NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F046416

Metagenome / Metatranscriptome Family F046416

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046416
Family Type Metagenome / Metatranscriptome
Number of Sequences 151
Average Sequence Length 56 residues
Representative Sequence MEYLAIALLSCLVGACSVQNTKAIEGEMPFVQGTPTKELLKEMPDLINTPTDGD
Number of Associated Samples 136
Number of Associated Scaffolds 151

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 71.52 %
% of genes near scaffold ends (potentially truncated) 99.34 %
% of genes from short scaffolds (< 2000 bps) 95.36 %
Associated GOLD sequencing projects 130
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (56.291 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater
(15.232 % of family members)
Environment Ontology (ENVO) Unclassified
(75.497 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(80.795 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 36.59%    β-sheet: 0.00%    Coil/Unstructured: 63.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 151 Family Scaffolds
PF10614CsgF 64.24
PF08804gp32 0.66
PF06508QueC 0.66
PF01764Lipase_3 0.66
PF13237Fer4_10 0.66
PF03783CsgG 0.66
PF137592OG-FeII_Oxy_5 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 151 Family Scaffolds
COG0037tRNA(Ile)-lysidine synthase TilS/MesJTranslation, ribosomal structure and biogenesis [J] 0.66
COG0137Argininosuccinate synthaseAmino acid transport and metabolism [E] 0.66
COG0171NH3-dependent NAD+ synthetaseCoenzyme transport and metabolism [H] 0.66
COG0301Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.66
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 0.66
COG0519GMP synthase, PP-ATPase domain/subunitNucleotide transport and metabolism [F] 0.66
COG06037-cyano-7-deazaguanine synthase (queuosine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.66
COG0780NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamilyTranslation, ribosomal structure and biogenesis [J] 0.66
COG1462Curli biogenesis system outer membrane secretion channel CsgGCell wall/membrane/envelope biogenesis [M] 0.66
COG1606ATP-utilizing enzyme, PP-loop superfamilyGeneral function prediction only [R] 0.66

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.54 %
UnclassifiedrootN/A30.46 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10284457Not Available502Open in IMG/M
3300000148|SI47jul10_100mDRAFT_c1032174All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300000152|LPjun08P12500mDRAFT_c1059022Not Available517Open in IMG/M
3300000158|SI54feb11_100mDRAFT_c1004750All Organisms → Viruses → Predicted Viral3465Open in IMG/M
3300000159|LPaug08P2610mDRAFT_c1029146All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300000163|LPjun09P162000mDRAFT_c1017265All Organisms → Viruses → Predicted Viral1187Open in IMG/M
3300000174|SI60aug11_200mDRAFT_c1026912All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300000265|LP_A_09_P04_10DRAFT_1026794All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300000929|NpDRAFT_10125336All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300001354|JGI20155J14468_10225131All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300001683|GBIDBA_10098009Not Available1304Open in IMG/M
3300002519|JGI25130J35507_1028332Not Available1222Open in IMG/M
3300003270|JGI26113J46593_1021351Not Available719Open in IMG/M
3300003478|JGI26238J51125_1068097Not Available701Open in IMG/M
3300003586|JGI26261J51718_1032424All Organisms → cellular organisms → Bacteria → Proteobacteria1212Open in IMG/M
3300003586|JGI26261J51718_1089549Not Available579Open in IMG/M
3300003602|JGI26262J51727_1119409All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300004831|Ga0069134_167771All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300005399|Ga0066860_10080350All Organisms → Viruses → Predicted Viral1177Open in IMG/M
3300005402|Ga0066855_10012034Not Available2388Open in IMG/M
3300005425|Ga0066859_10099762All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → unclassified Opitutales → Opitutales bacterium872Open in IMG/M
3300005603|Ga0066853_10143740All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300006029|Ga0075466_1157478All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300006341|Ga0068493_10221771All Organisms → cellular organisms → Bacteria1312Open in IMG/M
3300006753|Ga0098039_1075927All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M1164Open in IMG/M
3300006753|Ga0098039_1310733Not Available526Open in IMG/M
3300006902|Ga0066372_10057530All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M1912Open in IMG/M
3300006920|Ga0070748_1101532All Organisms → Viruses → Predicted Viral1096Open in IMG/M
3300006920|Ga0070748_1263280All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300006921|Ga0098060_1163518All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300006925|Ga0098050_1118492Not Available672Open in IMG/M
3300006927|Ga0098034_1130587All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → unclassified Opitutales → Opitutales bacterium712Open in IMG/M
3300007229|Ga0075468_10168809All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300007555|Ga0102817_1048982All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300007655|Ga0102825_1061431All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300007718|Ga0102852_1110968All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300007863|Ga0105744_1050880All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300007972|Ga0105745_1323190All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300007981|Ga0102904_1096330Not Available688Open in IMG/M
3300008050|Ga0098052_1092381All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300008624|Ga0115652_1062972All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M1264Open in IMG/M
3300008961|Ga0102887_1224455Not Available570Open in IMG/M
3300009002|Ga0102810_1123073All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300009049|Ga0102911_1087969All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae892Open in IMG/M
3300009056|Ga0102860_1171430All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300009077|Ga0115552_1286999All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300009086|Ga0102812_10833589All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300009109|Ga0117922_1049856Not Available2432Open in IMG/M
3300009335|Ga0117926_1058551All Organisms → cellular organisms → Bacteria1604Open in IMG/M
3300009432|Ga0115005_10759867All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300009433|Ga0115545_1140725All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300009445|Ga0115553_1281284All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300009472|Ga0115554_1328944All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300009472|Ga0115554_1360450All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300009476|Ga0115555_1391707Not Available553Open in IMG/M
3300009496|Ga0115570_10455081All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300010150|Ga0098056_1314577All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300011253|Ga0151671_1026873All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300017713|Ga0181391_1123114All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300017717|Ga0181404_1025799All Organisms → Viruses → Predicted Viral1510Open in IMG/M
3300017725|Ga0181398_1027161All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1412Open in IMG/M
3300017757|Ga0181420_1135716All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300017772|Ga0181430_1027424Not Available1839Open in IMG/M
3300017775|Ga0181432_1210947Not Available609Open in IMG/M
3300017776|Ga0181394_1183213All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300017782|Ga0181380_1174088Not Available727Open in IMG/M
3300020169|Ga0206127_1114956All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300020182|Ga0206129_10246194All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300020347|Ga0211504_1104716All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300020367|Ga0211703_10105603Not Available711Open in IMG/M
3300020389|Ga0211680_10163435All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M876Open in IMG/M
3300020415|Ga0211553_10110895Not Available1136Open in IMG/M
3300020415|Ga0211553_10131114All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300020459|Ga0211514_10420794All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300021068|Ga0206684_1176718Not Available697Open in IMG/M
3300021089|Ga0206679_10320219All Organisms → Viruses838Open in IMG/M
3300021089|Ga0206679_10702367Not Available508Open in IMG/M
3300021185|Ga0206682_10208161All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300021345|Ga0206688_10817876Not Available545Open in IMG/M
3300021352|Ga0206680_10421575Not Available518Open in IMG/M
3300021442|Ga0206685_10167212All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300021442|Ga0206685_10174626Not Available720Open in IMG/M
3300021442|Ga0206685_10275685Not Available570Open in IMG/M
3300021443|Ga0206681_10219686All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300021443|Ga0206681_10376732Not Available547Open in IMG/M
(restricted) 3300022920|Ga0233426_10073524All Organisms → Viruses → Predicted Viral1565Open in IMG/M
3300024188|Ga0228602_1096169Not Available521Open in IMG/M
3300024229|Ga0233402_1035177All Organisms → cellular organisms → Bacteria1077Open in IMG/M
3300024229|Ga0233402_1115971Not Available554Open in IMG/M
3300024236|Ga0228655_1107888All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300024244|Ga0228678_1082976All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300024267|Ga0228623_1063506All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300024294|Ga0228664_1099671All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300024315|Ga0228618_1067794All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300024320|Ga0233398_1003744Not Available5144Open in IMG/M
(restricted) 3300024327|Ga0233434_1078766All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1422Open in IMG/M
3300024346|Ga0244775_11309147All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300024413|Ga0233393_1101675All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300024420|Ga0228632_1032258All Organisms → Viruses → Predicted Viral1218Open in IMG/M
3300025072|Ga0208920_1023989All Organisms → cellular organisms → Bacteria1303Open in IMG/M
3300025103|Ga0208013_1139689All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300025114|Ga0208433_1071975All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → unclassified Opitutales → Opitutales bacterium888Open in IMG/M
3300025133|Ga0208299_1142075All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → unclassified Opitutales → Opitutales bacterium763Open in IMG/M
3300025594|Ga0209094_1146166Not Available504Open in IMG/M
3300025662|Ga0209664_1063326All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300025676|Ga0209657_1127798Not Available742Open in IMG/M
3300025685|Ga0209095_1111842All Organisms → Viruses842Open in IMG/M
3300025719|Ga0209252_1068260All Organisms → cellular organisms → Bacteria1276Open in IMG/M
3300025809|Ga0209199_1212741All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300025816|Ga0209193_1005175Not Available5251Open in IMG/M
3300025876|Ga0209223_10258989All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300026261|Ga0208524_1124696All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → unclassified Opitutales → Opitutales bacterium668Open in IMG/M
3300027194|Ga0208799_1053707All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300027206|Ga0208023_1043231All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300027406|Ga0208965_1041056Not Available1068Open in IMG/M
3300027801|Ga0209091_10065566All Organisms → Viruses → Predicted Viral2040Open in IMG/M
3300027827|Ga0209035_10364770All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300027839|Ga0209403_10315530All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300027847|Ga0209402_10517743All Organisms → cellular organisms → Bacteria692Open in IMG/M
(restricted) 3300027996|Ga0233413_10373669All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300028111|Ga0233397_1063019All Organisms → Viruses → Predicted Viral1018Open in IMG/M
3300028131|Ga0228642_1173979All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → unclassified Opitutales → Opitutales bacterium502Open in IMG/M
3300028190|Ga0257108_1200940Not Available565Open in IMG/M
3300028192|Ga0257107_1189288Not Available589Open in IMG/M
3300028396|Ga0228643_1153443All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300028489|Ga0257112_10330663Not Available506Open in IMG/M
3300031141|Ga0308021_10111584Not Available1093Open in IMG/M
3300031510|Ga0308010_1165823All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300031519|Ga0307488_10694294All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300031598|Ga0308019_10223732All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300031599|Ga0308007_10316396Not Available515Open in IMG/M
3300031602|Ga0307993_1020677All Organisms → Viruses → Predicted Viral1654Open in IMG/M
3300031658|Ga0307984_1152133All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300031694|Ga0308015_10272002All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300031695|Ga0308016_10365799Not Available516Open in IMG/M
3300031766|Ga0315322_10148892Not Available1666Open in IMG/M
3300031775|Ga0315326_10475652All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300031775|Ga0315326_10964451Not Available522Open in IMG/M
3300031851|Ga0315320_10348667Not Available1041Open in IMG/M
3300031851|Ga0315320_10492582All Organisms → Viruses828Open in IMG/M
3300031851|Ga0315320_10726792Not Available634Open in IMG/M
3300031861|Ga0315319_10178443All Organisms → Viruses1065Open in IMG/M
3300031861|Ga0315319_10236031All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300032019|Ga0315324_10016808Not Available2598Open in IMG/M
3300032048|Ga0315329_10081664All Organisms → Viruses → Predicted Viral1616Open in IMG/M
3300032088|Ga0315321_10668059All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300032278|Ga0310345_11227273All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300032360|Ga0315334_11330006All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300032360|Ga0315334_11506274Not Available576Open in IMG/M
3300033742|Ga0314858_209068All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300034695|Ga0372840_018196Not Available1967Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine15.23%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater15.23%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater9.27%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine7.28%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine7.28%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine7.95%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.30%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater5.30%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.97%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.65%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.65%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.99%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine1.99%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.99%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.32%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine1.32%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.32%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.32%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.32%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.66%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.66%
Surface SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Surface Seawater0.66%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.66%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.66%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.66%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.66%
Hydrothermal Vent PlumeEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume0.66%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000148Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 100mEnvironmentalOpen in IMG/M
3300000152Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P12 500mEnvironmentalOpen in IMG/M
3300000158Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 54 02/08/11 100mEnvironmentalOpen in IMG/M
3300000159Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 10mEnvironmentalOpen in IMG/M
3300000163Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P16 2000mEnvironmentalOpen in IMG/M
3300000174Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 60 08/10/11 200mEnvironmentalOpen in IMG/M
3300000265Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10EnvironmentalOpen in IMG/M
3300000929Marine plume microbial communities from the Columbia River - 15 PSUEnvironmentalOpen in IMG/M
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300001683Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assemblyEnvironmentalOpen in IMG/M
3300002519Marine viral communities from the Pacific Ocean - ETNP_2_300EnvironmentalOpen in IMG/M
3300003270Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_17_M020EnvironmentalOpen in IMG/M
3300003478Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNAEnvironmentalOpen in IMG/M
3300003586Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_135m_DNAEnvironmentalOpen in IMG/M
3300003602Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_150m_DNAEnvironmentalOpen in IMG/M
3300004831Marine surface microbial communities from the North Atlantic Ocean - filtered matterEnvironmentalOpen in IMG/M
3300005399Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F14-07SV275EnvironmentalOpen in IMG/M
3300005402Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73EnvironmentalOpen in IMG/M
3300005425Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV199EnvironmentalOpen in IMG/M
3300005603Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV61EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006341Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770mEnvironmentalOpen in IMG/M
3300006753Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaGEnvironmentalOpen in IMG/M
3300006902Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_AEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300006927Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007655Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579EnvironmentalOpen in IMG/M
3300007718Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3EnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300007981Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3EnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300008624Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 200m, 250-2.7umEnvironmentalOpen in IMG/M
3300008961Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02EnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009049Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02EnvironmentalOpen in IMG/M
3300009056Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009109Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 2.7-0.2um, replicate bEnvironmentalOpen in IMG/M
3300009335Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 198m, 2.7-0.2um, replicate aEnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017775Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300020169Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020367Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX556112-ERR599005)EnvironmentalOpen in IMG/M
3300020389Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX556139-ERR599008)EnvironmentalOpen in IMG/M
3300020415Marine microbial communities from Tara Oceans - TARA_B100001146 (ERX555973-ERR599166)EnvironmentalOpen in IMG/M
3300020459Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095)EnvironmentalOpen in IMG/M
3300021068Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015EnvironmentalOpen in IMG/M
3300021089Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021352Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015EnvironmentalOpen in IMG/M
3300021442Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015EnvironmentalOpen in IMG/M
3300021443Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015EnvironmentalOpen in IMG/M
3300022920 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MGEnvironmentalOpen in IMG/M
3300024188Seawater microbial communities from Monterey Bay, California, United States - 2DEnvironmentalOpen in IMG/M
3300024229Seawater microbial communities from Monterey Bay, California, United States - 54DEnvironmentalOpen in IMG/M
3300024236Seawater microbial communities from Monterey Bay, California, United States - 67DEnvironmentalOpen in IMG/M
3300024244Seawater microbial communities from Monterey Bay, California, United States - 125D_rEnvironmentalOpen in IMG/M
3300024267Seawater microbial communities from Monterey Bay, California, United States - 28DEnvironmentalOpen in IMG/M
3300024294Seawater microbial communities from Monterey Bay, California, United States - 78DEnvironmentalOpen in IMG/M
3300024315Seawater microbial communities from Monterey Bay, California, United States - 20DEnvironmentalOpen in IMG/M
3300024320Seawater microbial communities from Monterey Bay, California, United States - 38DEnvironmentalOpen in IMG/M
3300024327 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_120_MGEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024413Seawater microbial communities from Monterey Bay, California, United States - 21DEnvironmentalOpen in IMG/M
3300024420Seawater microbial communities from Monterey Bay, California, United States - 40DEnvironmentalOpen in IMG/M
3300025072Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025114Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025133Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025594Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes)EnvironmentalOpen in IMG/M
3300025662Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_150m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025676Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025685Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes)EnvironmentalOpen in IMG/M
3300025719Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_135m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025816Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes)EnvironmentalOpen in IMG/M
3300025876Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes)EnvironmentalOpen in IMG/M
3300026261Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV61 (SPAdes)EnvironmentalOpen in IMG/M
3300027194Estuarine microbial communities from the Columbia River estuary - metaG S.751 (SPAdes)EnvironmentalOpen in IMG/M
3300027206Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027406Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_07_M0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027827Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes)EnvironmentalOpen in IMG/M
3300027839Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes)EnvironmentalOpen in IMG/M
3300027847Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028111Seawater microbial communities from Monterey Bay, California, United States - 35DEnvironmentalOpen in IMG/M
3300028131Seawater microbial communities from Monterey Bay, California, United States - 53DEnvironmentalOpen in IMG/M
3300028190Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000mEnvironmentalOpen in IMG/M
3300028192Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500mEnvironmentalOpen in IMG/M
3300028396Seawater microbial communities from Monterey Bay, California, United States - 55DEnvironmentalOpen in IMG/M
3300028489Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1000mEnvironmentalOpen in IMG/M
3300031141Marine microbial communities from water near the shore, Antarctic Ocean - #351EnvironmentalOpen in IMG/M
3300031510Marine microbial communities from water near the shore, Antarctic Ocean - #129EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031598Marine microbial communities from water near the shore, Antarctic Ocean - #284EnvironmentalOpen in IMG/M
3300031599Marine microbial communities from water near the shore, Antarctic Ocean - #71EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300031694Marine microbial communities from water near the shore, Antarctic Ocean - #231EnvironmentalOpen in IMG/M
3300031695Marine microbial communities from water near the shore, Antarctic Ocean - #233EnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031775Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300031861Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 3416EnvironmentalOpen in IMG/M
3300032019Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 21515EnvironmentalOpen in IMG/M
3300032048Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 32315EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M
3300032278Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300032360Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M
3300034695Seawater microbial communities from the Northeast subarctic Pacific Ocean - P26_June_2012_500mEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1028445723300000101MarineMNMEYLAVALLSCIMAGCSVQNTKAIEGEMPFVQGTPTKELLKEMP
SI47jul10_100mDRAFT_103217433300000148MarineMNMEYLAVAFLSCIMAGCSVQNTKAIEGDMPFVQGTPTKELLKEMPDLINTPTDGEGNP
LPjun08P12500mDRAFT_105902213300000152MarineMNMEYLAVALLSCLVGACGMNQKTEAIQGDMPFVEGTPTKTLLQEMPELIGVPTDGD
SI54feb11_100mDRAFT_100475013300000158MarineMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALINQPT
LPaug08P2610mDRAFT_102914623300000159MarineMKYLAIVLLSCLISSCGVQQVKAIEGEMPFTQGTPTKELLNEMPPLVGMPTDGDGNPVKI
LPjun09P162000mDRAFT_101726513300000163MarineMEYLAVVLLSCLVGACSVNQKTEAIQGDMPFVEGTPTKTLLQEMPELVNMPTDGEGNPVKIT
SI60aug11_200mDRAFT_102691213300000174MarineMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALIN
LP_A_09_P04_10DRAFT_102679433300000265MarineMEYLAIALLSCLVSSCGVQQVKAIEGEMPFTQGTPTKELLNEMPALVGMPTDGDGNPVKITVA
NpDRAFT_1012533623300000929Freshwater And MarineMEYLAVALLSCLVGACGMNQKTEAIQGEMPFIEGTPTKTLLQEVPDLIGVPTDGEGNPVKIT
JGI20155J14468_1022513113300001354Pelagic MarineMEYLAIALLSCMVGACSVQNTKAIEGEMPFVQGTPTKELLKEMPDLINT
GBIDBA_1009800913300001683Hydrothermal Vent PlumeMEYLGILLLSCMLSSCSTNQKIEAIEGDMPFVQGTPTKTLLQEMPKLINTPTDGDGNPVKITI
JGI25130J35507_102833243300002519MarineMEYAAVILLSCLVGACSMNQKTEAIQGDMPFVQGTPTKTLLQEMPDLVNVPTDGEGNP
JGI26113J46593_102135113300003270MarineMNMEYLAVALLSCLVGACGMNQKHEAIQGEMPFVQGTPTKELLQDMPELINTPTDGEGNP
JGI26238J51125_106809723300003478MarineMNMEYLAVVLLSCLVSACGMNQKHEAIQGDMPFVQGTPTKELLQEMPDLINTPTDGEGNPVKITV
JGI26261J51718_103242413300003586MarineMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALINQPTDGSGNP
JGI26261J51718_108954923300003586MarineMNMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALINQPTDGSGNP
JGI26262J51727_111940913300003602MarineMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALINQP
Ga0069134_16777133300004831Surface SeawaterMEYLAIALLSCMVGACSVQNTKAIEGEMPFVQGTPTKELLKEMPDLINTPTDGDGNPVKITV
Ga0066860_1008035013300005399MarineMEYLAIVLLSCLVGACGINQKTEAIQGDMPFVEGTPTKTLLQEMPNLINTPTDGDGNPVKITVA
Ga0066855_1001203413300005402MarineMKMEYLAIALLSCLVGACSMNPKAEAIQEYDMPFVQGTPTKTLLQEMPDLINT
Ga0066859_1009976213300005425MarineMEYLAIALLSCLVGGCSMNQKTEAIQGDMPFVEGTPTKTLLQEIPKLINVPTDGD
Ga0066853_1014374013300005603MarineMEYLAVALLSCLVGACSMNQKTEAIQGDMPFIEGTPTKTLLQDIPDLINVPTD
Ga0075466_115747813300006029AqueousMNMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALINQPTDGSGNPVKIT
Ga0068493_1022177113300006341MarineMEYLAVALLSCLVGACSVNQKTEAIQGDMPFIEGTPTKTLLQEVPDLINVPTDGEGNPVK
Ga0098039_107592713300006753MarineMEYVAVILLSCLVGACSMNQKTEAIQGDMPFVQGTPTKTLLQEMPDLVNVPTDGEGNPVKITV
Ga0098039_131073313300006753MarineMEYLAIALLSCLVGGCSMNQKTEAIQGDMPFVEGTPTKTLLQEIPKLINVPTDG
Ga0066372_1005753013300006902MarineMEYLAVALLSCVVGACGMNQKTEAIQGDMPFIEGTPTKTLLHDIPDLINVPT
Ga0070748_110153213300006920AqueousMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALINQPTDGSGNPVKITVAVYA
Ga0070748_126328023300006920AqueousMEYLAIALLSCLMGACSTQNTKAIEGEMPFVQGTPTKELLKQMPDLINTP
Ga0098060_116351813300006921MarineMNMEYLAIALLSCLVGACSVQNTKAIEGEMPFTQGTPTKQLLKDMPPLINTPTDGEGNPVKI
Ga0098050_111849213300006925MarineVEYLGIVLLSFLVASCSVNHKTEAIQGDMPFVQGTPTKTLLQEMPELINTPTDGEGNPVKITVA
Ga0098034_113058723300006927MarineMEYLGIVLLSFLVASCSMNQKTEAIQGDMPFVEGTPTKTLLQEIPKLINVPTD
Ga0075468_1016880913300007229AqueousMNMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALINQPTDGSGNPV
Ga0102817_104898213300007555EstuarineMNMEYLAIALLSCLVSSCGVQQVKAIEGEMPFTQGTPTKELLNEMPPLVG
Ga0102825_106143113300007655EstuarineMNMEYLAIALLSCLVSSCGVQQVKAIEGEMPFTQGTPTKELLNEMPPLVGMPTDGDGNPV
Ga0102852_111096823300007718EstuarineMNMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMP
Ga0105744_105088013300007863Estuary WaterMNMEYLAVALLSCIMAGCSVQNTKAIEGDMPFVQGTPTKELLKDMPDLINTPTDGEG
Ga0105745_132319023300007972Estuary WaterMNMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPSLIN
Ga0102904_109633013300007981EstuarineMNMEYLAVALLSCLVGACGMNQKTEAIQGDMPFIEGTPTKTLLHEMPNLINVP
Ga0098052_109238143300008050MarineMNMEYLAVALLSCLVGACSVNQKTEAIQGEMPFVEGTPTKTLLQDMPELINTPTDGEGNP
Ga0115652_106297213300008624MarineVILNFKVINMEYLAIALLSCVVGACSVNQKTEAIQGDMPFVQGTPTKTLLQEMPELINVPTD
Ga0102887_122445523300008961EstuarineMNMEYLAVALLSCLVGACGMNQKTEAIQGEMPFIEGTPTKILLHDVPDLINVPTDG
Ga0102810_112307313300009002EstuarineMNMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPSLINQPTDGSGNPV
Ga0102911_108796933300009049EstuarineMNMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALINQPTDGSG
Ga0102860_117143023300009056EstuarineMNMEYLAIAVLSCLLGSCSVQNTKAIEGEMPFVQGTPTKQLLQDMPALINT
Ga0115552_128699923300009077Pelagic MarineMEYLAVALLSCMVGACSVQNTKAIEGEMPFVQGTPTKELLKEMPDLI
Ga0102812_1083358923300009086EstuarineMKYLAIVLLSCLISSCGVQQVKAIEGEMPFTQGTPTKELLNEMPALIGMPT
Ga0117922_104985653300009109MarineMNMEYLAIALLSCLVGACSINQKTEAIQGDMPFIEGTPTKTLLQEMPELINVPTDGDGNPVKITVAV
Ga0117926_105855113300009335MarineMNMEYLAIALLSCLVGACSINQKTEAIQGDMPFIEGTPTKTLLQEMPDLINVPTDGEGN
Ga0115005_1075986733300009432MarineMEYFAPILLSLLLASCGAQNIKSIEGEMPFTQGTPTKELLHEMP
Ga0115545_114072513300009433Pelagic MarineMNMEYLAIAFLSCIMAGCSVQNTKAIEGDMPFVQGTPTKELLKEMPELVGMPTDGSGNPVKITVAV
Ga0115553_128128413300009445Pelagic MarineMEYLAIALLSCMVGACSVQNTKAIEGEMPFVQGTPTKELLHEMPSLINQPTDGSGNPVKITVAVY
Ga0115554_132894413300009472Pelagic MarineMNMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALINQPTDGSGNPVKITV
Ga0115554_136045023300009472Pelagic MarineMNMEYLAIAFLSCIMAGCSVQNTKAIEGEMPFVQGTPTKELLKDMPDLINTPTDGKGNPV
Ga0115555_139170713300009476Pelagic MarineMNMEYLAVALLSCIMAGCSVQNTKAIEGEMPFVQGTPTKELLKEMPELVGMPTDGSGNPVKITV
Ga0115570_1045508123300009496Pelagic MarineMNMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALINQP
Ga0098056_131457723300010150MarineMNMEYLAIALLSCLVGGCSVQNTKAIEGEMPFVQGTPTKQLLQDMPALINTPTDGEG
Ga0151671_102687323300011253MarineMNMEYLAIALLSCIMAGCSVQNTKAIEGEMPFVQGTPTKQLQKEMPPLINTPTDGKGN
Ga0181391_112311423300017713SeawaterMNMEYLAIALLSCLVGACSTQNTKAIEGEMPFVQGTPTKQLLKDMPSLI
Ga0181404_102579943300017717SeawaterMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALINQPTDGSGNPVK
Ga0181398_102716113300017725SeawaterMEYLAIAVLSCLLGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALINQPTDGSGNPVKITV
Ga0181420_113571623300017757SeawaterMKYLAIVLLSCLISSCGVQQVKAIEGEMPFTQGTPTKELLNEMPALIGMPTD
Ga0181430_102742413300017772SeawaterMEYLAVALLSCIMAGCSVQNTKAIEGEMPFVQGTPTKELLKDMPDLINTPTDGNGNPVKI
Ga0181432_121094723300017775SeawaterMEYLAVALLSCLVGACSVNQKTEAIQGDMPFIEGTPTKVLLQEIPDLINVPT
Ga0181394_118321313300017776SeawaterMKYLAIALLSCLVSSCGVQQVKAIEGEMPFTQGTPTKELLNEMPALVGMPTD
Ga0181380_117408813300017782SeawaterMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKQLLQDMPALINTPTDG
Ga0206127_111495633300020169SeawaterMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALI
Ga0206129_1024619413300020182SeawaterMEYLAIALLSCMVGACSVQNTKAIEGEMPFVQGTPTKELLKEMPDLINTPTD
Ga0211504_110471613300020347MarineMEYLAIAFLSCIMAGCSVQNTKAIEGEMPFVQGTPTKELLKDMPDLINTPTDG
Ga0211703_1010560323300020367MarineMEYLAVALLSCLVGACSVNQKTEAIQGDMPFIEGTPTKTLLQEIPKLINVPTDGEGNPVKITVA
Ga0211680_1016343533300020389MarineMEYLAVALLSCLVGACGMNQKTEPIQGDMPFIEGTPTKVLLQEIPDLINVPTDGDGNPVKITVAV
Ga0211553_1011089513300020415MarineMNMEYLAVALLSCLVGACGINQKTEPIQGDMPFIEGTPTKVLLQEIPDLINVPTDGDCNP
Ga0211553_1013111413300020415MarineMEYLAIALLSCLVSSCGVQQVKAIEGEMPFTQGTPTKELLNEMPALIGMP
Ga0211514_1042079413300020459MarineMEYLAIALLSCLVGACSVQNTKAIEGEMPFVQGTPTKELLKEMPDLINTPTDGD
Ga0206684_117671813300021068SeawaterMEALPIIILSCLLGGCATATITAPEPEMPFVQGTPTKELLQEMPDLINTPTDGEGNP
Ga0206679_1032021913300021089SeawaterMEYLAVALLSCLVGACGMNQKTEAIQGEMPFIEGTPTKTLLHDLPNLINVPTDGEGNP
Ga0206679_1070236723300021089SeawaterMEYLAVALLSCLVGACSVNQKTEAIQGDMPFIEGTPTKTLLHEVPDLINVPTDGEGNP
Ga0206682_1020816113300021185SeawaterMEYLAIALLSCLVSSCGVQQVKAIEGEMPFTQGTPTKELLNEMPALIGM
Ga0206688_1081787613300021345SeawaterMEYLAVALLSCLVGACSVNQKTEAIQGDMPFIEGTPTKTLLQEIPKLINVPT
Ga0206680_1042157513300021352SeawaterMKMEYLAIALLSCLVGACSMNPKAELIQEYDMPFVQGTPTKTLLQEMPDLINTPTDGEG
Ga0206685_1016721223300021442SeawaterMEYLAVALLSCLVGACSVNQKTEAIQGDMPFIEGTPTKTLLQEIPKLINVPTDGDGNPV
Ga0206685_1017462613300021442SeawaterMEYLAVALLSCLVGACSMNQKTEAIQGDMPFIEGTPTKTLLQEIPKLINVPTDGDGNPVKITVA
Ga0206685_1027568523300021442SeawaterMNMEYLAVALLSCLVGACGMNQKTEAIQGDMPFIEGTPTKTLLHEVPDLINVPTDG
Ga0206681_1021968613300021443SeawaterMEYLAVALLSCLVGACSINQKTEAIQGDMPFIEGTPTKTLLQEIPKLINVPTDGDG
Ga0206681_1037673213300021443SeawaterMEYLAVALLSCLVGACSVNQKTEAIQGDMPFIEGTPTKTLLQEIPKLINVPTDG
(restricted) Ga0233426_1007352413300022920SeawaterMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALINQPTDG
Ga0228602_109616923300024188SeawaterMNMEYLAIALLSCLVGACSTQNTKAIEGEMPFVQGTPTKQLLKDMPSLINTPTDGEGNPVKITVAV
Ga0233402_103517713300024229SeawaterMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALINQPTDGSGNPVKITVA
Ga0233402_111597113300024229SeawaterMNMEYLAVALLSCIMAGCSVQNTKAIEGDMPFVQGTPTKELLKEMPDLINTPTDGEGNPVKITVA
Ga0228655_110788813300024236SeawaterMNMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALINQPTDGSGNPVKI
Ga0228678_108297623300024244SeawaterMNMEYLAIALLSCLVGACSTQNTKAIEGEMPFVQGTPTKQLLKDMPSLINT
Ga0228623_106350633300024267SeawaterMEYLAIAFLSCIMAGCSVQNTKAIEGEMPFVQGTPTKELLKDMPDLINTPTDGNG
Ga0228664_109967123300024294SeawaterMEYLAIAFLSCIMAGCSVQNTKAIEGEMPFVQGTPTKELLKDMPDLINTPTDGEGNPVKITVAV
Ga0228618_106779423300024315SeawaterMNMEYLAIALLSCLVGACSTQNTKAIEGEMPFVQGTPTKQLLKDMPSLINTPTDGEGNPVKI
Ga0233398_1003744123300024320SeawaterMEYLAIALLSCLVGACSTQNTKAIEGEMPFVQGTPTKQLLKDMPSLINTPTDGEGNPVKI
(restricted) Ga0233434_107876613300024327SeawaterMNMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPSL
Ga0244775_1130914713300024346EstuarineMNMEYLAIAILGMSLAGCGVQQVKAIEGEMPFIQGTPTKELLREIPELVGM
Ga0233393_110167513300024413SeawaterMNMEYLAIALLSCLVGACSTQNTKAIEGEMPFVQGTPTKQLLKDMPSLINTPTDGE
Ga0228632_103225843300024420SeawaterMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPSLI
Ga0208920_102398943300025072MarineMEYLAIALLSCLVGGCSMNQKTEAIQGDMPFVEGTPTKTLLQEIPKLINVPT
Ga0208013_113968913300025103MarineMEYLAIALLSCLVGACSTQNTKAIEGEMPFVESTPTKELLRQMPPPINTPTDGEGN
Ga0208433_107197533300025114MarineMEYAAVILLSCLVGACSMNQKTEAIQGDMPFVQGTPTKTLLQEVPPLVNVPTDGEG
Ga0208299_114207513300025133MarineMEYLAIALLSCLVGGCSMNQKTEAIQGDMPFIEGTPTKTLLQEIPKLINVP
Ga0209094_114616623300025594Pelagic MarineMNMEYLAIALLSCLVGACGTTNTKAIEGEMPFTQGTPTKTLLQEMPPLIGM
Ga0209664_106332613300025662MarineMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALINQPTDGSGNPV
Ga0209657_112779833300025676MarineMNMEYLAVVLLSCLVSACGMNQKHEAIQGDMPFVQGTPTKELLQEMPDLINTPTDGEGNPVKITVA
Ga0209095_111184213300025685Pelagic MarineMEYLAIAFLSCIMAGCSVQNTKAIEGEMPFVQGTPTKELLKDMPDLINTPTDGKGNPV
Ga0209252_106826043300025719MarineMNMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPSLINQPTD
Ga0209199_121274123300025809Pelagic MarineMNMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALINQPTDGSGNPVKITVA
Ga0209193_1005175103300025816Pelagic MarineMEYLAIALLSCMVGACSVQNTKAIEGEMPFVQGTPTKELLKEMPDLIN
Ga0209223_1025898933300025876Pelagic MarineMEYLAIALLSCLVGACGTTNTKAIEGEMPFTQGTPTKTLLQEMPRLVGMPT
Ga0208524_112469613300026261MarineMEYLGIVLLSFLVASCSMNQKTEAIQGDMPFVEGTPTKTLLQEIPKLINVP
Ga0208799_105370713300027194EstuarineMNMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPSLINQPTDGSGNPVKI
Ga0208023_104323123300027206EstuarineMNMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPSLINQPTDGSGNPVKITV
Ga0208965_104105613300027406MarineMNMEYLAVALLSCLVGACGMNQKHEAIQGDMPFVQGTPTKVLLQDMPSLINTPTDG
Ga0209091_1006556613300027801MarineMEYFAPILLSLLLASCGAQNIKSIEGEMPFTQGTPTKELL
Ga0209035_1036477013300027827MarineMDYLLPIILSLFVASCSVQNTKAIEVEMPFVQGTPTKELLQDMPPLIGMPTDGNGNPV
Ga0209403_1031553013300027839MarineMEYFAPILLSLLLASCGAQNIKSIEGEMPFTQGTPTKELLHEMPPPIG
Ga0209402_1051774313300027847MarineMDYIVPILLSLSIASCSVQNTKAIEGEMPFTQGTPTKELLQEMPPLVGMPTDGDGNPVKI
(restricted) Ga0233413_1037366923300027996SeawaterMNMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALINQPTDGSATP
Ga0233397_106301913300028111SeawaterMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPSLINQPTDGSGNPV
Ga0228642_117397913300028131SeawaterMNMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPALINQPTDGS
Ga0257108_120094013300028190MarineMEYLAVVLLSCLVGACSVNQKTEAIQGDMPFVEGTPTKTLLQEMPELVNMPTDG
Ga0257107_118928813300028192MarineMNMEYLAVALLSCLVGACGMNQKTEAIQGEMPFVEGTPTKVLLHDVPDLINVPTDGEGNPVKI
Ga0228643_115344323300028396SeawaterMNMEYLAIALLSCLVGACSTQNTKAIEGEMPFVQGTPTKQLLKDMPSLINTPTD
Ga0257112_1033066323300028489MarineMEYLAVALLSCLIGACGMNQKTEAIQGDMPFVEGTPTKTLLHDMPNLINVPTDGDGNP
Ga0308021_1011158413300031141MarineMDYIVPILLSLSIASCSVQNTKIIESEMPFTQGTPTKTLLQEMPA
Ga0308010_116582313300031510MarineMNYIIPIILSLFVASCSVQNKKAIEVEMPFVQGTPTKELLQDMPPLIGMPTDGDGNPVKITVA
Ga0307488_1069429423300031519Sackhole BrineMKYLAIALLSCLVSSCGVQQVKAIEGEMPFTQGTPTKELLNEMP
Ga0308019_1022373223300031598MarineMDYIVPIILSLFVASCSVQNRKAIEVEMPFVQGTPTKELLQDMPPLVGM
Ga0308007_1031639613300031599MarineMDYIVPIILSLFVASCSVQNTKAIEVEMPFVQGTPTKELLQDMPPLIGMPTDGNGNPVKITVAV
Ga0307993_102067743300031602MarineMDYLLPIILSLFVASCSVQNTKAIEVEMPFVQGTPTKELLQDMP
Ga0307984_115213313300031658MarineMDYIVPIILSLFVASCSVQNTKAIEVEMPFVQGTPTKELLQDMPPLIGMPTD
Ga0308015_1027200213300031694MarineMDYLLPIILSLFVASCSVQNTKAIEVEMPFVQGTPTKELLQDMPPLIGMPTD
Ga0308016_1036579923300031695MarineMDYIVPIILSLFVASCSVQNTKAIEVEMPFVQGTPTKELLQDMPPL
Ga0315322_1014889263300031766SeawaterMNMEYLAVALLSCLVGACGMNQKHEAIQGEMPFVQGTPTKELLQDMPSLINTPTDGEGNPVKITV
Ga0315326_1047565213300031775SeawaterMEYLAIAVLSCLVGSCSVQNTKAIEGEMPFVQGTPTKELLHEMPSLINQPTD
Ga0315326_1096445123300031775SeawaterMNMEYLAVVLLSCLVSACGMNQKHEAIQGDMPFVQGTPTKELLQEMPDLINTPTDGE
Ga0315320_1034866743300031851SeawaterMNMEYLAVALLSCLVGACGMNQKHEAIQGEMPFVQGTPTKELLQDMPSLINTPTDGEGNPVKITVA
Ga0315320_1049258233300031851SeawaterMEYLAIAFLSCIMAGCSVQNTKAIEGEMPFVQGTPTKELLKDMPDLI
Ga0315320_1072679213300031851SeawaterMEYLAVALLSCLVGACSVNQKTEAIQGDMPFIEGTPTKTLLQEIPKLINVPTDGDG
Ga0315319_1017844333300031861SeawaterMEYLAVALLSCLVGACGMNQKTEAIQGEMPFVEGTPTKVLLHDVPDLINVPTDGEGNPVKITVAIYKFP
Ga0315319_1023603133300031861SeawaterMEYLAVVLLSCLVGACSVNQKTEAIQGDMPFVEGTPTKELLQEIPDLINVPTDGE
Ga0315324_1001680813300032019SeawaterMEYLAVALLSCLVGACGMNQKTEAIQGEMPFVEGTPTKVLLHDVPDLINVPTDGEGNPVKITVAIYK
Ga0315329_1008166453300032048SeawaterMEALPIIILSCLLGGCATATITAPEPEMPFVQGTPTKELLQEMPDLINTP
Ga0315321_1066805923300032088SeawaterMKYLAIALLSCLVSSCGVQQVKAIEGEMPFTQGTPTKELLNEMPPLVGMPTDGDGNPVKITVAVY
Ga0310345_1122727323300032278SeawaterMEYLAVALLSCLVGACSINQKTEAIQGDMPFIEGTPTKTLLQEIPKLINVPTDGDGNPVKITV
Ga0315334_1133000613300032360SeawaterMEYAAVILLSCLVGACSVNQKTEAIQGDMPFVQGTPTKTLLQEMPPLVNVPTDGEGNPVKITV
Ga0315334_1150627423300032360SeawaterMEALPIIILSCLLGGCATATITAPEPEMPFVQGTPTKELLQEMPDLINTPTDGE
Ga0314858_209068_2_1783300033742Sea-Ice BrineMKYLAIVLLSCLISSCGVQQVKAIEGEMPFTQGTPTKELLNEMPPLVGMPTDGDPPPSS
Ga0372840_018196_3_1943300034695SeawaterMEYLAVALLSCLVGACGMNQKTEAIQGDMPFIEGTPTKTLLHEMPNLINVPTDGEGNPVKITVA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.