Basic Information | |
---|---|
Family ID | F046274 |
Family Type | Metagenome |
Number of Sequences | 151 |
Average Sequence Length | 45 residues |
Representative Sequence | LGQLQIGALASLFGVSAALGASGLALVALAGATALLYPRLRAL |
Number of Associated Samples | 137 |
Number of Associated Scaffolds | 151 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.65 % |
% of genes near scaffold ends (potentially truncated) | 96.69 % |
% of genes from short scaffolds (< 2000 bps) | 94.70 % |
Associated GOLD sequencing projects | 133 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (80.132 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (9.934 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.815 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.735 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.34% β-sheet: 0.00% Coil/Unstructured: 43.66% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 151 Family Scaffolds |
---|---|---|
PF00211 | Guanylate_cyc | 7.95 |
PF06808 | DctM | 5.30 |
PF02668 | TauD | 3.97 |
PF02230 | Abhydrolase_2 | 3.97 |
PF02775 | TPP_enzyme_C | 2.65 |
PF14595 | Thioredoxin_9 | 1.99 |
PF01594 | AI-2E_transport | 1.99 |
PF08240 | ADH_N | 1.99 |
PF13378 | MR_MLE_C | 1.99 |
PF12695 | Abhydrolase_5 | 1.32 |
PF07859 | Abhydrolase_3 | 1.32 |
PF00903 | Glyoxalase | 1.32 |
PF00174 | Oxidored_molyb | 1.32 |
PF00665 | rve | 1.32 |
PF00378 | ECH_1 | 1.32 |
PF10503 | Esterase_PHB | 1.32 |
PF12006 | DUF3500 | 1.32 |
PF02515 | CoA_transf_3 | 1.32 |
PF01925 | TauE | 0.66 |
PF08028 | Acyl-CoA_dh_2 | 0.66 |
PF01292 | Ni_hydr_CYTB | 0.66 |
PF13857 | Ank_5 | 0.66 |
PF09382 | RQC | 0.66 |
PF05721 | PhyH | 0.66 |
PF00011 | HSP20 | 0.66 |
PF02661 | Fic | 0.66 |
PF02776 | TPP_enzyme_N | 0.66 |
PF00296 | Bac_luciferase | 0.66 |
PF00990 | GGDEF | 0.66 |
PF01972 | SDH_sah | 0.66 |
PF13676 | TIR_2 | 0.66 |
PF13365 | Trypsin_2 | 0.66 |
PF05685 | Uma2 | 0.66 |
COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
---|---|---|---|
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 7.95 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.97 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 1.99 |
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.32 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 1.32 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.32 |
COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 1.32 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 1.32 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 1.32 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 1.32 |
COG3915 | Uncharacterized conserved protein | Function unknown [S] | 1.32 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 1.32 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.66 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.66 |
COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.66 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.66 |
COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.66 |
COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.66 |
COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.66 |
COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.66 |
COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.66 |
COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.66 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 80.13 % |
Unclassified | root | N/A | 19.87 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664021|ICCgaii200_c0907170 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0423469 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 593 | Open in IMG/M |
3300000550|F24TB_10578706 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300000559|F14TC_100785911 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300000559|F14TC_103001460 | Not Available | 601 | Open in IMG/M |
3300000890|JGI11643J12802_10758927 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300000955|JGI1027J12803_108251663 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300001139|JGI10220J13317_10013310 | Not Available | 652 | Open in IMG/M |
3300002914|JGI25617J43924_10279963 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 570 | Open in IMG/M |
3300003319|soilL2_10081875 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
3300004058|Ga0055498_10147584 | Not Available | 511 | Open in IMG/M |
3300004156|Ga0062589_100160329 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
3300004281|Ga0066397_10151202 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300004479|Ga0062595_100960236 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300005174|Ga0066680_10585973 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300005176|Ga0066679_10296728 | Not Available | 1050 | Open in IMG/M |
3300005184|Ga0066671_10075957 | All Organisms → cellular organisms → Bacteria | 1793 | Open in IMG/M |
3300005206|Ga0068995_10102725 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 583 | Open in IMG/M |
3300005332|Ga0066388_100525309 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
3300005332|Ga0066388_102003882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1038 | Open in IMG/M |
3300005332|Ga0066388_103521865 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 799 | Open in IMG/M |
3300005332|Ga0066388_103967584 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300005332|Ga0066388_104982226 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300005341|Ga0070691_10603990 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300005438|Ga0070701_10099947 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
3300005440|Ga0070705_100556061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 881 | Open in IMG/M |
3300005444|Ga0070694_101658545 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300005445|Ga0070708_101810597 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300005446|Ga0066686_10440213 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300005467|Ga0070706_100398950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1280 | Open in IMG/M |
3300005471|Ga0070698_100566684 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
3300005539|Ga0068853_102067599 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300005542|Ga0070732_10594873 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300005546|Ga0070696_100330668 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300005557|Ga0066704_10657354 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 666 | Open in IMG/M |
3300005557|Ga0066704_10827902 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300005558|Ga0066698_10692843 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300005566|Ga0066693_10414127 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300005617|Ga0068859_101700833 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300005764|Ga0066903_108482856 | Not Available | 524 | Open in IMG/M |
3300006794|Ga0066658_10672316 | Not Available | 569 | Open in IMG/M |
3300006845|Ga0075421_102056408 | Not Available | 607 | Open in IMG/M |
3300006853|Ga0075420_100446883 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1116 | Open in IMG/M |
3300006865|Ga0073934_10649491 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 613 | Open in IMG/M |
3300006871|Ga0075434_100224923 | All Organisms → cellular organisms → Bacteria | 1896 | Open in IMG/M |
3300006880|Ga0075429_100374575 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
3300006904|Ga0075424_100020041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6840 | Open in IMG/M |
3300006914|Ga0075436_101048310 | Not Available | 613 | Open in IMG/M |
3300006954|Ga0079219_10331845 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 964 | Open in IMG/M |
3300006954|Ga0079219_12455266 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300006969|Ga0075419_10638886 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300007004|Ga0079218_10837924 | Not Available | 891 | Open in IMG/M |
3300009012|Ga0066710_103788413 | Not Available | 568 | Open in IMG/M |
3300009081|Ga0105098_10712108 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300009100|Ga0075418_10014220 | All Organisms → cellular organisms → Bacteria | 8820 | Open in IMG/M |
3300009101|Ga0105247_11688634 | Not Available | 523 | Open in IMG/M |
3300009137|Ga0066709_104309301 | Not Available | 519 | Open in IMG/M |
3300009147|Ga0114129_11623883 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 791 | Open in IMG/M |
3300009148|Ga0105243_10063549 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2958 | Open in IMG/M |
3300009156|Ga0111538_11435042 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300009157|Ga0105092_10597039 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300009162|Ga0075423_12097501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
3300009545|Ga0105237_10105081 | All Organisms → cellular organisms → Bacteria | 2815 | Open in IMG/M |
3300010047|Ga0126382_12433287 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 509 | Open in IMG/M |
3300010326|Ga0134065_10275750 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300010358|Ga0126370_12435056 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300010362|Ga0126377_11961641 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 661 | Open in IMG/M |
3300010398|Ga0126383_12285997 | Not Available | 626 | Open in IMG/M |
3300011436|Ga0137458_1059292 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1043 | Open in IMG/M |
3300012225|Ga0137434_1067908 | Not Available | 560 | Open in IMG/M |
3300012225|Ga0137434_1084480 | Not Available | 510 | Open in IMG/M |
3300012285|Ga0137370_10246478 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1057 | Open in IMG/M |
3300012361|Ga0137360_11103599 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 685 | Open in IMG/M |
3300012363|Ga0137390_11077843 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300012685|Ga0137397_10193360 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1513 | Open in IMG/M |
3300012906|Ga0157295_10023067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1267 | Open in IMG/M |
3300012907|Ga0157283_10154353 | Not Available | 680 | Open in IMG/M |
3300012912|Ga0157306_10018065 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1477 | Open in IMG/M |
3300012922|Ga0137394_10213266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1650 | Open in IMG/M |
3300012922|Ga0137394_11580318 | Not Available | 513 | Open in IMG/M |
3300012951|Ga0164300_10332505 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300012955|Ga0164298_11017934 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 613 | Open in IMG/M |
3300013100|Ga0157373_10768029 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 709 | Open in IMG/M |
3300013297|Ga0157378_12126339 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 612 | Open in IMG/M |
3300014154|Ga0134075_10234607 | Not Available | 792 | Open in IMG/M |
3300014326|Ga0157380_11980673 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 644 | Open in IMG/M |
3300015241|Ga0137418_10579317 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 884 | Open in IMG/M |
3300015241|Ga0137418_10579432 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 884 | Open in IMG/M |
3300017654|Ga0134069_1059303 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1213 | Open in IMG/M |
3300017656|Ga0134112_10010043 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3123 | Open in IMG/M |
3300017997|Ga0184610_1093929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Archangium → Archangium gephyra | 944 | Open in IMG/M |
3300017997|Ga0184610_1311735 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 517 | Open in IMG/M |
3300018084|Ga0184629_10255194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 917 | Open in IMG/M |
3300018422|Ga0190265_10111652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2589 | Open in IMG/M |
3300018422|Ga0190265_10547610 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
3300019377|Ga0190264_10119513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → environmental samples → uncultured Ramlibacter sp. | 1286 | Open in IMG/M |
3300019887|Ga0193729_1267329 | Not Available | 529 | Open in IMG/M |
3300020015|Ga0193734_1028934 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1041 | Open in IMG/M |
3300021432|Ga0210384_11363918 | Not Available | 614 | Open in IMG/M |
3300022756|Ga0222622_10538014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Archangium → Archangium gephyra | 838 | Open in IMG/M |
3300025318|Ga0209519_10683770 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 555 | Open in IMG/M |
3300025324|Ga0209640_10849330 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 715 | Open in IMG/M |
3300025324|Ga0209640_11305979 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300025535|Ga0207423_1007207 | All Organisms → cellular organisms → Bacteria | 1679 | Open in IMG/M |
3300025918|Ga0207662_10976654 | Not Available | 601 | Open in IMG/M |
3300025935|Ga0207709_10182795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → environmental samples → uncultured Ramlibacter sp. | 1482 | Open in IMG/M |
3300025961|Ga0207712_11017066 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 736 | Open in IMG/M |
3300025965|Ga0210090_1019363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18 | 931 | Open in IMG/M |
3300026005|Ga0208285_1006041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Archangium → Archangium gephyra | 847 | Open in IMG/M |
3300026015|Ga0208286_1020704 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 537 | Open in IMG/M |
3300026035|Ga0207703_11232499 | Not Available | 719 | Open in IMG/M |
3300026300|Ga0209027_1280088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 536 | Open in IMG/M |
3300026306|Ga0209468_1173930 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300026475|Ga0257147_1010981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1199 | Open in IMG/M |
3300027277|Ga0209846_1052360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
3300027665|Ga0209983_1116694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
3300027717|Ga0209998_10048041 | Not Available | 982 | Open in IMG/M |
3300027835|Ga0209515_10274946 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
3300027882|Ga0209590_11058474 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
3300027886|Ga0209486_11168618 | Not Available | 526 | Open in IMG/M |
3300028381|Ga0268264_10414666 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1297 | Open in IMG/M |
3300028590|Ga0247823_11135560 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 586 | Open in IMG/M |
3300028596|Ga0247821_10638644 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 690 | Open in IMG/M |
3300028597|Ga0247820_10578153 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 773 | Open in IMG/M |
3300028809|Ga0247824_10153388 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1240 | Open in IMG/M |
3300030006|Ga0299907_10229664 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1527 | Open in IMG/M |
3300031228|Ga0299914_11078077 | Not Available | 651 | Open in IMG/M |
3300031229|Ga0299913_10071949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3339 | Open in IMG/M |
3300031229|Ga0299913_11700264 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
3300031547|Ga0310887_10745654 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 611 | Open in IMG/M |
3300031548|Ga0307408_101250900 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300031731|Ga0307405_11109349 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300031740|Ga0307468_100372352 | Not Available | 1076 | Open in IMG/M |
3300031770|Ga0318521_11001042 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 512 | Open in IMG/M |
3300031777|Ga0318543_10541633 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 522 | Open in IMG/M |
3300031949|Ga0214473_11880700 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 588 | Open in IMG/M |
3300031965|Ga0326597_11967496 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300032002|Ga0307416_102661276 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300032003|Ga0310897_10077594 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1270 | Open in IMG/M |
3300032075|Ga0310890_10348410 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1082 | Open in IMG/M |
3300032143|Ga0315292_11343136 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300032174|Ga0307470_11669507 | Not Available | 535 | Open in IMG/M |
3300032179|Ga0310889_10742718 | Not Available | 515 | Open in IMG/M |
3300032180|Ga0307471_103179864 | Not Available | 582 | Open in IMG/M |
3300032205|Ga0307472_100901719 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300033004|Ga0335084_10898387 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 896 | Open in IMG/M |
3300033475|Ga0310811_10199271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2447 | Open in IMG/M |
3300033550|Ga0247829_11687431 | Not Available | 522 | Open in IMG/M |
3300033551|Ga0247830_11009267 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300033814|Ga0364930_0340854 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300034151|Ga0364935_0104907 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 871 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.61% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.62% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.30% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.64% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.65% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.65% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.65% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.65% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.65% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.99% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.99% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.99% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.99% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.99% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.32% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.32% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.32% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.32% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.32% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.32% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.66% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.66% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.66% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.66% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.66% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.66% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.66% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.66% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.66% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.66% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.66% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005206 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025535 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025965 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026005 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
3300026015 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICCgaii200_09071701 | 2228664021 | Soil | GALASLLGVSAALGVSGLALVTLASLTVLLYPRLRAL |
ICChiseqgaiiDRAFT_04234692 | 3300000033 | Soil | VVAIGLAPLGQLQIGALASLFGVGVALGTSGLALALLATLTALVFPRVKRI* |
F24TB_105787063 | 3300000550 | Soil | RGRAGGAWVVAIGFAPLGQIQIGALASLFGVSAALGASGLALVALAGATALLYPRLRAL* |
F14TC_1007859113 | 3300000559 | Soil | GAWVVAIGFAPLGQIQIGALASLFGVSAALGASGLALVALAGATALLYPRLRAL* |
F14TC_1030014602 | 3300000559 | Soil | LGQLQIGALASLVGVSAALTASGLALVGLAAGTLRVFPRLRRP* |
JGI11643J12802_107589273 | 3300000890 | Soil | AIGFAPLGQLQIGALASLLGVSAALGVSGLALVTLASLTVLLYPRLRAL* |
JGI1027J12803_1082516632 | 3300000955 | Soil | LGQLQIGALASLLGVSIALGASGLALVLLAGGTALLVPRVRRL* |
JGI10220J13317_100133102 | 3300001139 | Soil | GFAPLGQLQIGALASLLGVSAALGVSGLALVTLASLTVLLYPRLRAL* |
JGI25617J43924_102799632 | 3300002914 | Grasslands Soil | WVVAIGFAPLGQLQIGALASLLGVSAALGVSGLALVALASATVFFYPRLRAL* |
soilL2_100818751 | 3300003319 | Sugarcane Root And Bulk Soil | QLQIGALASLFGVSIALATSGTALVILALGTAALSPRLKRL* |
Ga0055498_101475841 | 3300004058 | Natural And Restored Wetlands | IQIGALASLFGVSAALGASGLGLVALAGATALFYPRLRAL* |
Ga0062589_1001603291 | 3300004156 | Soil | LQIGALASLFGVGVALGTSGLALALLATLTALVFPRVKRI* |
Ga0066397_101512021 | 3300004281 | Tropical Forest Soil | APLGQWQIGALASLFGVGVALGASGLALVVLAGAAALLVPRVRRL* |
Ga0062595_1009602361 | 3300004479 | Soil | AGGAWVVAIGLAPLGQLQIGALASAFGVGVGFAVSGLALALLTLATAVFAPRSRRL* |
Ga0066680_105859732 | 3300005174 | Soil | GQLQIGALASLFGVSVAFGASGLALAVLAGTTALLVPRARRL* |
Ga0066679_102967281 | 3300005176 | Soil | LAPLGQLQIGALASLFGVGIALGASGLALTALAGAAALTFPRVRRI* |
Ga0066671_100759572 | 3300005184 | Soil | GRAGGAWVVAIGLAPLGQLQIGALASLFGVSVAFGASGLALAVLAGATALLVPRARRL* |
Ga0068995_101027251 | 3300005206 | Natural And Restored Wetlands | IGLAPLGQIQIGALASLFGGSAALGASGLGLVALAGATALLYPRLRAL* |
Ga0066388_1005253092 | 3300005332 | Tropical Forest Soil | GLAPLGQLQIGALASLFGVSVALAGSGLALVGSAVLTALRFPRIRRL* |
Ga0066388_1020038823 | 3300005332 | Tropical Forest Soil | APLGQLQIGALASLLGVSVALAASGLALVGLAGVTLRVFPRVRSL* |
Ga0066388_1035218651 | 3300005332 | Tropical Forest Soil | LGQLQIGAMASLFGASIALGATGVALVALAIISALAVPRIRNI* |
Ga0066388_1039675842 | 3300005332 | Tropical Forest Soil | PLGQLQIGALASLFGVSLALGASGLALVALASGAAVLFPRVRHL* |
Ga0066388_1049822261 | 3300005332 | Tropical Forest Soil | IGLAPLGQLQIGGLASLFGVSLALGTTGLGLVGLAAGTWLLFPRLRHL* |
Ga0070691_106039901 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | GGAWVVAIGFAPLGQIQIGALASLLGVSAALGVSGLALVALASATVFFYPRLRAL* |
Ga0070701_100999473 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | LQIGALASLLGVSAALGVSGLALVTLASLTVLLYPRLRAL* |
Ga0070705_1005560611 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | PLGQLQIGALASLLGVSAALGVSGLALVALASATVFFYPRLRAL* |
Ga0070694_1016585451 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | APLGQLQIGALASLFGVSAALAASGLALVALGVGAALLFPRLRRLG* |
Ga0070708_1018105971 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LAPLGQLQIGGLASLFSVSAALGVSGLALVGLVTATAFAYPRLRRL* |
Ga0066686_104402131 | 3300005446 | Soil | AGGAWVVAIGLAPLGQLQIGALASLFGVGIALGASGLALTALAGAAALTFPRVRRI* |
Ga0070706_1003989503 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LGQLQIGALASLLGVSAALGVSGLALVALASATVFFYPRLRAL* |
Ga0070698_1005666841 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GFAPLGQLQIGALASLLGVSAALGVSGLALVALASATVFFYPRLRAL* |
Ga0068853_1020675992 | 3300005539 | Corn Rhizosphere | VVAIGLAPLGQLQIGALASLVGVSIAFGASGLALVLLAGSTALLVPRVRRL* |
Ga0070732_105948733 | 3300005542 | Surface Soil | GGAWVVAIGFAPLGQIQIGALASLLGVSVALGVSGLALVALASATVFFYPRLRAL* |
Ga0070696_1003306681 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | QLQMGALASLLGVSFAFGTSGVALVALASATALAFPRLRRL* |
Ga0066704_106573541 | 3300005557 | Soil | AIGFAPLGQLQIGALASLFGVGIALGASGLALTALAGAAALTFPRVRRI* |
Ga0066704_108279022 | 3300005557 | Soil | QIGALASLFGVGIALGASGLALTALAGAAALTFPRVRRI* |
Ga0066698_106928431 | 3300005558 | Soil | GQLQIGALASLFGVGIALGTSGLALVALAVAAAALVPRVRRL* |
Ga0066693_104141271 | 3300005566 | Soil | LAPLGQLQIGALASLFGVSVALGASGLALAALAGAAALVFPRVRRL* |
Ga0068859_1017008331 | 3300005617 | Switchgrass Rhizosphere | LQIGGLASLFSVSAALGVSGLALVGLVTATAFAYPRLRRL* |
Ga0066903_1084828561 | 3300005764 | Tropical Forest Soil | PLGQLQIGALASLLGVSVALAASGLALVGLAGVTLRVFPRVRSL* |
Ga0066658_106723162 | 3300006794 | Soil | APLGQMQIGALASLFGVSIAFGASGLALALLAIATAVLAPRARRL* |
Ga0075421_1020564082 | 3300006845 | Populus Rhizosphere | APLGQFQVGALASLLGVSAALGASGLALAALAGGTALLVTRIRRL* |
Ga0075420_1004468832 | 3300006853 | Populus Rhizosphere | QIGALASLFGVSIAFGTSGLALVILAGVTTVLFPRLKRL* |
Ga0073934_106494912 | 3300006865 | Hot Spring Sediment | GAWVVAIGLAPLGQLQIGALASLFGVSVALGASGLALVVLAGVTGVWFPRLKRV* |
Ga0075434_1002249234 | 3300006871 | Populus Rhizosphere | LQIGALASLFGVSAALATSGLALAVLATSAAVLFPRVRRL* |
Ga0075429_1003745751 | 3300006880 | Populus Rhizosphere | GALASLFGVSIAFGTSGLALVILAGVTTVLFPRLKRL* |
Ga0075424_1000200418 | 3300006904 | Populus Rhizosphere | GQLQIGALATLFGVGVAFGLSGFVLMVLAGGTALLFPRVRRL* |
Ga0075436_1010483102 | 3300006914 | Populus Rhizosphere | APLGQLQIGALASLLGVSAALGVSGLALVTLACATVFFYPRLRAL* |
Ga0079219_103318451 | 3300006954 | Agricultural Soil | AWVVAIGFAPLGQLQIGALASLLGVSAALGVSGLALVTLASLTVIFYPRLRAL* |
Ga0079219_124552662 | 3300006954 | Agricultural Soil | GLAPLGQLQIGALASAFGVTVGFAASGLALALLAVATAVFAPRARRL* |
Ga0075419_106388862 | 3300006969 | Populus Rhizosphere | IGALASLFGVAVALGTSGATLAVLAAGAAVLFPRIRRL* |
Ga0079218_108379242 | 3300007004 | Agricultural Soil | LGQLQIGALGSLVGVSAALAASGLALVALAGLTARAFPRLRKP* |
Ga0066710_1037884132 | 3300009012 | Grasslands Soil | GAWVVAVGLAPLGQLQIGALASAFGVSVGFAVSGLALAVLALATAVLAPRARRL |
Ga0105098_107121082 | 3300009081 | Freshwater Sediment | QIGALASLFGVSIALGTSGLALAILAAATGLLYPRVKRV* |
Ga0075418_1001422011 | 3300009100 | Populus Rhizosphere | ASLFGVGVAFGASGLALTLMAGATALLFPKVRRL* |
Ga0105247_116886342 | 3300009101 | Switchgrass Rhizosphere | LGQLQIGALASLLGVSAALGVSGLALVTLASLTVLLYPRLRAL* |
Ga0066709_1043093011 | 3300009137 | Grasslands Soil | LGQLQIGAMASLFGASIALGASGLALVALAVIGALAVPRIRNI* |
Ga0114129_116238831 | 3300009147 | Populus Rhizosphere | LASLFGVSIALGTSGLALAMLAGTTVVLFPRLKRV* |
Ga0105243_100635494 | 3300009148 | Miscanthus Rhizosphere | APLGQLQIGGLASLFSVSAALGVSGLALVGLVTATAFAYPRLRRL* |
Ga0111538_114350421 | 3300009156 | Populus Rhizosphere | LQIGARASAFGVGVGFAASGLALVLLAVATAVFAPRARRL* |
Ga0105092_105970392 | 3300009157 | Freshwater Sediment | AIGLAPLGQLQIGALASLFGVSIALGTSGLALAILAAATGLLYPRVKRV* |
Ga0075423_120975011 | 3300009162 | Populus Rhizosphere | QLQIGALASLVGVSAALGTSGFALMALAGALAFMFPRVRRL* |
Ga0105237_101050815 | 3300009545 | Corn Rhizosphere | GRAGGAWVVAIGFAPLGQLQIGALASLLGVSAALGVSGLALVTLASLTVLLYPRLRAL* |
Ga0126382_124332872 | 3300010047 | Tropical Forest Soil | QLQIGALASLVGVSIAFGTSGLALVLLAGSAALLVPRVRRL* |
Ga0134065_102757502 | 3300010326 | Grasslands Soil | GAWVVAIGLGPLGHLQIGALASLFGVGVALGTSGAALVTLALAGAPLFPRVRRL* |
Ga0126370_124350562 | 3300010358 | Tropical Forest Soil | LAPLGQFQIGALASLLGVSMALGLSGLGLITLVGVTVFLFPPIRRL* |
Ga0126377_119616412 | 3300010362 | Tropical Forest Soil | AIGLAPLGQLQIGALASLFGVSIALGASGLALAMLAVTTALLVPRVRRV* |
Ga0126383_122859972 | 3300010398 | Tropical Forest Soil | LGQLQIGALASLFGASVALGISGVGLLALAGAAALAFPRLRRL* |
Ga0137458_10592922 | 3300011436 | Soil | LGQIQMGALASLFGVSAALGASGLGLVALAGATALLYPRLRAL* |
Ga0137434_10679082 | 3300012225 | Soil | IGALASLFGVSAALGASGLALTALAITAALLFPRVRRL* |
Ga0137434_10844802 | 3300012225 | Soil | AIGLAPLGQLQMGALASLFGVSAALGASGLGLVVLAGATALLYPRLRAL* |
Ga0137370_102464781 | 3300012285 | Vadose Zone Soil | QIGALASLFGVGVAFGVSGLALITLTGATALLFPRVRRL* |
Ga0137360_111035991 | 3300012361 | Vadose Zone Soil | VLAIGLAPLGQLQIGALASLFGVSAALATSGLALAALAVTAAILFPSVRRL* |
Ga0137390_110778431 | 3300012363 | Vadose Zone Soil | PLGQLQIGALASLFGVSLAFGTSGLGLVALASAAAVSFPRVRRL* |
Ga0137397_101933603 | 3300012685 | Vadose Zone Soil | QIGALASLFGVGVAFGTSGLALVMLAGATALLFPRVRRL* |
Ga0157295_100230671 | 3300012906 | Soil | IGFAPLGQLQIGALASLFGVSAALGASGLALVALAGATALLYPRLRAL* |
Ga0157283_101543531 | 3300012907 | Soil | LGQLQIGALASLFGVSAALGASGLALVALAGATALLYPRLRAL* |
Ga0157306_100180651 | 3300012912 | Soil | IGAMASLFGVSLALGASGLGLLALAGAAALWSPRLRRL* |
Ga0137394_102132661 | 3300012922 | Vadose Zone Soil | QIGALASLLGVSAALGVSGLALVALACATVFFYPRLRAL* |
Ga0137394_115803182 | 3300012922 | Vadose Zone Soil | IGALASLFGVGIALGTSGLALVALAVAAAALVPRVRRL* |
Ga0164300_103325053 | 3300012951 | Soil | PLGQRHIGALASLLGVSAALGVSGLALVTLASLTVFLYPRLRAL* |
Ga0164298_110179343 | 3300012955 | Soil | AWVVAIGFAPLGQLQIGALASLLGVSAALGVSGLALATLAFLTVLLYPRLRAL* |
Ga0157373_107680292 | 3300013100 | Corn Rhizosphere | ALASLVGVSIAFGASGLALVLLAGSTALLVPRVRRL* |
Ga0157378_121263392 | 3300013297 | Miscanthus Rhizosphere | QIGALASLVGVSIAFGASGLALVLLAGSTALLVPRVRRL* |
Ga0134075_102346071 | 3300014154 | Grasslands Soil | QLQVGALASLFGVSIALGASGLALTAVAGAAALTFPRVRRI* |
Ga0157380_119806732 | 3300014326 | Switchgrass Rhizosphere | GRAGGAWVVAIGLAPLGQLQIGALASLFGVSIALGASGLALATLAGATVLLFPHVKRV* |
Ga0137418_105793171 | 3300015241 | Vadose Zone Soil | GQLQIGALASLFGVSVAFGASGVALVLLAGATALLFPRVRRL* |
Ga0137418_105794321 | 3300015241 | Vadose Zone Soil | GQLQIGALASLFGVSVAFGASGVALILLAGATALLFPRVRRL* |
Ga0134069_10593032 | 3300017654 | Grasslands Soil | APLGQLQIGALATMFGVSVAFGASGLALVALAGATALLFPRLRRL |
Ga0134112_100100434 | 3300017656 | Grasslands Soil | PLGQLQIGALATLFGVSVAFGTSGLALVTLAGVTALLFPRLRRL |
Ga0184610_10939293 | 3300017997 | Groundwater Sediment | QMGALASLFGVSAALGASGLGLVALAGATALLYPRLRAL |
Ga0184610_13117352 | 3300017997 | Groundwater Sediment | GALASLFGVSIALGVSGLGLVVLAGAAALLFPRIRRL |
Ga0184629_102551942 | 3300018084 | Groundwater Sediment | GALASLFGVSAALGASGLGLVALAGATALLYPRLRAL |
Ga0190265_101116523 | 3300018422 | Soil | QMVALASLFGVSIALGASGLALATLAGATVLLFPRVKRV |
Ga0190265_105476101 | 3300018422 | Soil | LAPLGQMQMGALASLFGVSVALGTSGVALVVVATATGLLFPRMKRT |
Ga0190264_101195131 | 3300019377 | Soil | LASLFGVSAALGASGLALVALVAATALAYPRLRRL |
Ga0193729_12673291 | 3300019887 | Soil | GQLQIGALASLLGVSAALGVSGLALVALATATLFFYPRLRAL |
Ga0193734_10289341 | 3300020015 | Soil | RGRAGGAWVVAIGFAPLGQLQIGALASLLGVSAALGVSGLALIALASATVFFYPRLRAL |
Ga0210384_113639181 | 3300021432 | Soil | ALASLLGVSAALGVSGLALVALASATVFFYPRLRAL |
Ga0222622_105380141 | 3300022756 | Groundwater Sediment | IGALASLFGVSAALGASGLGLVALAGATALLYPRLRAL |
Ga0209519_106837702 | 3300025318 | Soil | GLAPLGQLQIGALASLFGVSVALGASGLGLAALAAAGALWLPRVRRL |
Ga0209640_108493301 | 3300025324 | Soil | GQLQIGALASLFGVSVALGASGLGLAALAAAGALWLPRVRRL |
Ga0209640_113059791 | 3300025324 | Soil | LAPLGQLQIGALASLFGVSVALGTSGLALMILAGATGLLFPRVKRV |
Ga0207423_10072071 | 3300025535 | Natural And Restored Wetlands | GALASLFGVSAALGASGLGLVALAGATALFYPRLRAL |
Ga0207662_109766542 | 3300025918 | Switchgrass Rhizosphere | ALASLFGVSAALGASGLGLVALAGATALLYPRLRAL |
Ga0207709_101827952 | 3300025935 | Miscanthus Rhizosphere | QLQIGGLASLFSVSAALGVSGLALVGLVTATAFAYPRLRRL |
Ga0207712_110170661 | 3300025961 | Switchgrass Rhizosphere | LGQLQIGALASLFGVSLALGASGLALVALATGAAMLFPRVRHL |
Ga0210090_10193633 | 3300025965 | Natural And Restored Wetlands | LASLFGVSAALGASGLGLVALAGATALFYPRLRAL |
Ga0208285_10060411 | 3300026005 | Rice Paddy Soil | IGALASLLGVSAALGVSGLALVALASATVFFYPRLRAL |
Ga0208286_10207042 | 3300026015 | Rice Paddy Soil | GRAGGAWVVAIGFAPLGQIQIGALASLFGVSAALGLSGLALVALASATVFFYPRLRAL |
Ga0207703_112324992 | 3300026035 | Switchgrass Rhizosphere | VVAIGFAPLGQLQIGALASLLGVSAALGVSGLALVTLASLTVFLYPRLRALLGRAIAGAAGPW |
Ga0209027_12800881 | 3300026300 | Grasslands Soil | LQIGALASLFGVGVALGTSGAALVTLALAGALLFPRVRRL |
Ga0209468_11739301 | 3300026306 | Soil | ALASLFGVGVALGTSGAALVTLALAGALLFPRVRRL |
Ga0257147_10109811 | 3300026475 | Soil | GQLQIGALASLLGVSAALGVSGLALVALACATVFFYPRLRAL |
Ga0209846_10523602 | 3300027277 | Groundwater Sand | VRGRQLQIGALASLFGVSAALGASGLALVALAGATALLYPRLRAL |
Ga0209983_11166941 | 3300027665 | Arabidopsis Thaliana Rhizosphere | QLQIGALASLLGVSAALGVSGLALVTLASLTVLLYPRLRAL |
Ga0209998_100480411 | 3300027717 | Arabidopsis Thaliana Rhizosphere | GQLQIGALASLRGVSAALAASGLALVGLAGATRRVFPQIRRL |
Ga0209515_102749461 | 3300027835 | Groundwater | VVAIGLAPLGQLQIGALASLLGVSIALGASGLALVLLASATALLFLRMR |
Ga0209590_110584742 | 3300027882 | Vadose Zone Soil | FAPLGQLQIGALASLFGVSAALGASGLALVALAGATALLYPRLRAL |
Ga0209486_111686182 | 3300027886 | Agricultural Soil | LGQLQIGALGSLVGVSAALAASGLALVALAGLTARAFPRLRKP |
Ga0268264_104146662 | 3300028381 | Switchgrass Rhizosphere | IGLAPLGQLQIGGLASLFSVSAALGASGLALVGLVAATALAYPRLRRL |
Ga0247823_111355601 | 3300028590 | Soil | LQIGALASLFGVSIALGTSGLALAMLAGTTVVLFPRLKRV |
Ga0247821_106386442 | 3300028596 | Soil | IGLAPLGQLQIGALASLLSVSIALGTSGLALVLLSASAALLVPRVRRL |
Ga0247820_105781531 | 3300028597 | Soil | GRAGGAWVVAIGLAPLGQLQIGALASLLSVSIALGTSGLALVLLAASAALLVPRVRRL |
Ga0247824_101533881 | 3300028809 | Soil | GAWVVAIGLAPLGQLQIGALASLFGVSIALGTSGLALAMLAGTTVVLFPRLKRV |
Ga0299907_102296644 | 3300030006 | Soil | QLQIGALASLFGVGAALGASGLGLVALAGATALLYPRLRAL |
Ga0299914_110780772 | 3300031228 | Soil | LAPVGQIQIGALASLFGVSIALGASGLALVALAAGAALLFPRLRTF |
Ga0299913_100719491 | 3300031229 | Soil | APLGQLQIGALASLFGVGAALGASGLGLVALAGATALLYPRLRAL |
Ga0299913_117002641 | 3300031229 | Soil | LQMGALASLFGVSIALGASGLALATLAGATVLLFPRVKRV |
Ga0310887_107456542 | 3300031547 | Soil | PLGQLQIGALASLLSVSIALGTSGLALVLLAASAALLVPRVRRL |
Ga0307408_1012509001 | 3300031548 | Rhizosphere | LQIGALATLFGVSVALGTSGLALALLAVVTAVTFPRVKRC |
Ga0307405_111093492 | 3300031731 | Rhizosphere | VPAALRGRAGGAWVVAIGLAPIGQIQIGALATLFGVSVALGTSGLALALLAVVTAVMFPRVKKC |
Ga0307468_1003723521 | 3300031740 | Hardwood Forest Soil | VGLAPLGQLQIGALASAFGVSVAFGASGLALALLALATAVFAPRARRL |
Ga0318521_110010421 | 3300031770 | Soil | WVVAIGLAPLGQLQIGALASLFGVSLALGASGLALVALASGTAILFPRVRHL |
Ga0318543_105416331 | 3300031777 | Soil | GQLQIGALASLFGVSLALGASGLALVALASGTAILFPRVRHL |
Ga0214473_118807002 | 3300031949 | Soil | AWVVAIGLAPLGQLQIGALASLFGVSVALGTSGLALAMLAGTTALVFPRVRRV |
Ga0326597_119674961 | 3300031965 | Soil | PLGQLQIGALASVLGVSAAFGLSGLALVIVAAVGAYCFPRLRTL |
Ga0307416_1026612762 | 3300032002 | Rhizosphere | GAWVVAIGLAPLGQLQIGALASLFGVGVAFGTSGLALALLAVLTAVVYPRVKRI |
Ga0310897_100775942 | 3300032003 | Soil | IGLAPLGQLQIGALASLLSVSIALGTSGLALVLLAASAALLVPRVRRL |
Ga0310890_103484101 | 3300032075 | Soil | GGAWVVAIGLAPLGQLQIGALASLVGVSIAFGASGLALVLLAGSTALFVPRVRRL |
Ga0315292_113431361 | 3300032143 | Sediment | GLAPLGQLQIGALASLVGVSAALGASGFALIALALAASKVHPQLRKT |
Ga0307470_116695072 | 3300032174 | Hardwood Forest Soil | APLGQIQIGALASLFGVSAALGASGLGLVALAGATALLYPRLRAL |
Ga0310889_107427181 | 3300032179 | Soil | GQIQIGALASLLGVSAALGVSGLALVALASATVFFYPRLRAL |
Ga0307471_1031798641 | 3300032180 | Hardwood Forest Soil | LASLFGVSAALATSGLALAALAVTAALLFPSVRRL |
Ga0307472_1009017193 | 3300032205 | Hardwood Forest Soil | PLGQLQIGALASLLGVSAALGVSGLALVALASATVFFYPRLRAL |
Ga0335084_108983872 | 3300033004 | Soil | QIGALASLVGVSIALGASGLALVLLAGGTALLVPRVRRL |
Ga0310811_101992714 | 3300033475 | Soil | PLGQLQIGAVASLFGVGVAFGASGLALTLLAGATALLFPRLRRL |
Ga0247829_116874312 | 3300033550 | Soil | VVAIGFAPLGQLQIGALASLLGVSAALGVSGLALVTLASLTVLLYPRLRAL |
Ga0247830_110092671 | 3300033551 | Soil | RSAGGAWVVAIGLAPLGQLQIGALATLFGVSVALGTSGLALALLAVVTAVVFPRVKRC |
Ga0364930_0340854_322_501 | 3300033814 | Sediment | RGRAGGAWVVAIGLAPLGQFQIGALASLFGVSAALGASGLALVALAGATALLYPRLRAL |
Ga0364935_0104907_43_198 | 3300034151 | Sediment | VVAIGLGPLGQLQIGALASLFGVGIALGASGLALAALAGVIAILVPRVRRL |
⦗Top⦘ |