Ga0307497_10649248All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium539Open in IMG/M
3300031232|Ga0302323_100280472All Organisms → cellular organisms → Bacteria → Proteobacteria1720Open in IMG/M
3300031240|Ga0265320_10252213All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium783Open in IMG/M
3300031538|Ga0310888_10319506All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium892Open in IMG/M
3300031543|Ga0318516_10271309All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium981Open in IMG/M
3300031713|Ga0318496_10031993All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales2663Open in IMG/M
3300031754|Ga0307475_10294508All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1302Open in IMG/M
3300031764|Ga0318535_10352977All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium657Open in IMG/M
3300031799|Ga0318565_10628048All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300031805|Ga0318497_10054018All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2078Open in IMG/M
3300031833|Ga0310917_10088735All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1972Open in IMG/M
3300031897|Ga0318520_11067177All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium511Open in IMG/M
3300031910|Ga0306923_11422322All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium729Open in IMG/M
3300031954|Ga0306926_12449789All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300032010|Ga0318569_10020562All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales2650Open in IMG/M
3300032013|Ga0310906_10407969All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium899Open in IMG/M
3300032052|Ga0318506_10434313All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium582Open in IMG/M
3300032074|Ga0308173_10505532All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1083Open in IMG/M
3300032074|Ga0308173_11353778All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium667Open in IMG/M
3300032075|Ga0310890_10613118All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium843Open in IMG/M
3300032089|Ga0318525_10587752All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium568Open in IMG/M
3300032157|Ga0315912_10965093All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium677Open in IMG/M
3300033412|Ga0310810_11093176All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium665Open in IMG/M
3300033418|Ga0316625_100253275All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1211Open in IMG/M
3300033433|Ga0326726_10101908All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae2571Open in IMG/M
3300033486|Ga0316624_11955315All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium544Open in IMG/M
3300033493|Ga0316631_10443921All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium541Open in IMG/M
3300033891|Ga0334811_016339All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2082Open in IMG/M
3300034004|Ga0334926_017229All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1221Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.26%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen5.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.97%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.31%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.65%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.99%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.99%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.99%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil1.99%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.99%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.99%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.99%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.32%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.32%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.32%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.32%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.32%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.32%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.32%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.32%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.66%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.66%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.66%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.66%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.66%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.66%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.66%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.66%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.66%
Hypolithic BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust0.66%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.66%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.66%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.66%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010352AD_JPHWcaEngineeredOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010869Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011443Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2EnvironmentalOpen in IMG/M
3300012122Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT200_2EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016730Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300022519Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 1-5EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024317Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01EnvironmentalOpen in IMG/M
3300025504Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026281Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)EnvironmentalOpen in IMG/M
3300027735Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300029980Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3EnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030010Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031238Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaGHost-AssociatedOpen in IMG/M
3300031240Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaGHost-AssociatedOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033493Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_AEnvironmentalOpen in IMG/M
3300033891Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-DEnvironmentalOpen in IMG/M
3300034004Biocrust microbial communities from Mojave Desert, California, United States - 22HNCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0063455_10028309813300004153SoilVSPEANNTFESTKFGRFIQTYSSFLSSFVIGVAGLIATSVWQYRQSQTAAENARSEQAIAKTKAENDWRITRAEILSKNLNVLSTQGANTADQRFGVLLSLTRGSIIDPELAVSYALELGKDNASYMR
Ga0062589_10086355423300004156SoilVADESDKSGGNAKKRSKLAKFLQEYHGPLSTLFLGLAGLIATSIWQYRQSVTSAQQAKSEQAIARTKADNDWRIARAEILSKNLNILSTQGPQTADQRFGVLLSLTRGAILDPELAVSYALELGKDNASYMRAVL
Ga0062592_10051833113300004480SoilVGAEEDKAAGDSTPPPAKKSRLAKFIQEYHGALSTLFLGVAGLIATSIWQYRQSITAAEAAKSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQSADQRFGVLLSLTRGAILDPELAVSYALELGKDN
Ga0062591_10037393923300004643SoilVAEESDKGGGESGAKKKSKLAKFFQEYHGPLSTLFLGVAGLIATSIWQFRQSVTAAEQAKSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQTADQRFGVLLSLTRGAILDPELAVSYALELGKD
Ga0062591_10154014513300004643SoilVGAEEDKAAGDSTPPPAKKSRLAKFIQEYHGALSTLFLGVAGLIATSIWQYRQSITAAEAAKSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQSADQRFGVLLSLTRGAILDPELAVSYALELGKDNA
Ga0070690_10133390413300005330Switchgrass RhizosphereVAEESDKSGGASGGTRKSKLAKFFQEYHGPLSTLFLGVAGLIATSIWQFRQSVTTAEQAKSEQAIARTKADNDWRIARAEILSKNLDVLSKQGPQSADQRFGVLLSLTRGAILDPELAVSYALELGKDNASYMRAVL
Ga0070666_1052946023300005335Switchgrass RhizosphereVPEAADKSAGEPSKKSKLAKFIQEYHGALSTLFLGVAGLIATSIWQYRQSVTAAKQAASEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQTADQRFGVLLSLTRGAILDPELAVSYALELGKDN
Ga0070682_10042030023300005337Corn RhizosphereLPAVSGDSDSDGKKSDRPAKQEPPPDRPSRVGRFLQTYSSFLSSFVIGVAGLVATSIWQYRQSQIATEQSRSEQAIARTKAENDWRIARAEILSKNLNVLSLQGPASADQRFGVLLSLTRSSIIDPELAVSYAL
Ga0068868_10021337913300005338Miscanthus RhizosphereMSEPSSREKSLPGDGSKSTLPPSRFGHFIQTYSGFLSSFVIGVAGLVATSIWQYRQSVNAEKAAASEQAIAQTKAENDWRIARAEILAKNLNVLSTQGPTTADQRFGVLLSLTRGSIIDPELAVSYALELGK
Ga0070688_10167344913300005365Switchgrass RhizosphereVSGDEDKAAGGSAGKKSRLAKFIQEYHGALSTLFLGLAGLIATSIWQYRQSVTAEAGAKSEQAIARTKADNDWRIARAEILSKNLNVLSTTGPQSADQRFGVLLSLTRGAILDPELAVSYALELGKDNASYMR
Ga0070667_10169953713300005367Switchgrass RhizosphereVGEDEDKGSANAGRKSKLAKFIQEYHGALSTLFLGLAGLVATSIWQYRQSVTAAAQAKSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQTADQRFGVLLSLTRGAILDPELAVSYALELGKDNASYMRAVL
Ga0070714_10217708523300005435Agricultural SoilVSDEEHKSGSEKPGPGAQESRLGQFIQKYSSFLSSFVIGVAGLFATSIWQYRQSQIAAQQAKSEQEMTRTKAENDWRIARAEILSKNLNILSGTGPGSADQKFGVLLSLTRGAIIDPEL
Ga0070713_10105546213300005436Corn, Switchgrass And Miscanthus RhizosphereVADHEPSKFGHFIQTYSAFLSSFVIGVAGLIATSIWQYRQSQIAEEQSHAQQAAAKAKADSDWRIARAEILGKNLNVLSAQGANTADQRFGVLLSLTRGNIIDPELAVSYALELGRDNADYMRSVLAST
Ga0070701_1087876413300005438Corn, Switchgrass And Miscanthus RhizosphereMADSQPETGSAFARFIQTYSTFLSTFVIGVAGLVATSIWQYRQGEISRTQAEAQTEMAREKARSDWRIARAEILAKNLDVLSTQKPETADKRFGVLLSLTRGDMIDAELAVSYALELGKDSPLYMRTILGSTKDKNYHQLA
Ga0070685_1007912413300005466Switchgrass RhizosphereVAEESDKSGGASGGTRKSKLAKFFQEYHGPLSTLFLGVAGLIATSIWQFRQSVTTAEQAKSEQAIARTKADNDWRIARAEILSKNLDVLSKQGPQSADQRFGVLLSLTRGAILDPELAVSYALELGKDNASYMRAVLEAT
Ga0070706_10104140613300005467Corn, Switchgrass And Miscanthus RhizosphereMSTPTPPSGPSRLGHFIQTYSSFLSSFVIGVAGLVATSIWQYRQSQTAAHSAASEQAIAKTKAENDWRIARAEILAKNLNVLASQAPDSADQRFGVLLSLTRGSILDPELAV
Ga0070698_10140293523300005471Corn, Switchgrass And Miscanthus RhizosphereMADTQPETGSAFARFIQTYSTFLSTFVIGVAGLVATSIWQYRQGEISRTQAEAQTEMAREKARSDWRIARAEILAKNLDVLSTQKPETADKRFGVLLSLTRGDMIDAELAVSYALELGKDSPLYMRTILGSTK
Ga0070679_10121204723300005530Corn RhizosphereVAADEQTSDGDNGAKKKSRLAKFFQEYHGPLSTLFLGLAGLIATSIWQYRQSVTSAQAAKSEQAIARTKADNDWRIARAEILSKNLNVLSTTGPQTADQRFGVLLSLTRGAILDPELAVSYALELGKDNASYMRAVLEAT
Ga0070665_10107993313300005548Switchgrass RhizosphereMFPPIMSTPTPPAGPSRLGHFIQTYSSFLSSFVIGVAGLVATSIWQYRQSQTAANTAASEQAIAKTKAENDWRIARAEILAKNLNVLASQAPDTADQRFGVLLSLTRGSILDPELAVSYALELGKDNP
Ga0068857_10221248213300005577Corn RhizosphereMSTPTPTPTPPSGPSRLGHFIQTYSSFLSSFVIGVAGLVATSIWQYRQSQTAAHTAASEQAIAKTKAENDWRIARAEILAKNLNVLASQAPDSADQRFGVLLSLTRGSILDPELAVSY
Ga0070762_1115439913300005602SoilLRKAAYSLVVSDETNPTAEKSTAREEVSKLGKFIQTYSAFLSSFVIGVAGLVATSIWQYRQSQIASAQAHSEQVIATTKAENDWRIARADILSKNLNVLSAQGPGSADQKFGVLL
Ga0068856_10028206033300005614Corn RhizosphereVSAEGDRSGQADSAGEERPSRLGRFIQTYSAFLSSFVIGVAGLVATSIWQYRQSQISAQQAKSEQVIAQTKAENDWRIARAEILSKNLNILSGQGPGSADQKFGVLLSLTRGAIIDPELAVSYAMELGKQNPTYMRTVLEATAQKNY
Ga0070764_1001614343300005712SoilVTTDNEDGDAPAVGSPPEKVSKLGKFIQTYHGFLSSFVIGVAGLVATSIWQYRQSQIAAQQAHSEQTIAETKAENDWRIARAEILSKNLNVLSAQGPGSADQRFGVLLSLTRGAIIDPELAVSYALELGKDNASY
Ga0068863_10180677813300005841Switchgrass RhizosphereMSDDGEPTAAQDGRTTRLGKFIQTYHGFLSSFVIGVAGLIATSIWQYRQSEVAAKQALSEQAIAKTKADNDWRIARAEILSKNLNVLSTQGPQSADQRFGVLLSLTRGAILDPELAVSYALELGKDNPSYMRSVLEATAQKNYNQL
Ga0068863_10190228023300005841Switchgrass RhizosphereVSAEEGKGGGPSDEPKPTGTLSRLGKFIQTYHSFLSSFVIGVAGLVATSIWQYRQSQIASQQARSEQAIAQTKAENDWRIARAEILSKNLNVLSAQGPGSADQRFGVLLSLTRGAIIDPELAVS
Ga0068860_10092902513300005843Switchgrass RhizosphereMGESSPPDKSHPADGSKGAVQPSRFGHFIQTYSGFLSSFVIGVAGLVATSIWQYRQSVNAEKAAVSEQAIAQTKAANDWRIARAEILAKNLSVLSSQGPETADQRFGVLLSLTRGSILDPELAVSYALELGKVNPDYMRSVL
Ga0068862_10035282933300005844Switchgrass RhizosphereVSDPTPPPPSRIGVFIEKYSSFLSSFVIGLAGLIATSIWQYRQSENARVEADTQRRLAQEKAANDWKIARAEILAKNLDVLATQGPGAADRKFGVLLSLTRGNILDPELAVSYALELGK
Ga0080027_1012890023300005993Prmafrost SoilMSGEDEGGSPDDPKATEKLSKLGRFIQTYHGFLSSFVIGVAGLVATSIWQYRQSEIASQQARSEQSIAQTKAENDWRIARAEILSKNLNVLSAQGPGSADQRFGVLLSLTRGAIIDPELAVSYAMELGKDNPTYMR
Ga0066652_10178935513300006046SoilVGADDDKKDSAAAGGDKKKSKLAKFLQEYHGPLSTMFLGLAGLIATSIWQFRQSVTAAEQAKSEQAIARTKADNDWRIARAEILSKNLNVLSTTGPSTADQRFGVLLSLTRGAILDPELAVSYALELGKDNASYMRAVLEA
Ga0070765_10156613513300006176SoilVSDDEKPATEPKTAREEVTKLGKFIQTYSAFLSSFVIGVAGLVATSIWQYRQSQIASAQAQSEQAIAATKAENDWRIARADILSKNLTVLSGQGPGSADQKFGVLLSLSRGQIIDPELAV
Ga0068871_10094980813300006358Miscanthus RhizosphereVADESDKSGGNAKKRSKLAKFLQEYHGPLSTLFLGLAGLIATSIWQYRQSVTSAQQAKSEQAIARTKADNDWRIARAEILSKNLNILSTQGPQTADQRFGVLLSLTRGAILDPELAMS
Ga0074063_1374941923300006953SoilVADHEPSKFGHFIQTYSAFLSSFVIGVAGLIATSIWQYRQSQIAEEQSHAQQAAAKAKADSDWRIARAEILGKNLNVLSAQGANTADQRFGVLLSLTRGNIIDPELAVSYALELGRDNADYMRSVLASTSDKNYWQLAQAFK
Ga0105106_1063174923300009078Freshwater SedimentMTPAGESPKHDDHPPSRMGKFIQTYSSFLSSFVIGVAGLVATSIWQYRQSQNAIKQAESEQKIATTKAENEWRIARAEILAKNLNVLSTQGPATADQRFGVLLSLTRGAILDPELAGSYALELGKDNVQYMRDVLAATERKN
Ga0105240_1097538113300009093Corn RhizosphereVSADDESGGEEKAAPTASKLGRFIQTYHGFLSSFVIGVAGLVATSIWQYRQSQIAAQQAHSEQAIAQTKAENDWRIARAEILSKNLNVLSAQGPGSADQRFGVLLSLTRGAIIDPELAVSYAMELGKDNPTYMRTVLEATGQKNYQQ
Ga0105245_1058124423300009098Miscanthus RhizosphereVAPEEHSKFGRFIQTYSAFLSSFVIGVAGLIATSIWQYRQSQIAEEHARSEQATARVKADNDWRIARAEILGKNLGVLSAQGAGTADQRFGVLLSLTRGNIIDPELAVSYALELGRDNASYMRAVLSSTSDKNYS
Ga0075423_1194116913300009162Populus RhizosphereVGAEEDKAAGDSNPPPAKKSRLAKFIQEYHGALSTLFLGVAGLIATSIWQYRQSITAAEAAKSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQSADQRFGVLLSLTRGAILDPELAVSYALEL
Ga0105242_1120074813300009176Miscanthus RhizosphereVAEESDKSGGASGGTRKSKLAKFFQEYHGPLSTLFLGVAGLIATSIWQFRQSVTTAEQAKSEQAIARTKADNDWRIARAEILSKNLDVLSKQGPQSADQRFGVLLSLTRGAILDPELAVSYAL
Ga0105242_1259312113300009176Miscanthus RhizosphereVAESADKSAGEPSKKSKLAKFIQEYHGALSTLFLGVAGLIATSIWQYRQSVTAAKQAASEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQTADQRFGVLLSLTRGAILDPELAVSYALELGRDNASYMRAVLSSTSDKNY
Ga0105248_1167288213300009177Switchgrass RhizosphereVAEESDKGGGTKKSKLAKFFQEYHGPLSTLFLGVAGLIATSIWQFRQSVTTAEQAKSEQAIARTKADNDWRIARAEILSKNLDVLSKQGPQSADQRFGVLLSLTRGAILDPELAVSYALELGKDNAS
Ga0105237_1071079723300009545Corn RhizosphereMFTPMSSDGASKPDELSKIGRFIQTYSSFLSSFVIGVAGLVATSIWQYRQSQTAARQAESEQTIARTKADNDWRIARAEILAKNLNVLSAQGPQTADQRFGVLLSLTRGNILDPELAVSYALELGKDNA
Ga0116247_1023510513300010352Anaerobic Digestor SludgeMLSPMPDAPTPSPHEPSRLGRFIQSYSGFLSSFVIGVAGLVATSIWQFRQAQNAERQQASEQAIARTKAENEWRIARAEILAKNLQVLTQQGPNSADQRFGVLLSLTRGNILDPELAISYALE
Ga0126376_1239459723300010359Tropical Forest SoilVAADEDKTAGNDRKKSKLAKFFQEYHGPLSTLFLGLAGLIATSIWQFRQSVTAAEQAKSEQAIARTKADNDWRIARAEILSKNLNVLSTTGPNTADQRFGVLLSLTRGAILDPELAVSYALELGKDNASYMRA
Ga0126377_1299643823300010362Tropical Forest SoilMSDDDEPTAAQGDRTTRLGKFIQTYHGFLSSFVIGVAGLIATSIWQYRQSEVAAKQALSEQAIAKTKADNDWRIARAEILSKNLNVLSAQGPASADQRFGVLLSLTRGSIIDPELAVSYALELGKDNAAYMRAVLES
Ga0134125_1237823823300010371Terrestrial SoilVSDDEHKTGGEKPGFGAQESRLGQFIQKYSSFLSSFVIGVAGLFATSIWQYRQSQIAAQQAKSEQEMTRTKAENDWRIARAEILSKNLNILSGTGPGSADQKFGVLLSLTRGSIIDPELAVSYAMELGKENPTYMR
Ga0134124_1298264023300010397Terrestrial SoilVSDPAPAEEHRPSKLGHFIQTYSGFLSSFVIGVAGLIATSIWQYRQSQIAVEQARSEQAAARAKADSDWRIARAEILSKNLNVLSAQGPDTADQRFGVLLSLTRGAIIDPELAVS
Ga0134127_1360778013300010399Terrestrial SoilVGAEEDKAAESSNPPPAKKSRLAKFIQEYHGALSTLFLGVAGLIATSIWQYRQSITAAEAAKSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQSADQRFGVLLSLTRGAILDPELAVSYALELGKDNPSYMRSVLEA
Ga0134122_1175273223300010400Terrestrial SoilVSDNPTPPLPSTPSRLGHFIEKYSSFLSSFVIGLAGLIATSIWQYRQSENARVEADTQRRLAQEKAANDWKIARAEILAKNLDVLGTQGPGSADRKFGVLLSLTRGNILDPELAVSYALELGKENPYY
Ga0134123_1156137523300010403Terrestrial SoilMFPAMAESSSGSGHDGAMRPSRLGYFIQTYSGFLSSFVIGVAGLVATSIWQYRQSLNAEKQAISEQAIAKTKAENDWRIARAEILAKNLSILSSQSPDSADQRFGVLLSLTRGSILDPELAVSYALELGRV
Ga0126359_131911523300010869Boreal Forest SoilVSAEDEAGDEPKPGGSPSKLGRFIQTYHSFLSSFVIGVAGLVATSIWQYRQSQIASQQARSEQSIAQTKAENDWRIARAEILSKNLNVLSAQGPGSADQRFGVLLSLTRGAIIDPELAVSYAVEL
Ga0126359_134547743300010869Boreal Forest SoilVSDDTPQHQTSKFGHFIQTYSSFLSSFVIGVAGLVATSVWQYRQSKNAEQQAVSDQAIARTKADNDWRITRADILSKNLNVLSTQGPNTADQRFGVLLSLTRGAIIDPELAVSYALELGKDNASYMRSVLESTA
Ga0137457_101907313300011443SoilVSAESEDPKKAPEGKPPEPAAALRASRLGRFIEKYHTFLSSFVIGVAGLIATSIWQYRQSQIATEQARSEQAIARTKADNDWRIARAEILSKNLNVLSTSGPGSADQRFGVLLSLTRGSIIDPELAVSYALELGKDNAGYMRAVLEAT
Ga0137332_104332113300012122SoilVGAEEDKAAGNSTPPAAKKSQRAKFAQEYHGALSTLFLGVAGLIATSIWQYRQSITAAQAAKSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPGTADQRFGVLLSLTRGAILDPELAVSYALELGKDNAGYMRAVLE
Ga0157305_1021034723300012891SoilVTDAADKPAGGPSKKSRLAKFIQEYHGALSTLFLGVAGLIATSIWQYRQSVTAAEAAKSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQSADQRFGVLLSLTRGAILDPELAVSYALELGKDNPGYMRSVLEATAQ
Ga0157288_1005128123300012901SoilVADESDKGGGDAKKRSKLAKFLQEYHGPLSTLFLGLAGLIATSIWQYRQSVTSAQQAKSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQSADQRFGVLLSLTRGAILDPELAVSYA
Ga0157291_1003593423300012902SoilVTDAADKPAGGPSKKSRLAKFIQEYHGALSTLFLGVAGLIATSIWQYRQSVTASEAAKSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQSADQRFGVLLSLTRGAILDPELAVSYALELGKDNPGYMRSVLEAT
Ga0157306_1047256423300012912SoilVTDAADKPAGGPSKKSRLAKFIQEYHGALSTLFLGVAGLIATSIWQYRQSQIATEQSRSEQAIARTKADNDWRIARAEILSKNLNVLSLQGPASADQRFGVLLSLTRGSIIDPELA
Ga0157298_1028562423300012913SoilVAEADKSAGEPSKKSKLAKFIQEYHGALSTLFLGVAGLIATSIWQYRQSVTAAKQAASEQAIARTKADNDWRIARAEILSKNLTVLSTQGPQTADQRFGVLLSLTRGAILDPELA
Ga0137404_1013080313300012929Vadose Zone SoilVAADEPSKFGRFIQTYSAFLSSFVIGVAGLIATSIWQYRQSQIAVEQARSEQAAARSKADSDWRIARAEILAKNLGVLSAQGANTADQRFGVLLSLTRGNIIDPELAVSYALELGRDNASYMRSV
Ga0137410_1132268923300012944Vadose Zone SoilVSDEPSPDATKVGRFIQTYSSFLSSFVIGVAGLIATSVWQYRQSLTAAEQARSEQAIAKTKAENDWRIARAEILSKNLNVLSTQGPNTADQRFGVLLSLTRGSIIDPELAVSYALELGKDNASYMRSVL
Ga0164306_1191677423300012988SoilVSAEDQEGGGPSDETKATGTLSRLGKFIQTYHSFLSSFVIGVAGLVATSIWQYRQSQIASQQARSEQAIAQTKAENDWRIARAEILSKNLNVLSAQGPGSADQRFGVLLSLTRGAIIDPELAVSYAMELGKDN
Ga0157374_1171632513300013296Miscanthus RhizosphereVADHEPSKFGHFIQTYSAFLSSFVIGVAGLIATSIWQYRQSQIAEEQSHAQQAAAKAKADSDWRIARGEILGKNLNVLSAQGANTADQRFGVLLSLTRGNIIDPELAV
Ga0157374_1296584523300013296Miscanthus RhizosphereMSEPSSREKSLPGDGSKSTLPPSRFGHFIQTYSGFLSSFVIGVAGLVATSIWQYRQSVNAEKAAASEQAIAQTKAENDWRIARAEILAKHLSVLSSQAPETAAQRFGVLLSLTSGPTLAPDLAA
Ga0163163_1185110923300014325Switchgrass RhizosphereMPDSTETTAGGAFARFIHTYSTFLSTFVIGVAGLVATSIWQYRQGEISRTQAEAQTEMAREKARSDWRIARAEILAKNLDVLSTQKPETADKRFGVLLSLTRGDMIDAELAVSYALELGKDS
Ga0157380_1292605713300014326Switchgrass RhizosphereVSAKNDNSGAGSDKPDHSKLGRFIQTYSSFLSTFVIGVAGLAATSIWQYRQSLTAAEAARSEQTIARTKADNDWRIARAEILAKNLTILSTQGPQTADQRFGVLLSLTRGAILDPELAVSYALELGKDNPSYMRAVLEATAQK
Ga0182019_1077369623300014498FenMSSSEEPEEHEDTSRVGRFIQTYSSFLSSFVIGVAGLVATSIWQYRQSQTALRQAESEQKIAATKAENEWRIARAEILAKNLNVLSMQGPSSADQRFGVLLSLTRGAILDPELAVSYALELGKDNA
Ga0182021_1220971313300014502FenMAETPAAHDNSSRLGRFIQNYSGFLSSFVIGVAGLVATSIWQFRQAQNAERQQASEQAIARTKADNDWRIARAEILGKNLSVLSQQGPQTVDQRFGVLLSLSRGNILDPELAVSYALELGRDNPTYMGVVLAGTT
Ga0182027_1150996623300014839FenMSAEDQTPKHDEPEPSRMGKFIQNYSTFLSTFVIGVAGLVATSIWQYRQSQTAVKQAESEQKIAATKADNEWRIARAEILAKNLNVLSTQGPNTADQRFGVLLSLTRGAILDPELAISYALELGKDNARYMHDVLAATEHKNYQ
Ga0134085_1057584113300015359Grasslands SoilMGGSPAPEKSPPAKAELVPSRLGHFIQTYSSFLSSFVIGVAGLVATSIWQYRQSVNAANAAASEQAIAKTKAENDWRIARAEILAKNLGVLASQAPDSADQRFGVLLSLTRGNILDPELAVSYALELGKVNPDYMRSVLG
Ga0132258_1355814313300015371Arabidopsis RhizosphereVSGESDSGENKSGSRSEPERAEHERVSRLGRFLQTYSSFLSSFVIGVAGLVATSIWQYRQSQIATEQARSEQAIARTKAENDWRIARAEILSKNLNVLSTQGPGSADQRFGVLLSLTRGSIIDPELAVS
Ga0132255_10327912913300015374Arabidopsis RhizosphereVAEEADKATGEAAPKKSKLAKFLQEYHGAVSTLFLGVAGLVATSIWQYRQSITTAAQAQSEQAIARTKADNDWRIARAEILSKNLNVLSTTGPNSADQRFGVLLSLTRGAILDPELAVSYALELGKDN
Ga0182041_1108421813300016294SoilVSGDAESEGGTSGGGAPAGHGWAARLGQFIQTYHSFLSSFVIGVAGLVATSIWQYRQSQTAAEQARSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPGSADQRFGVLLSLTRGAIIDPELAVSYALELGKDNA
Ga0181515_138902823300016730PeatlandMAETPAAPDNTSRLGRFIQNYHGFLSSFVIGVAGLVATSIWQFRQAQNAERQQASEQAIARTKADNDWRIARAEILGKNLSVLSQQGPQTADQRFGVLLSLTRGNILDPELAVSYALELGRDNPTYMRVVLAGTASKNYTQLEQ
Ga0190271_1098005923300018481SoilMGDDGTDKKPGSRVGSFIQTYHSFLSSFVIGAAGLVATSIWQYRQSEISGKQAESQQQIAKAQADNNWRIERAEILSKNLDVLSASGPETVERRYGVLLSLTRGSILDPELAVSYALELGKDSPSYM
Ga0190273_1084165423300018920SoilMAMNDRNTYVDNAGRFGRFIQAYSSFLSTFVIGAAGLVATSIWQYRQSEMAAKQAESQQKIAITQADNNWRIERAEILAKNLGVLSSAGPESVESRYGALLSLTRGSILDRGLAVSYALELGKDK
Ga0173481_1082216213300019356SoilVADESDKGGGDAKKRSKLAKFLQEYHGPLSTLFLGLAGLIATSIWQYRQSVTSAQQAKSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQSADQRFGVLLSLTRGAILDPELAVSYALELGKDNAGY
Ga0173482_1071719813300019361SoilVAEESDKSGGASGGTRKSKLAKFFQEYHGPLSTLFLGVAGLIATSIWQFRQSVTTAEQAKSEQAIARTKADNDWRIARAEILSKNLTILSTQGPQTADQRFGVLLSLTRGAILDPELAVSYALELGKDNPSYMR
Ga0193753_1011193823300020034SoilMGRFIQTYSGFLSSFVIGVAGLVATSIWQYRQSQTAAEQGRSEQAIARTKADNDWRIARAEILSKNLNVLSAQGSNTADQKFGVLLSLTRGSIIDPELAVSYALELGKDNAGY
Ga0210396_1057352323300021180SoilVSDDDKPATDNKTAREEVTKLGKFIQTYSAFLSSFVIGVAGLVATSIWQYRQSQIASAQAQSEQAIAATKAENDWRIARADILSKNLTVLSGQGPGSADQKFGVLLSLSRGQIIDPELA
Ga0210387_1104206913300021405SoilVSDEIPPHRTTKFGHFIQTYSSFLSSFVIGVAGLIATSVWQYRQSQTAERQAISEQAIAKTKADNDWRITRADILSKNLNVLSTQGPNTADQRFGVLLSLPRGAIIDPDLAVS
Ga0210386_1026954013300021406SoilVSDDEKPATDAKTAREEVTKLGKFIQTYSAFLSSFVIGVAGLVATSIWQYRQSQIASAQAQSEQAIAATKAENDWRIARADILSKNLTVLSGQGPGSADQKFGVLLSLSRGQIIDPELAVSYAMELGKDNATYMRTVLEA
Ga0210383_1113766713300021407SoilVSAEDGEAGESSDEPGSTGKLSKLGKFIQTYHSFLSSFVIGVAGLVATSIWQYRQSQIASQQARSEQSIAQTKAENDWRIARAEILSKNLNVLSAQGPGSADQRFGVLLSLTRGAIIDPELAVSYAMELGKDNATYMRTV
Ga0210390_1112168423300021474SoilVSAEDEEGGGSPGQPPSTGKLSKLGRFIQTYHSFLSSFVIGVAGLVATSIWQYRQSQIASQQARSEQSIAQTKAENDWRIARAEILSKNLNVLSAQGPGSADQRFGVLLSLTRGAIIDPELAVSYAMEL
Ga0224543_100147913300022519SoilMGETPAAAHDNPSRLGRFIQNYSGFLSSFVIGVAGLVATSIWQFRQAQNAERQQASEQAIARTKADNDWRIARAEILGKNLSVLSQQGPQTADQRFGVLLSLSRGNILDPELAVSYALELGRDNPTYMRVVLAGTA
Ga0247664_114923523300024232SoilVADHEPSKFGHFIQTYSAFLSSFVIGVAGLIATSIWQYRQSQIAEEQSHAQQAAAKAKADSDWRIARAEILGKNLNVLSAQGANTADQRFGVLLSLTRGNIIDPELAVSYALELGRDNAD
Ga0247660_101302423300024317SoilVAEESDKSAGGSGGTKRSKLAKFFQEYHGPLSTLFLGVAGLIATSIWQFRQSVTAAEQAKSEQAIARTKADNDWRIARAEILSKNLDVLSKQGPQSADQRFGVLLSLTRGSILDPELAVSYALELGRDNASYMRAV
Ga0208356_104335713300025504Arctic Peat SoilMTAREEVTKLGKFIQTYSAFLSSFVIGVAGLVATSIWQYRQSQIASAQAQSEQAIAETKAENDWRIARADILSKNLTVLSGQGPGSADQKFGVLLSLSRGKIIDPELAVSYAMELGKQNATYMRT
Ga0207680_1074550513300025903Switchgrass RhizosphereVGEDEDKGSANAGRKSKLAKFIQEYHGALSTLFLGLAGLVATSIWQYRQSVTAAAQAKSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQTADQRFGVLLSLTRGAILDPELAVSYALELGKDNPSYMR
Ga0207684_1102561023300025910Corn, Switchgrass And Miscanthus RhizosphereMSTPTPPSGPSRLGHFIQTYSSFLSSFVIGVAGLVATSIWQYRQSQTAAHSAASEQAIAKTKAENDWRIARAEILAKNLNVLASQAPDSADQRFGVLLSLTRGSILDPELAVSYALEL
Ga0207671_1044551723300025914Corn RhizosphereMFTPMSSDGASKPDELSKIGRFIQTYSSFLSSFVIGVAGLVATSIWQYRQSQTAARQAESEQTIARTKADNDWRIARAEILAKNLNVLSAQGPQTADQRFGVLLSLTRGNILDPELAVSYALELGKDNATYMKSV
Ga0207694_1001541653300025924Corn RhizosphereMGESSPPDKSHPADGSKGAVQPSRFGHFIQTYSGFLSSFVIGVAGLVATSIWQYRQSVNAEKAAVSEQAIAQTKAANDWRIARAEILAKNLSVLSSQGPETADQRFGVLLSLTRGSILDPELAVSYALELGKVNPDYMRSVLA
Ga0207687_1191273913300025927Miscanthus RhizosphereMSEPSSREKSLPGDGSKSTLPPSRFGHFIQTYSGFLSSFVIGVAGLVATSIWQYRQSVNAEKAAASEQAIAQTKAENDWRIARAEILAKNLSVLSSQAPETADQRFGVLLSLTRGSILDPELAVSYALELGKVNPDYMRSVLA
Ga0207670_1098110913300025936Switchgrass RhizosphereVAEESDKGGGTKKSKLAKFFQEYHGPLSTLFLGVAGLIATSIWQFRQSVTTAEQAKSEQAIARTKADNDWRIARAEILSKNLDVLSKQGPQSVDQRFGVLLSLTRGAILDPELAVSYALELGKDNASYMRAVLEATAEKN
Ga0207651_1022883823300025960Switchgrass RhizosphereVSVKNDSGGAGADKPDHSRLGRFIQTYSSFLSTFVIGVAGLAATSIWQYRQSLTAQEQARSEQAIARTKADNDWRIARAEILAKNLTILSTQGPQTADQRFGVLLSLTRGAILDPELAVSYALELGKDNP
Ga0207712_1168085713300025961Switchgrass RhizosphereVAEESDKGGGTKKSKLAKFFQEYHGPLSTLFLGVAGLIATSIWQFRQSVTTAEQAKSEQAIARTKADNDWRIARAEILSKNLDVLSKQGPQSVDQRFGVLLSLTRGAILDPELAVSYALELG
Ga0207668_1093769213300025972Switchgrass RhizosphereVGAEEDKAAESSNPPPAKKSRLAKFIQEYHGALSTLFLGVAGLIATSIWQYRQSITAAEAAKSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPATADQRFGVLLSLTRGAILDPELAVSYALELGKDNAGYMRAVL
Ga0207668_1124404323300025972Switchgrass RhizosphereVAEESDKGGGESGAKKKSKLAKFFQEYHGPLSTLFLGVAGLIATSIWQFRQSVTAAEQAKSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQTADQRFGVLLSLTRGAILDPELAVSYALELGKDNPSYMRAVLE
Ga0207658_1031121613300025986Switchgrass RhizosphereVGEDEDKGSANAGRKSKLAKFIQEYHGALSTLFLGLAGLVATSIWQYRQSVTAAAQAKSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQTADQRFGVLLSLTRGAILDPELAVSYALELG
Ga0207639_1068216013300026041Corn RhizosphereVAEESDKGGGTKKSKLAKFFQEYHGPLSTLFLGVAGLIATSIWQFRQSVTTAEQAKSEQAIARTKADNDWRIARAEILSKNLDVLSKQGPQSVDQRFGVLLSLTRGAILDPELAVSYA
Ga0207641_1181869913300026088Switchgrass RhizosphereVAAEDNKAGNAGDGGPRRKSKLAKFLQEYHGPLSTLFLGLAGLVATSIWQYRQSVTSAQQAKSEQAIARTKADNDWRIARAEILSKNLNVLSAAGPQTADQRFGVLLSLTRGAILDPELAVSYALEL
Ga0209863_1008584713300026281Prmafrost SoilVSDETPPHKTTKFGHFIQTYSSFLSSFVIGVAGLIATSVWQYRQSQTAEKQAISEQAIARTKADNDWRITRADILSKNLGVLSTQGPNTADQRFGVLLSLTRGAIIDPELAVSYALELGKVNASYMRSVLAST
Ga0209863_1023145813300026281Prmafrost SoilMSGEDEGGSPDDPKATEKLSKLGRFIQTYHGFLSSFVIGVAGLVATSIWQYRQSEIASQQARSEQSIAQTKAENDWRIARAEILSKNLNVLSAQGPGSADQRFGVLLSLTRGAIIDPELA
Ga0209261_1008678513300027735Wetland SedimentMRRMAIGVAGLVATSIWQFRQAKNAERQQASEQAIARTKADNEWRIARAEILAKNLSVLTQQGPNSADQRFGVLLSLTRGNILDPELAISYALELGRD
Ga0209167_1059638323300027867Surface SoilVSAEDEEGGESTDEPQSTGKLSKLGKFIQTYHSFLSSFVIGVAGLVATSIWQYRQSQIASQQARSEQSIAQTKAENDWRIARAEILSKNLNVLSAQGPGSADQRFGVLLSLTRGAIIDPELAVSYAMELGKDNATYMRTVLEATG
Ga0209974_1020540413300027876Arabidopsis Thaliana RhizosphereVAEADKSAGEPSKKSKLAKFIQEYHGALSTLFLGVAGLIATSIWQYRQSVTAAKQAASEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQTADQRFGVLLSLTRGAILDP
Ga0209382_1225785913300027909Populus RhizosphereMADTPPPETGSGFARFIQTYSTFLSTFVIGVAGLVATSIWQFRQGEISRTQAEAQTEMAREKARSDWRIARAEILAKNLDVLSTQKPETADKRFGVLLSLTRGDMIDAELAVSYALELGKDSPLYMRTILGSTKEKNYHQLARTF
Ga0268266_1062207413300028379Switchgrass RhizosphereVPEAADKSAGEPSKKSKLAKFIQEYHGALSTLFLGVAGLIATSIWQYRQSVTAAKQAASEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQTADQRFGVLLSLTRGAILDPELAVSYALELGKDNPSYMRAVLEATAQKNYNQL
Ga0268264_1086374923300028381Switchgrass RhizosphereMGESSPPDKSHPADGSKGAVQPSRFGHFIQTYSGFLSSFVIGVAGLVATSIWQYRQSVNAEKAAVSEQAIAQTKAANDWRIARAEILAKNLSVLSSQGPETADQRFGVLLSLTRGSILDPELAVCYALELGKVNPDYMRSVLAS
Ga0307292_1049815713300028811SoilVAPEDSSKFGRFIQTYSAFLSSFVIGVAGLIATSIWQYRQSQIAEEHARSEQATARVKADNDWRIARAEILSKNLNILSTQGPQTADQRFGVLLSLTRGAILDPELAVSYALELGKD
Ga0302298_1029044913300029980FenMAETPTAAHDNPSRLGRFIQNYSGFLSSFVIGVAGLVATSIWQFRQAQNAERQQASEQAIARTTADNDWRIARAEILGKNLSVLSQQGPQTADQRFGVLLSLSRGNILDPELAVSYALELGRDNPTYMRVVLSGT
Ga0311332_1073917023300029984FenMTTEGESTKHDNIHSSRVGKFIQNYSTFLSTFVIGVAGLVATSIWQYRQSQTAIKQAESEQKIAATKADNEWRIARAEILAKNLNVLSTQGPNTVDQRFGVLLSLTRGAILDPELAVSYALELGKDNPSY
Ga0311337_1101622023300030000FenMSAEDETPKHDEPEPSRMGKFIQNYSTFLSTFVIGVAGLVATSIWQYRQSQTAVKQAESEQKIAATKADNEWRIARAEILAKNLNVLSTQGPNTADQRFGVLLSLTRGAILDPELAISYALELGKDNARYMHDVLA
Ga0302299_1034486613300030010FenVSAEDEEGGGPSSESRPSGTLSKVGKFIQTYHSFLSSFVIGVAGLVATSIWQYRQSQIASEQARSEQTIARTKAENDWRIARAEILSKNLNVLSAQGPGSADQRFGVLLSLTRGAIIDPELAVSYAMELGKDNATYMRTVL
Ga0311333_1130442113300030114FenMQQGYAPPMSEEHEPPKHDVHTSRLGKFIQNYSSFLSTFVIGVAGLVATSIWQYRQSQTALRQAESEQKIAATKADNEWRIARAEILAKNLNVLSTQGANTADQRFGVLLSLTRGAILDSELAVSYALELGKD
Ga0311349_1008636313300030294FenMTTEGESTKHDNIHSSRVGKFIQNYSTFLSTFVIGVAGLVATSIWQYRQSQTAMKQAESEQKIATTKAENEWRIARAEILAKNLNVLSTQGANTADQRFGVLLSLTRGAILDPELAVSYALELGK
Ga0311349_1151550023300030294FenVAEHEPSKFGRFIQTYSAFLSSFVIGVAGLIATSIWQYRQSQIAVEHERSEQAAARAKADSDWRIARAEILGKNLGVLSAQGANTADQRFGVLLSLTRGNIIDPELAVSYALELGRDNASYMRSVLASTGDK
Ga0307499_1033558613300031184SoilMGKPSSPEKPVATEASRSHLEPSRFGHFIQTYSGFLSSFVIGVAGLVATSIWQYRQSLNGEKAAASEQAIAKTKAENDWRIARAEILSKNLSVLATQGPNTADQRFGVLLSLTRGGIIDPELAVSYALELGKYNPDYMRSVL
Ga0307497_1064924813300031226SoilVGAEEDKAAGSASPPPAKKSKLAKFIQEYHGALSTLFLGVAGLIATSIWQYRQSITAAEAAKSEQAIARTKADNDWRIARAEILSKNLNILSTQGPQTADQRFGVLLSLTRGAILDPELAVSYALELGKDNPGYMRAVLE
Ga0170824_11302561823300031231Forest SoilVSAEDEEGGESSDETKSTGKLSKLGKFIQTYHSFLSSFVIGVAGLVATSIWQYRQSQIASEQARSEQTIARTKAENDWRIARAEILSKNLNILSAQGPGSADQRFGVLLSLTRGAI
Ga0302323_10028047213300031232FenMSAEKESPKHDDVQTSRLGKFIQAYSGFLSTFVIGVAGLVATSIWQYRQSQTAIRQAESEQKIAATKADNEWRIARAEILAKNLNVLSTQGPNTVDQRFGVLLSLTRGAILDPELAVSYALELG
Ga0265330_1023986413300031235RhizosphereMSAEDESPKPHDLHSSRMGKFIQTYSSFLSTFVIGVAGLVATSIWQYRQSQTALRQAESEQKIAATKADNEWRIARAEILAKNLNVLSTQGANSADQRFGVLLSLTRGAILD
Ga0265332_1041635813300031238RhizosphereMAETPAAHDNPSRLGRFIQNYSGFLSSFVIGVAGLVATSIWQFRQAQNAERQQASEQAIARTKADNDWRIARAEILGKNLSVLSLQGPQTVDQRFGVLLSLTRGNILDPELAVSYA
Ga0265320_1025221313300031240RhizosphereMSPDSESPKHDDIHSSRLGKFIQNYSTFLSTFVIGVAGLVATSIWQYRQSQTALRQAESEQKIAATKADNEWRIARAEILAKNLNVLSTQGANTADQRFGVLLSLTRGAILDPELAVS
Ga0310888_1031950613300031538SoilVAEESDKGGGESGAKKKSKLAKFFQEYHGPLSTLFLGVAGLIATSIWQFRQSVTAAEQAKSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQTADQRFGVLLSLTRGAILDPELAVSYALELGKDNPSYMRAVLEATAQKN
Ga0318516_1027130913300031543SoilVSAEPEAPADDKAKEPEKTTRLGRFIQTYHGFLSSFVIGVAGLVATSIWQYKQSQIASQQARSEQAIAKTKAENDWRIARAEILSKNLNVLSLQGPQSADQRFGVLLSLTRGAIIDPELAVSYALELGKDNPS
Ga0318496_1003199333300031713SoilVSGDAESEGGTSGGGAPAGHGWAARLGQFIQTYHSFLSSFVIGVAGLVATSIWQYRQSQTAAEQARSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPGSADQRFGVLLSLTRGAIIDPELAL
Ga0310813_1143620023300031716SoilVSDEHLQNATKFGRFIQTYSSFLSSFVIGVAGLIATSVWQYRQSQTAAEQAKSEQAIAKTKAENDWRITRAEILSKNLNVLSTQGPQSADQRFGVLLSLTRGAIIDPEQAVSY
Ga0307475_1029450823300031754Hardwood Forest SoilVRYRRPMPAGDPDVDERWRSEQQLSRFGAFVQTYHAFLSSFVIGAAGLIATSVWQYRQAETAAAAARSAQSIATTKAENDWRIARADILSKNLGVLTTQGPNTVGQRFGVLLSLARGRIIEPELSVAYALELGRDNPSFMRTILANTPDVNY
Ga0318535_1035297723300031764SoilVSGDAESEGAAGGGAAPAGHGWAARLGQFIQTYHSFLSSFVIGVAGLIATSIWQFRQSQTAAEQARSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPGSADQRFGVLLSLTRGAIIDPELAVSYALELGKDNASYMRAVLEATAQKNYN
Ga0318566_1002649233300031779SoilVSGDAESEGGTSGGGAPAGHGWAARLGQFIQTYHSFLSSFVIGVAGLVATSIWQYRQSQTAAEQARSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPGSADQRFGVLLSLTRGAIID
Ga0318565_1062804813300031799SoilTQTSGATTASTGSGIAHFTAGSSSHCMTTAGIIYWRRVSAEPEAPADDKAKEPEKTTRLGRFIQTYHGFLSSFVIGVAGLVATSIWQYKQSQIASQQARSEQAIAKTKAENDWRIARAEILSKNLNVLSLQGPQSADQRFGVLLSLTRGAIIDPELAVSYALELGKDNPSYM
Ga0318497_1005401813300031805SoilVSGDAESEGGTSGGGAPAGHGWAARLGQFIQTYHSFLSSFVIGVAGLVATSIWQYRQSQTAAEQARSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPGSADQRFGVLLSLTRGAIIDPELAVSYALELGKDNPSYMRAVLEATSDKNY
Ga0310917_1008873523300031833SoilVSGDAESEGGTSGGGAPAGHGWAARLGQFIQTYHSFLSSFVIGVAGLVATSIWQYRQSQTAAEQARSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPGSADQRFGVLLSLTRGAIIDPELAVS
Ga0318520_1106717713300031897SoilVSGDAESEGAAGGGAAPAGHGWAARLGQFIQTYHSFLSSFVIGVAGLVATSIWQYRQSQTAAEQARSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPGSADQRFGVLLSLTRGAIIDPELAVSYALELGKDNAS
Ga0302322_10112955023300031902FenMSDEHASPKHDDIHSSRLGKFIQNYSTFLSTFVIGIAGLVATSIWQYRQSQTAVKQAESEQKIAATKADNEWRIARAEILAKNLTVLSTQGPNTADQRFGVLLSLTRGAILDP
Ga0306923_1142232213300031910SoilVSGDAESEGAAGGGAAPAGHGWAARLGQFIQTYHSFLSSFVIGVAGLVATSIWQYRQSQTAAEQARSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPGSADQRFGVLLSLTRGAIIDPELAVSYA
Ga0306926_1244978913300031954SoilVSDEDDGAAGAEKSPSGGRVSRLGKFIQTYHSFLSSFVIGVAGLVATSIWQYRQSQISAQQAKSEQEIAKTKAENDWRIARAEILSKNLNVLSGSGPGSADQKFGVLLSLTRGSIIDPELAVSYAMELGKENPTYMRTVLEATA
Ga0318569_1002056233300032010SoilVSGDAESEGGTSGGGAPAGHGWAARLGQFIQTYHSFLSSFVIGVAGLVATSIWQYRQSQTAAEQARSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPGSADQRFGVLLSLTRGAIIDPELAVSYALELGKDN
Ga0310906_1040796913300032013SoilVAEESDKGGGESGAKKKSKLAKFFQEYHGPLSTLFLGVAGLIATSIWQFRQSVTAAEQAKSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQTADQRFGVLLSLTRGAILDPELAV
Ga0318506_1043431323300032052SoilVSGDAESEGGTSGGGAPAGHGWAARLGQFIQTYHSFLSSFVIGVAGLVATSIWQYRQSQTAAEQARSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPGSADQRFGVLLSLTRGAIIDPELAVSY
Ga0308173_1050553213300032074SoilVSDDEHKTGGEKPGFGAQESRLGQFIQKYSSFLSSFVIGVAGLFATSIWQYRQSQIAAQQAKSEQEMTRTKAENDWRIARAEILSKNLNILSAQGPGSADQRFGVLLSLTRGAIIDPELAVSYAMELGKDNAT
Ga0308173_1135377813300032074SoilVSAEGETGDESPEGGKATGKLSRLGKFIQTYHSFLSSFVIGVAGLVATSIWQYRQSQISAQQAASEQAIARTKAENDWRIARAEILSKNLNVLSAQGPGSADQRFGVLLSLTRGAIIDPELAVSY
Ga0310890_1061311813300032075SoilVAEESDKGGGESGAKKKSKLAKFFQEYHGPLSTLFLGVAGLIATSIWQFRQSVTAAEQAKSEQAIARTKADNDWRIARAEILSKNLNVLSTQGPQTADQRFGVLLSLTRGAILDPELAVSYALELGKDNPSYMRAVLEATAQK
Ga0318525_1058775223300032089SoilVSAEPEAPADDKAKEPEKTTRLGRFIQTYHGFLSSFVIGVAGLVATSIWQYKQSQIASQQARSEQAIAKTKAENDWRIARAEILSKNLNVLSLQGPQSADQRFGVLLSLTRGAIIDPELAVSYALELGKDNPSYM
Ga0315912_1096509313300032157SoilMSTSTDDPSPPAPAAAAPDGGKATKTPIPASPSRMGSFIQTYSSFLSSFVIGVAGLVATSIWQYRQSQSAARHAESEQAMTKTKADNDWRIARAEILAKNLNVLASQAPDTADQRFGVLLSLTRGSILDPELAVSYAL
Ga0310810_1109317613300033412SoilVSGEEDKGPAEPSKKSKLAKFIQEYHGALSTLFLGLAGLVATSIWQYRQSVTAAAQARSEQAIARTKADNDWRIARAEILSKNLNVLSTTGPQSADQRFGVLLSLTRGAILDPELAVSYALELGRDNA
Ga0316625_10025327523300033418SoilMTPAGESPKHDDHQPSRMGKFIQTYSSFLSSFVIGVAGLVATSIWQYRQSQNAIKQAESEQKIATTKAENEWRIARAEILAKNLNVLSTQGPATADQRFGVLLSLTRGAILDPELAGSYALELGKDNVQYMRDVLAATERKNYQQL
Ga0326726_1010190873300033433Peat SoilVTYSEGRVRCTLPAMSQENESPKKDDVRSSRAGKFIQTYSSFLSSFVIGVAGLVATSIWQYRQSVNAAKQAESEQKIAATKADNEWRIARAEILAKNLGVLSTQGPNTADQRFGVLLSLTRGAILDPEL
Ga0316624_1195531513300033486SoilMTSAGESPKRDDPSGSRMGKFIQTYSGFLSSFVIGVAGLVATSIWQYRQSQTAIRQAESEQKIATTKAENEWRIARAEILAKNLGVLSAQGAGTADQRFGVLLSLTRGAILDPELAVSYALELGKDNAAYM
Ga0316631_1044392113300033493SoilMTPASESPKPDDHQPSRMGRFIQTYSGFLSSFVIGVAGLVATSIWQYRQSQTAIKQAESEQKIATTKAENEWRIARAEILAKNLSVLSTQGPATADQRFGVLLSLTRGEILDPELAVSYALELGKDNVQYMRDVLAATERKNYQQL
Ga0334811_016339_1668_20813300033891SoilMTETPAAHDNTSRLGRFIQNYHGFLSSFVIGVAGLVATSIWQFRQAQNAERQQASEQAIARTKADNDWRIARAEILGKNLSVLSLQGPQTVDQRFGVLLSLTRGNILDPELAVSYALELGRDNPTYMAVVLAGTANKN
Ga0334926_017229_816_12203300034004Hypolithic BiocrustMTTQPHFEGVNLVTDLNKSVPPARPEVTRLGQFIQSYSSFLSSFVIGVAGLVATSIWQYRQSEITRAQAASDQAITKAKADNEWRIARADILAKNLDVLSAQGENTTDRKFGVLLSLTRAEILDPELAVSYALEL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.