NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F046274

Metagenome Family F046274

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046274
Family Type Metagenome
Number of Sequences 151
Average Sequence Length 45 residues
Representative Sequence LGQLQIGALASLFGVSAALGASGLALVALAGATALLYPRLRAL
Number of Associated Samples 137
Number of Associated Scaffolds 151

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.65 %
% of genes near scaffold ends (potentially truncated) 96.69 %
% of genes from short scaffolds (< 2000 bps) 94.70 %
Associated GOLD sequencing projects 133
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.132 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(9.934 % of family members)
Environment Ontology (ENVO) Unclassified
(27.815 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.735 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 56.34%    β-sheet: 0.00%    Coil/Unstructured: 43.66%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 151 Family Scaffolds
PF00211Guanylate_cyc 7.95
PF06808DctM 5.30
PF02668TauD 3.97
PF02230Abhydrolase_2 3.97
PF02775TPP_enzyme_C 2.65
PF14595Thioredoxin_9 1.99
PF01594AI-2E_transport 1.99
PF08240ADH_N 1.99
PF13378MR_MLE_C 1.99
PF12695Abhydrolase_5 1.32
PF07859Abhydrolase_3 1.32
PF00903Glyoxalase 1.32
PF00174Oxidored_molyb 1.32
PF00665rve 1.32
PF00378ECH_1 1.32
PF10503Esterase_PHB 1.32
PF12006DUF3500 1.32
PF02515CoA_transf_3 1.32
PF01925TauE 0.66
PF08028Acyl-CoA_dh_2 0.66
PF01292Ni_hydr_CYTB 0.66
PF13857Ank_5 0.66
PF09382RQC 0.66
PF05721PhyH 0.66
PF00011HSP20 0.66
PF02661Fic 0.66
PF02776TPP_enzyme_N 0.66
PF00296Bac_luciferase 0.66
PF00990GGDEF 0.66
PF01972SDH_sah 0.66
PF13676TIR_2 0.66
PF13365Trypsin_2 0.66
PF05685Uma2 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 151 Family Scaffolds
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 7.95
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 3.97
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 1.99
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.32
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 1.32
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 1.32
COG2041Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductasesEnergy production and conversion [C] 1.32
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 1.32
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 1.32
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 1.32
COG3915Uncharacterized conserved proteinFunction unknown [S] 1.32
COG4584TransposaseMobilome: prophages, transposons [X] 1.32
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.66
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.66
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.66
COG1969Ni,Fe-hydrogenase I cytochrome b subunitEnergy production and conversion [C] 0.66
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.66
COG2864Cytochrome b subunit of formate dehydrogenaseEnergy production and conversion [C] 0.66
COG3038Cytochrome b561Energy production and conversion [C] 0.66
COG3658Cytochrome b subunit of Ni2+-dependent hydrogenaseEnergy production and conversion [C] 0.66
COG4117Thiosulfate reductase cytochrome b subunitInorganic ion transport and metabolism [P] 0.66
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 0.66
COG5285Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) familySecondary metabolites biosynthesis, transport and catabolism [Q] 0.66


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.13 %
UnclassifiedrootN/A19.87 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664021|ICCgaii200_c0907170All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0423469All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium593Open in IMG/M
3300000550|F24TB_10578706All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300000559|F14TC_100785911All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300000559|F14TC_103001460Not Available601Open in IMG/M
3300000890|JGI11643J12802_10758927All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300000955|JGI1027J12803_108251663All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300001139|JGI10220J13317_10013310Not Available652Open in IMG/M
3300002914|JGI25617J43924_10279963All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria570Open in IMG/M
3300003319|soilL2_10081875All Organisms → cellular organisms → Bacteria1243Open in IMG/M
3300004058|Ga0055498_10147584Not Available511Open in IMG/M
3300004156|Ga0062589_100160329All Organisms → cellular organisms → Bacteria1559Open in IMG/M
3300004281|Ga0066397_10151202All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300004479|Ga0062595_100960236All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300005174|Ga0066680_10585973All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300005176|Ga0066679_10296728Not Available1050Open in IMG/M
3300005184|Ga0066671_10075957All Organisms → cellular organisms → Bacteria1793Open in IMG/M
3300005206|Ga0068995_10102725All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria583Open in IMG/M
3300005332|Ga0066388_100525309All Organisms → cellular organisms → Bacteria1816Open in IMG/M
3300005332|Ga0066388_102003882All Organisms → cellular organisms → Bacteria → Proteobacteria1038Open in IMG/M
3300005332|Ga0066388_103521865All Organisms → cellular organisms → Bacteria → Proteobacteria799Open in IMG/M
3300005332|Ga0066388_103967584All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300005332|Ga0066388_104982226All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300005341|Ga0070691_10603990All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300005438|Ga0070701_10099947All Organisms → cellular organisms → Bacteria1605Open in IMG/M
3300005440|Ga0070705_100556061All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales881Open in IMG/M
3300005444|Ga0070694_101658545All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300005445|Ga0070708_101810597All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300005446|Ga0066686_10440213All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300005467|Ga0070706_100398950All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1280Open in IMG/M
3300005471|Ga0070698_100566684All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300005539|Ga0068853_102067599All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005542|Ga0070732_10594873All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300005546|Ga0070696_100330668All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300005557|Ga0066704_10657354All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium666Open in IMG/M
3300005557|Ga0066704_10827902All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300005558|Ga0066698_10692843All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300005566|Ga0066693_10414127All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005617|Ga0068859_101700833All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300005764|Ga0066903_108482856Not Available524Open in IMG/M
3300006794|Ga0066658_10672316Not Available569Open in IMG/M
3300006845|Ga0075421_102056408Not Available607Open in IMG/M
3300006853|Ga0075420_100446883All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1116Open in IMG/M
3300006865|Ga0073934_10649491All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria613Open in IMG/M
3300006871|Ga0075434_100224923All Organisms → cellular organisms → Bacteria1896Open in IMG/M
3300006880|Ga0075429_100374575All Organisms → cellular organisms → Bacteria1246Open in IMG/M
3300006904|Ga0075424_100020041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria6840Open in IMG/M
3300006914|Ga0075436_101048310Not Available613Open in IMG/M
3300006954|Ga0079219_10331845All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria964Open in IMG/M
3300006954|Ga0079219_12455266All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300006969|Ga0075419_10638886All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300007004|Ga0079218_10837924Not Available891Open in IMG/M
3300009012|Ga0066710_103788413Not Available568Open in IMG/M
3300009081|Ga0105098_10712108All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300009100|Ga0075418_10014220All Organisms → cellular organisms → Bacteria8820Open in IMG/M
3300009101|Ga0105247_11688634Not Available523Open in IMG/M
3300009137|Ga0066709_104309301Not Available519Open in IMG/M
3300009147|Ga0114129_11623883All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria791Open in IMG/M
3300009148|Ga0105243_10063549All Organisms → cellular organisms → Bacteria → Proteobacteria2958Open in IMG/M
3300009156|Ga0111538_11435042All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300009157|Ga0105092_10597039All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300009162|Ga0075423_12097501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300009545|Ga0105237_10105081All Organisms → cellular organisms → Bacteria2815Open in IMG/M
3300010047|Ga0126382_12433287All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria509Open in IMG/M
3300010326|Ga0134065_10275750All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300010358|Ga0126370_12435056All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300010362|Ga0126377_11961641All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria661Open in IMG/M
3300010398|Ga0126383_12285997Not Available626Open in IMG/M
3300011436|Ga0137458_1059292All Organisms → cellular organisms → Bacteria → Proteobacteria1043Open in IMG/M
3300012225|Ga0137434_1067908Not Available560Open in IMG/M
3300012225|Ga0137434_1084480Not Available510Open in IMG/M
3300012285|Ga0137370_10246478All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1057Open in IMG/M
3300012361|Ga0137360_11103599All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria685Open in IMG/M
3300012363|Ga0137390_11077843All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300012685|Ga0137397_10193360All Organisms → cellular organisms → Bacteria → Proteobacteria1513Open in IMG/M
3300012906|Ga0157295_10023067All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1267Open in IMG/M
3300012907|Ga0157283_10154353Not Available680Open in IMG/M
3300012912|Ga0157306_10018065All Organisms → cellular organisms → Bacteria → Proteobacteria1477Open in IMG/M
3300012922|Ga0137394_10213266All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1650Open in IMG/M
3300012922|Ga0137394_11580318Not Available513Open in IMG/M
3300012951|Ga0164300_10332505All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300012955|Ga0164298_11017934All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria613Open in IMG/M
3300013100|Ga0157373_10768029All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria709Open in IMG/M
3300013297|Ga0157378_12126339All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria612Open in IMG/M
3300014154|Ga0134075_10234607Not Available792Open in IMG/M
3300014326|Ga0157380_11980673All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium644Open in IMG/M
3300015241|Ga0137418_10579317All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium884Open in IMG/M
3300015241|Ga0137418_10579432All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium884Open in IMG/M
3300017654|Ga0134069_1059303All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1213Open in IMG/M
3300017656|Ga0134112_10010043All Organisms → cellular organisms → Bacteria → Proteobacteria3123Open in IMG/M
3300017997|Ga0184610_1093929All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Archangium → Archangium gephyra944Open in IMG/M
3300017997|Ga0184610_1311735All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria517Open in IMG/M
3300018084|Ga0184629_10255194All Organisms → cellular organisms → Bacteria → Proteobacteria917Open in IMG/M
3300018422|Ga0190265_10111652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2589Open in IMG/M
3300018422|Ga0190265_10547610All Organisms → cellular organisms → Bacteria1273Open in IMG/M
3300019377|Ga0190264_10119513All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → environmental samples → uncultured Ramlibacter sp.1286Open in IMG/M
3300019887|Ga0193729_1267329Not Available529Open in IMG/M
3300020015|Ga0193734_1028934All Organisms → cellular organisms → Bacteria → Proteobacteria1041Open in IMG/M
3300021432|Ga0210384_11363918Not Available614Open in IMG/M
3300022756|Ga0222622_10538014All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Archangium → Archangium gephyra838Open in IMG/M
3300025318|Ga0209519_10683770All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria555Open in IMG/M
3300025324|Ga0209640_10849330All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria715Open in IMG/M
3300025324|Ga0209640_11305979All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300025535|Ga0207423_1007207All Organisms → cellular organisms → Bacteria1679Open in IMG/M
3300025918|Ga0207662_10976654Not Available601Open in IMG/M
3300025935|Ga0207709_10182795All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → environmental samples → uncultured Ramlibacter sp.1482Open in IMG/M
3300025961|Ga0207712_11017066All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria736Open in IMG/M
3300025965|Ga0210090_1019363All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18931Open in IMG/M
3300026005|Ga0208285_1006041All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Archangium → Archangium gephyra847Open in IMG/M
3300026015|Ga0208286_1020704All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria537Open in IMG/M
3300026035|Ga0207703_11232499Not Available719Open in IMG/M
3300026300|Ga0209027_1280088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium536Open in IMG/M
3300026306|Ga0209468_1173930All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300026475|Ga0257147_1010981All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1199Open in IMG/M
3300027277|Ga0209846_1052360All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium625Open in IMG/M
3300027665|Ga0209983_1116694All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300027717|Ga0209998_10048041Not Available982Open in IMG/M
3300027835|Ga0209515_10274946All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300027882|Ga0209590_11058474All Organisms → cellular organisms → Bacteria → Proteobacteria503Open in IMG/M
3300027886|Ga0209486_11168618Not Available526Open in IMG/M
3300028381|Ga0268264_10414666All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1297Open in IMG/M
3300028590|Ga0247823_11135560All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium586Open in IMG/M
3300028596|Ga0247821_10638644All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria690Open in IMG/M
3300028597|Ga0247820_10578153All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium773Open in IMG/M
3300028809|Ga0247824_10153388All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1240Open in IMG/M
3300030006|Ga0299907_10229664All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1527Open in IMG/M
3300031228|Ga0299914_11078077Not Available651Open in IMG/M
3300031229|Ga0299913_10071949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3339Open in IMG/M
3300031229|Ga0299913_11700264All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium581Open in IMG/M
3300031547|Ga0310887_10745654All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium611Open in IMG/M
3300031548|Ga0307408_101250900All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300031731|Ga0307405_11109349All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300031740|Ga0307468_100372352Not Available1076Open in IMG/M
3300031770|Ga0318521_11001042All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria512Open in IMG/M
3300031777|Ga0318543_10541633All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria522Open in IMG/M
3300031949|Ga0214473_11880700All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium588Open in IMG/M
3300031965|Ga0326597_11967496All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300032002|Ga0307416_102661276All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300032003|Ga0310897_10077594All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1270Open in IMG/M
3300032075|Ga0310890_10348410All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1082Open in IMG/M
3300032143|Ga0315292_11343136All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300032174|Ga0307470_11669507Not Available535Open in IMG/M
3300032179|Ga0310889_10742718Not Available515Open in IMG/M
3300032180|Ga0307471_103179864Not Available582Open in IMG/M
3300032205|Ga0307472_100901719All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300033004|Ga0335084_10898387All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria896Open in IMG/M
3300033475|Ga0310811_10199271All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2447Open in IMG/M
3300033550|Ga0247829_11687431Not Available522Open in IMG/M
3300033551|Ga0247830_11009267All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300033814|Ga0364930_0340854All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300034151|Ga0364935_0104907All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria871Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.61%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.62%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.30%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.64%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil2.65%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.99%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.99%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.99%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.99%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.32%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.32%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.32%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.32%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.32%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.66%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.66%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.66%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.66%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.66%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.66%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.66%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.66%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.66%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.66%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001139Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soilEnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300004058Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005206Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300012225Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2EnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025535Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025965Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026005Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 (SPAdes)EnvironmentalOpen in IMG/M
3300026015Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026475Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-AEnvironmentalOpen in IMG/M
3300027277Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027665Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027717Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027835Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028590Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICCgaii200_090717012228664021SoilGALASLLGVSAALGVSGLALVTLASLTVLLYPRLRAL
ICChiseqgaiiDRAFT_042346923300000033SoilVVAIGLAPLGQLQIGALASLFGVGVALGTSGLALALLATLTALVFPRVKRI*
F24TB_1057870633300000550SoilRGRAGGAWVVAIGFAPLGQIQIGALASLFGVSAALGASGLALVALAGATALLYPRLRAL*
F14TC_10078591133300000559SoilGAWVVAIGFAPLGQIQIGALASLFGVSAALGASGLALVALAGATALLYPRLRAL*
F14TC_10300146023300000559SoilLGQLQIGALASLVGVSAALTASGLALVGLAAGTLRVFPRLRRP*
JGI11643J12802_1075892733300000890SoilAIGFAPLGQLQIGALASLLGVSAALGVSGLALVTLASLTVLLYPRLRAL*
JGI1027J12803_10825166323300000955SoilLGQLQIGALASLLGVSIALGASGLALVLLAGGTALLVPRVRRL*
JGI10220J13317_1001331023300001139SoilGFAPLGQLQIGALASLLGVSAALGVSGLALVTLASLTVLLYPRLRAL*
JGI25617J43924_1027996323300002914Grasslands SoilWVVAIGFAPLGQLQIGALASLLGVSAALGVSGLALVALASATVFFYPRLRAL*
soilL2_1008187513300003319Sugarcane Root And Bulk SoilQLQIGALASLFGVSIALATSGTALVILALGTAALSPRLKRL*
Ga0055498_1014758413300004058Natural And Restored WetlandsIQIGALASLFGVSAALGASGLGLVALAGATALFYPRLRAL*
Ga0062589_10016032913300004156SoilLQIGALASLFGVGVALGTSGLALALLATLTALVFPRVKRI*
Ga0066397_1015120213300004281Tropical Forest SoilAPLGQWQIGALASLFGVGVALGASGLALVVLAGAAALLVPRVRRL*
Ga0062595_10096023613300004479SoilAGGAWVVAIGLAPLGQLQIGALASAFGVGVGFAVSGLALALLTLATAVFAPRSRRL*
Ga0066680_1058597323300005174SoilGQLQIGALASLFGVSVAFGASGLALAVLAGTTALLVPRARRL*
Ga0066679_1029672813300005176SoilLAPLGQLQIGALASLFGVGIALGASGLALTALAGAAALTFPRVRRI*
Ga0066671_1007595723300005184SoilGRAGGAWVVAIGLAPLGQLQIGALASLFGVSVAFGASGLALAVLAGATALLVPRARRL*
Ga0068995_1010272513300005206Natural And Restored WetlandsIGLAPLGQIQIGALASLFGGSAALGASGLGLVALAGATALLYPRLRAL*
Ga0066388_10052530923300005332Tropical Forest SoilGLAPLGQLQIGALASLFGVSVALAGSGLALVGSAVLTALRFPRIRRL*
Ga0066388_10200388233300005332Tropical Forest SoilAPLGQLQIGALASLLGVSVALAASGLALVGLAGVTLRVFPRVRSL*
Ga0066388_10352186513300005332Tropical Forest SoilLGQLQIGAMASLFGASIALGATGVALVALAIISALAVPRIRNI*
Ga0066388_10396758423300005332Tropical Forest SoilPLGQLQIGALASLFGVSLALGASGLALVALASGAAVLFPRVRHL*
Ga0066388_10498222613300005332Tropical Forest SoilIGLAPLGQLQIGGLASLFGVSLALGTTGLGLVGLAAGTWLLFPRLRHL*
Ga0070691_1060399013300005341Corn, Switchgrass And Miscanthus RhizosphereGGAWVVAIGFAPLGQIQIGALASLLGVSAALGVSGLALVALASATVFFYPRLRAL*
Ga0070701_1009994733300005438Corn, Switchgrass And Miscanthus RhizosphereLQIGALASLLGVSAALGVSGLALVTLASLTVLLYPRLRAL*
Ga0070705_10055606113300005440Corn, Switchgrass And Miscanthus RhizospherePLGQLQIGALASLLGVSAALGVSGLALVALASATVFFYPRLRAL*
Ga0070694_10165854513300005444Corn, Switchgrass And Miscanthus RhizosphereAPLGQLQIGALASLFGVSAALAASGLALVALGVGAALLFPRLRRLG*
Ga0070708_10181059713300005445Corn, Switchgrass And Miscanthus RhizosphereLAPLGQLQIGGLASLFSVSAALGVSGLALVGLVTATAFAYPRLRRL*
Ga0066686_1044021313300005446SoilAGGAWVVAIGLAPLGQLQIGALASLFGVGIALGASGLALTALAGAAALTFPRVRRI*
Ga0070706_10039895033300005467Corn, Switchgrass And Miscanthus RhizosphereLGQLQIGALASLLGVSAALGVSGLALVALASATVFFYPRLRAL*
Ga0070698_10056668413300005471Corn, Switchgrass And Miscanthus RhizosphereGFAPLGQLQIGALASLLGVSAALGVSGLALVALASATVFFYPRLRAL*
Ga0068853_10206759923300005539Corn RhizosphereVVAIGLAPLGQLQIGALASLVGVSIAFGASGLALVLLAGSTALLVPRVRRL*
Ga0070732_1059487333300005542Surface SoilGGAWVVAIGFAPLGQIQIGALASLLGVSVALGVSGLALVALASATVFFYPRLRAL*
Ga0070696_10033066813300005546Corn, Switchgrass And Miscanthus RhizosphereQLQMGALASLLGVSFAFGTSGVALVALASATALAFPRLRRL*
Ga0066704_1065735413300005557SoilAIGFAPLGQLQIGALASLFGVGIALGASGLALTALAGAAALTFPRVRRI*
Ga0066704_1082790223300005557SoilQIGALASLFGVGIALGASGLALTALAGAAALTFPRVRRI*
Ga0066698_1069284313300005558SoilGQLQIGALASLFGVGIALGTSGLALVALAVAAAALVPRVRRL*
Ga0066693_1041412713300005566SoilLAPLGQLQIGALASLFGVSVALGASGLALAALAGAAALVFPRVRRL*
Ga0068859_10170083313300005617Switchgrass RhizosphereLQIGGLASLFSVSAALGVSGLALVGLVTATAFAYPRLRRL*
Ga0066903_10848285613300005764Tropical Forest SoilPLGQLQIGALASLLGVSVALAASGLALVGLAGVTLRVFPRVRSL*
Ga0066658_1067231623300006794SoilAPLGQMQIGALASLFGVSIAFGASGLALALLAIATAVLAPRARRL*
Ga0075421_10205640823300006845Populus RhizosphereAPLGQFQVGALASLLGVSAALGASGLALAALAGGTALLVTRIRRL*
Ga0075420_10044688323300006853Populus RhizosphereQIGALASLFGVSIAFGTSGLALVILAGVTTVLFPRLKRL*
Ga0073934_1064949123300006865Hot Spring SedimentGAWVVAIGLAPLGQLQIGALASLFGVSVALGASGLALVVLAGVTGVWFPRLKRV*
Ga0075434_10022492343300006871Populus RhizosphereLQIGALASLFGVSAALATSGLALAVLATSAAVLFPRVRRL*
Ga0075429_10037457513300006880Populus RhizosphereGALASLFGVSIAFGTSGLALVILAGVTTVLFPRLKRL*
Ga0075424_10002004183300006904Populus RhizosphereGQLQIGALATLFGVGVAFGLSGFVLMVLAGGTALLFPRVRRL*
Ga0075436_10104831023300006914Populus RhizosphereAPLGQLQIGALASLLGVSAALGVSGLALVTLACATVFFYPRLRAL*
Ga0079219_1033184513300006954Agricultural SoilAWVVAIGFAPLGQLQIGALASLLGVSAALGVSGLALVTLASLTVIFYPRLRAL*
Ga0079219_1245526623300006954Agricultural SoilGLAPLGQLQIGALASAFGVTVGFAASGLALALLAVATAVFAPRARRL*
Ga0075419_1063888623300006969Populus RhizosphereIGALASLFGVAVALGTSGATLAVLAAGAAVLFPRIRRL*
Ga0079218_1083792423300007004Agricultural SoilLGQLQIGALGSLVGVSAALAASGLALVALAGLTARAFPRLRKP*
Ga0066710_10378841323300009012Grasslands SoilGAWVVAVGLAPLGQLQIGALASAFGVSVGFAVSGLALAVLALATAVLAPRARRL
Ga0105098_1071210823300009081Freshwater SedimentQIGALASLFGVSIALGTSGLALAILAAATGLLYPRVKRV*
Ga0075418_10014220113300009100Populus RhizosphereASLFGVGVAFGASGLALTLMAGATALLFPKVRRL*
Ga0105247_1168863423300009101Switchgrass RhizosphereLGQLQIGALASLLGVSAALGVSGLALVTLASLTVLLYPRLRAL*
Ga0066709_10430930113300009137Grasslands SoilLGQLQIGAMASLFGASIALGASGLALVALAVIGALAVPRIRNI*
Ga0114129_1162388313300009147Populus RhizosphereLASLFGVSIALGTSGLALAMLAGTTVVLFPRLKRV*
Ga0105243_1006354943300009148Miscanthus RhizosphereAPLGQLQIGGLASLFSVSAALGVSGLALVGLVTATAFAYPRLRRL*
Ga0111538_1143504213300009156Populus RhizosphereLQIGARASAFGVGVGFAASGLALVLLAVATAVFAPRARRL*
Ga0105092_1059703923300009157Freshwater SedimentAIGLAPLGQLQIGALASLFGVSIALGTSGLALAILAAATGLLYPRVKRV*
Ga0075423_1209750113300009162Populus RhizosphereQLQIGALASLVGVSAALGTSGFALMALAGALAFMFPRVRRL*
Ga0105237_1010508153300009545Corn RhizosphereGRAGGAWVVAIGFAPLGQLQIGALASLLGVSAALGVSGLALVTLASLTVLLYPRLRAL*
Ga0126382_1243328723300010047Tropical Forest SoilQLQIGALASLVGVSIAFGTSGLALVLLAGSAALLVPRVRRL*
Ga0134065_1027575023300010326Grasslands SoilGAWVVAIGLGPLGHLQIGALASLFGVGVALGTSGAALVTLALAGAPLFPRVRRL*
Ga0126370_1243505623300010358Tropical Forest SoilLAPLGQFQIGALASLLGVSMALGLSGLGLITLVGVTVFLFPPIRRL*
Ga0126377_1196164123300010362Tropical Forest SoilAIGLAPLGQLQIGALASLFGVSIALGASGLALAMLAVTTALLVPRVRRV*
Ga0126383_1228599723300010398Tropical Forest SoilLGQLQIGALASLFGASVALGISGVGLLALAGAAALAFPRLRRL*
Ga0137458_105929223300011436SoilLGQIQMGALASLFGVSAALGASGLGLVALAGATALLYPRLRAL*
Ga0137434_106790823300012225SoilIGALASLFGVSAALGASGLALTALAITAALLFPRVRRL*
Ga0137434_108448023300012225SoilAIGLAPLGQLQMGALASLFGVSAALGASGLGLVVLAGATALLYPRLRAL*
Ga0137370_1024647813300012285Vadose Zone SoilQIGALASLFGVGVAFGVSGLALITLTGATALLFPRVRRL*
Ga0137360_1110359913300012361Vadose Zone SoilVLAIGLAPLGQLQIGALASLFGVSAALATSGLALAALAVTAAILFPSVRRL*
Ga0137390_1107784313300012363Vadose Zone SoilPLGQLQIGALASLFGVSLAFGTSGLGLVALASAAAVSFPRVRRL*
Ga0137397_1019336033300012685Vadose Zone SoilQIGALASLFGVGVAFGTSGLALVMLAGATALLFPRVRRL*
Ga0157295_1002306713300012906SoilIGFAPLGQLQIGALASLFGVSAALGASGLALVALAGATALLYPRLRAL*
Ga0157283_1015435313300012907SoilLGQLQIGALASLFGVSAALGASGLALVALAGATALLYPRLRAL*
Ga0157306_1001806513300012912SoilIGAMASLFGVSLALGASGLGLLALAGAAALWSPRLRRL*
Ga0137394_1021326613300012922Vadose Zone SoilQIGALASLLGVSAALGVSGLALVALACATVFFYPRLRAL*
Ga0137394_1158031823300012922Vadose Zone SoilIGALASLFGVGIALGTSGLALVALAVAAAALVPRVRRL*
Ga0164300_1033250533300012951SoilPLGQRHIGALASLLGVSAALGVSGLALVTLASLTVFLYPRLRAL*
Ga0164298_1101793433300012955SoilAWVVAIGFAPLGQLQIGALASLLGVSAALGVSGLALATLAFLTVLLYPRLRAL*
Ga0157373_1076802923300013100Corn RhizosphereALASLVGVSIAFGASGLALVLLAGSTALLVPRVRRL*
Ga0157378_1212633923300013297Miscanthus RhizosphereQIGALASLVGVSIAFGASGLALVLLAGSTALLVPRVRRL*
Ga0134075_1023460713300014154Grasslands SoilQLQVGALASLFGVSIALGASGLALTAVAGAAALTFPRVRRI*
Ga0157380_1198067323300014326Switchgrass RhizosphereGRAGGAWVVAIGLAPLGQLQIGALASLFGVSIALGASGLALATLAGATVLLFPHVKRV*
Ga0137418_1057931713300015241Vadose Zone SoilGQLQIGALASLFGVSVAFGASGVALVLLAGATALLFPRVRRL*
Ga0137418_1057943213300015241Vadose Zone SoilGQLQIGALASLFGVSVAFGASGVALILLAGATALLFPRVRRL*
Ga0134069_105930323300017654Grasslands SoilAPLGQLQIGALATMFGVSVAFGASGLALVALAGATALLFPRLRRL
Ga0134112_1001004343300017656Grasslands SoilPLGQLQIGALATLFGVSVAFGTSGLALVTLAGVTALLFPRLRRL
Ga0184610_109392933300017997Groundwater SedimentQMGALASLFGVSAALGASGLGLVALAGATALLYPRLRAL
Ga0184610_131173523300017997Groundwater SedimentGALASLFGVSIALGVSGLGLVVLAGAAALLFPRIRRL
Ga0184629_1025519423300018084Groundwater SedimentGALASLFGVSAALGASGLGLVALAGATALLYPRLRAL
Ga0190265_1011165233300018422SoilQMVALASLFGVSIALGASGLALATLAGATVLLFPRVKRV
Ga0190265_1054761013300018422SoilLAPLGQMQMGALASLFGVSVALGTSGVALVVVATATGLLFPRMKRT
Ga0190264_1011951313300019377SoilLASLFGVSAALGASGLALVALVAATALAYPRLRRL
Ga0193729_126732913300019887SoilGQLQIGALASLLGVSAALGVSGLALVALATATLFFYPRLRAL
Ga0193734_102893413300020015SoilRGRAGGAWVVAIGFAPLGQLQIGALASLLGVSAALGVSGLALIALASATVFFYPRLRAL
Ga0210384_1136391813300021432SoilALASLLGVSAALGVSGLALVALASATVFFYPRLRAL
Ga0222622_1053801413300022756Groundwater SedimentIGALASLFGVSAALGASGLGLVALAGATALLYPRLRAL
Ga0209519_1068377023300025318SoilGLAPLGQLQIGALASLFGVSVALGASGLGLAALAAAGALWLPRVRRL
Ga0209640_1084933013300025324SoilGQLQIGALASLFGVSVALGASGLGLAALAAAGALWLPRVRRL
Ga0209640_1130597913300025324SoilLAPLGQLQIGALASLFGVSVALGTSGLALMILAGATGLLFPRVKRV
Ga0207423_100720713300025535Natural And Restored WetlandsGALASLFGVSAALGASGLGLVALAGATALFYPRLRAL
Ga0207662_1097665423300025918Switchgrass RhizosphereALASLFGVSAALGASGLGLVALAGATALLYPRLRAL
Ga0207709_1018279523300025935Miscanthus RhizosphereQLQIGGLASLFSVSAALGVSGLALVGLVTATAFAYPRLRRL
Ga0207712_1101706613300025961Switchgrass RhizosphereLGQLQIGALASLFGVSLALGASGLALVALATGAAMLFPRVRHL
Ga0210090_101936333300025965Natural And Restored WetlandsLASLFGVSAALGASGLGLVALAGATALFYPRLRAL
Ga0208285_100604113300026005Rice Paddy SoilIGALASLLGVSAALGVSGLALVALASATVFFYPRLRAL
Ga0208286_102070423300026015Rice Paddy SoilGRAGGAWVVAIGFAPLGQIQIGALASLFGVSAALGLSGLALVALASATVFFYPRLRAL
Ga0207703_1123249923300026035Switchgrass RhizosphereVVAIGFAPLGQLQIGALASLLGVSAALGVSGLALVTLASLTVFLYPRLRALLGRAIAGAAGPW
Ga0209027_128008813300026300Grasslands SoilLQIGALASLFGVGVALGTSGAALVTLALAGALLFPRVRRL
Ga0209468_117393013300026306SoilALASLFGVGVALGTSGAALVTLALAGALLFPRVRRL
Ga0257147_101098113300026475SoilGQLQIGALASLLGVSAALGVSGLALVALACATVFFYPRLRAL
Ga0209846_105236023300027277Groundwater SandVRGRQLQIGALASLFGVSAALGASGLALVALAGATALLYPRLRAL
Ga0209983_111669413300027665Arabidopsis Thaliana RhizosphereQLQIGALASLLGVSAALGVSGLALVTLASLTVLLYPRLRAL
Ga0209998_1004804113300027717Arabidopsis Thaliana RhizosphereGQLQIGALASLRGVSAALAASGLALVGLAGATRRVFPQIRRL
Ga0209515_1027494613300027835GroundwaterVVAIGLAPLGQLQIGALASLLGVSIALGASGLALVLLASATALLFLRMR
Ga0209590_1105847423300027882Vadose Zone SoilFAPLGQLQIGALASLFGVSAALGASGLALVALAGATALLYPRLRAL
Ga0209486_1116861823300027886Agricultural SoilLGQLQIGALGSLVGVSAALAASGLALVALAGLTARAFPRLRKP
Ga0268264_1041466623300028381Switchgrass RhizosphereIGLAPLGQLQIGGLASLFSVSAALGASGLALVGLVAATALAYPRLRRL
Ga0247823_1113556013300028590SoilLQIGALASLFGVSIALGTSGLALAMLAGTTVVLFPRLKRV
Ga0247821_1063864423300028596SoilIGLAPLGQLQIGALASLLSVSIALGTSGLALVLLSASAALLVPRVRRL
Ga0247820_1057815313300028597SoilGRAGGAWVVAIGLAPLGQLQIGALASLLSVSIALGTSGLALVLLAASAALLVPRVRRL
Ga0247824_1015338813300028809SoilGAWVVAIGLAPLGQLQIGALASLFGVSIALGTSGLALAMLAGTTVVLFPRLKRV
Ga0299907_1022966443300030006SoilQLQIGALASLFGVGAALGASGLGLVALAGATALLYPRLRAL
Ga0299914_1107807723300031228SoilLAPVGQIQIGALASLFGVSIALGASGLALVALAAGAALLFPRLRTF
Ga0299913_1007194913300031229SoilAPLGQLQIGALASLFGVGAALGASGLGLVALAGATALLYPRLRAL
Ga0299913_1170026413300031229SoilLQMGALASLFGVSIALGASGLALATLAGATVLLFPRVKRV
Ga0310887_1074565423300031547SoilPLGQLQIGALASLLSVSIALGTSGLALVLLAASAALLVPRVRRL
Ga0307408_10125090013300031548RhizosphereLQIGALATLFGVSVALGTSGLALALLAVVTAVTFPRVKRC
Ga0307405_1110934923300031731RhizosphereVPAALRGRAGGAWVVAIGLAPIGQIQIGALATLFGVSVALGTSGLALALLAVVTAVMFPRVKKC
Ga0307468_10037235213300031740Hardwood Forest SoilVGLAPLGQLQIGALASAFGVSVAFGASGLALALLALATAVFAPRARRL
Ga0318521_1100104213300031770SoilWVVAIGLAPLGQLQIGALASLFGVSLALGASGLALVALASGTAILFPRVRHL
Ga0318543_1054163313300031777SoilGQLQIGALASLFGVSLALGASGLALVALASGTAILFPRVRHL
Ga0214473_1188070023300031949SoilAWVVAIGLAPLGQLQIGALASLFGVSVALGTSGLALAMLAGTTALVFPRVRRV
Ga0326597_1196749613300031965SoilPLGQLQIGALASVLGVSAAFGLSGLALVIVAAVGAYCFPRLRTL
Ga0307416_10266127623300032002RhizosphereGAWVVAIGLAPLGQLQIGALASLFGVGVAFGTSGLALALLAVLTAVVYPRVKRI
Ga0310897_1007759423300032003SoilIGLAPLGQLQIGALASLLSVSIALGTSGLALVLLAASAALLVPRVRRL
Ga0310890_1034841013300032075SoilGGAWVVAIGLAPLGQLQIGALASLVGVSIAFGASGLALVLLAGSTALFVPRVRRL
Ga0315292_1134313613300032143SedimentGLAPLGQLQIGALASLVGVSAALGASGFALIALALAASKVHPQLRKT
Ga0307470_1166950723300032174Hardwood Forest SoilAPLGQIQIGALASLFGVSAALGASGLGLVALAGATALLYPRLRAL
Ga0310889_1074271813300032179SoilGQIQIGALASLLGVSAALGVSGLALVALASATVFFYPRLRAL
Ga0307471_10317986413300032180Hardwood Forest SoilLASLFGVSAALATSGLALAALAVTAALLFPSVRRL
Ga0307472_10090171933300032205Hardwood Forest SoilPLGQLQIGALASLLGVSAALGVSGLALVALASATVFFYPRLRAL
Ga0335084_1089838723300033004SoilQIGALASLVGVSIALGASGLALVLLAGGTALLVPRVRRL
Ga0310811_1019927143300033475SoilPLGQLQIGAVASLFGVGVAFGASGLALTLLAGATALLFPRLRRL
Ga0247829_1168743123300033550SoilVVAIGFAPLGQLQIGALASLLGVSAALGVSGLALVTLASLTVLLYPRLRAL
Ga0247830_1100926713300033551SoilRSAGGAWVVAIGLAPLGQLQIGALATLFGVSVALGTSGLALALLAVVTAVVFPRVKRC
Ga0364930_0340854_322_5013300033814SedimentRGRAGGAWVVAIGLAPLGQFQIGALASLFGVSAALGASGLALVALAGATALLYPRLRAL
Ga0364935_0104907_43_1983300034151SedimentVVAIGLGPLGQLQIGALASLFGVGIALGASGLALAALAGVIAILVPRVRRL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.