


| Basic Information | |
|---|---|
| Family ID | F045895 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 38 residues |
| Representative Sequence | ELDMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 33.77 % |
| % of genes near scaffold ends (potentially truncated) | 48.68 % |
| % of genes from short scaffolds (< 2000 bps) | 88.82 % |
| Associated GOLD sequencing projects | 128 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.289 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.474 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.368 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.053 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.38% β-sheet: 0.00% Coil/Unstructured: 47.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF02811 | PHP | 48.68 |
| PF07733 | DNA_pol3_alpha | 9.87 |
| PF00005 | ABC_tran | 8.55 |
| PF14579 | HHH_6 | 1.97 |
| PF02687 | FtsX | 1.32 |
| PF12071 | DUF3551 | 1.32 |
| PF04055 | Radical_SAM | 1.32 |
| PF00106 | adh_short | 0.66 |
| PF06042 | NTP_transf_6 | 0.66 |
| PF13505 | OMP_b-brl | 0.66 |
| PF00497 | SBP_bac_3 | 0.66 |
| PF05973 | Gp49 | 0.66 |
| PF11154 | DUF2934 | 0.66 |
| PF00318 | Ribosomal_S2 | 0.66 |
| PF03129 | HGTP_anticodon | 0.66 |
| PF00872 | Transposase_mut | 0.66 |
| PF01255 | Prenyltransf | 0.66 |
| PF12704 | MacB_PCD | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 9.87 |
| COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 9.87 |
| COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 0.66 |
| COG0052 | Ribosomal protein S2 | Translation, ribosomal structure and biogenesis [J] | 0.66 |
| COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.66 |
| COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.66 |
| COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.66 |
| COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.66 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.66 |
| COG3575 | Uncharacterized conserved protein | Function unknown [S] | 0.66 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.66 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.29 % |
| Unclassified | root | N/A | 21.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101558070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1102 | Open in IMG/M |
| 3300000559|F14TC_110845103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 642 | Open in IMG/M |
| 3300000956|JGI10216J12902_101548981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 814 | Open in IMG/M |
| 3300001661|JGI12053J15887_10005246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 6777 | Open in IMG/M |
| 3300002568|C688J35102_118325531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 549 | Open in IMG/M |
| 3300002568|C688J35102_120977883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4409 | Open in IMG/M |
| 3300004156|Ga0062589_100335462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1191 | Open in IMG/M |
| 3300004156|Ga0062589_100771325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 866 | Open in IMG/M |
| 3300004480|Ga0062592_101751199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 606 | Open in IMG/M |
| 3300004480|Ga0062592_102432747 | Not Available | 526 | Open in IMG/M |
| 3300004781|Ga0062379_10050044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 845 | Open in IMG/M |
| 3300005205|Ga0068999_10035912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 826 | Open in IMG/M |
| 3300005332|Ga0066388_101099062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1346 | Open in IMG/M |
| 3300005353|Ga0070669_101654108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 558 | Open in IMG/M |
| 3300005355|Ga0070671_101741166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 553 | Open in IMG/M |
| 3300005553|Ga0066695_10001873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 8659 | Open in IMG/M |
| 3300005554|Ga0066661_10396981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 844 | Open in IMG/M |
| 3300005555|Ga0066692_10115977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1608 | Open in IMG/M |
| 3300005560|Ga0066670_11002518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 510 | Open in IMG/M |
| 3300005569|Ga0066705_10008337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4767 | Open in IMG/M |
| 3300005713|Ga0066905_100114424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1867 | Open in IMG/M |
| 3300005764|Ga0066903_100104890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3841 | Open in IMG/M |
| 3300005764|Ga0066903_100675426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1813 | Open in IMG/M |
| 3300005764|Ga0066903_101737364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1189 | Open in IMG/M |
| 3300005764|Ga0066903_103317265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 870 | Open in IMG/M |
| 3300005764|Ga0066903_108583806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 520 | Open in IMG/M |
| 3300005841|Ga0068863_100627847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1065 | Open in IMG/M |
| 3300005983|Ga0081540_1271038 | Not Available | 587 | Open in IMG/M |
| 3300005985|Ga0081539_10145465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1147 | Open in IMG/M |
| 3300005985|Ga0081539_10347168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 624 | Open in IMG/M |
| 3300006028|Ga0070717_10452684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1157 | Open in IMG/M |
| 3300006038|Ga0075365_10697380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
| 3300006041|Ga0075023_100100862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 998 | Open in IMG/M |
| 3300006175|Ga0070712_101865925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 526 | Open in IMG/M |
| 3300006175|Ga0070712_101939269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 516 | Open in IMG/M |
| 3300006755|Ga0079222_10992629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 720 | Open in IMG/M |
| 3300006806|Ga0079220_11485326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 580 | Open in IMG/M |
| 3300006845|Ga0075421_100012809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 10428 | Open in IMG/M |
| 3300006853|Ga0075420_101550271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 568 | Open in IMG/M |
| 3300006854|Ga0075425_100339368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1730 | Open in IMG/M |
| 3300006871|Ga0075434_102045957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 578 | Open in IMG/M |
| 3300006904|Ga0075424_100378593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1509 | Open in IMG/M |
| 3300009012|Ga0066710_100715039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 1528 | Open in IMG/M |
| 3300009088|Ga0099830_11769708 | Not Available | 516 | Open in IMG/M |
| 3300009089|Ga0099828_10824841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 830 | Open in IMG/M |
| 3300009090|Ga0099827_10125109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 2076 | Open in IMG/M |
| 3300009090|Ga0099827_10329323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1296 | Open in IMG/M |
| 3300009090|Ga0099827_10801571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 815 | Open in IMG/M |
| 3300009792|Ga0126374_10255597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1147 | Open in IMG/M |
| 3300009792|Ga0126374_11433342 | Not Available | 564 | Open in IMG/M |
| 3300009813|Ga0105057_1072106 | Not Available | 601 | Open in IMG/M |
| 3300010046|Ga0126384_10480213 | Not Available | 1067 | Open in IMG/M |
| 3300010046|Ga0126384_11974034 | Not Available | 557 | Open in IMG/M |
| 3300010047|Ga0126382_10133116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1673 | Open in IMG/M |
| 3300010320|Ga0134109_10495483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300010339|Ga0074046_10119838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1690 | Open in IMG/M |
| 3300010339|Ga0074046_10403518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 825 | Open in IMG/M |
| 3300010358|Ga0126370_10072516 | All Organisms → cellular organisms → Bacteria | 2282 | Open in IMG/M |
| 3300010359|Ga0126376_13057379 | Not Available | 517 | Open in IMG/M |
| 3300010360|Ga0126372_11172796 | Not Available | 791 | Open in IMG/M |
| 3300010360|Ga0126372_12773834 | Not Available | 542 | Open in IMG/M |
| 3300010361|Ga0126378_12143285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 638 | Open in IMG/M |
| 3300010362|Ga0126377_10444689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 1317 | Open in IMG/M |
| 3300010376|Ga0126381_100660120 | Not Available | 1493 | Open in IMG/M |
| 3300011271|Ga0137393_10575832 | Not Available | 966 | Open in IMG/M |
| 3300012188|Ga0136618_10432294 | Not Available | 568 | Open in IMG/M |
| 3300012189|Ga0137388_10261932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1577 | Open in IMG/M |
| 3300012201|Ga0137365_10151821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 1739 | Open in IMG/M |
| 3300012203|Ga0137399_11005064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 702 | Open in IMG/M |
| 3300012204|Ga0137374_10061708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 3757 | Open in IMG/M |
| 3300012204|Ga0137374_10760265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 722 | Open in IMG/M |
| 3300012212|Ga0150985_106912161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio cholerae | 1475 | Open in IMG/M |
| 3300012349|Ga0137387_11069869 | Not Available | 576 | Open in IMG/M |
| 3300012685|Ga0137397_10002631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 12445 | Open in IMG/M |
| 3300012918|Ga0137396_10731619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 729 | Open in IMG/M |
| 3300012929|Ga0137404_10382865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1237 | Open in IMG/M |
| 3300012930|Ga0137407_10790237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 896 | Open in IMG/M |
| 3300012930|Ga0137407_12205764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
| 3300012960|Ga0164301_11353137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300012986|Ga0164304_10476406 | Not Available | 906 | Open in IMG/M |
| 3300012987|Ga0164307_11255806 | Not Available | 617 | Open in IMG/M |
| 3300012988|Ga0164306_11178293 | Not Available | 641 | Open in IMG/M |
| 3300013066|Ga0164281_102222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 554 | Open in IMG/M |
| 3300013075|Ga0164288_1082033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 898 | Open in IMG/M |
| 3300014655|Ga0181516_10517550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 613 | Open in IMG/M |
| 3300014658|Ga0181519_10054632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2652 | Open in IMG/M |
| 3300014863|Ga0180060_1033240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 670 | Open in IMG/M |
| 3300015248|Ga0180079_1076177 | Not Available | 521 | Open in IMG/M |
| 3300015264|Ga0137403_10933471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 717 | Open in IMG/M |
| 3300015374|Ga0132255_104576586 | Not Available | 586 | Open in IMG/M |
| 3300016319|Ga0182033_10954090 | Not Available | 761 | Open in IMG/M |
| 3300017787|Ga0183260_10181471 | Not Available | 1485 | Open in IMG/M |
| 3300017789|Ga0136617_10651471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 822 | Open in IMG/M |
| 3300017947|Ga0187785_10690385 | Not Available | 535 | Open in IMG/M |
| 3300017959|Ga0187779_10103194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1720 | Open in IMG/M |
| 3300018028|Ga0184608_10005799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4002 | Open in IMG/M |
| 3300018071|Ga0184618_10183409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 869 | Open in IMG/M |
| 3300018072|Ga0184635_10002225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5847 | Open in IMG/M |
| 3300018072|Ga0184635_10256682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 691 | Open in IMG/M |
| 3300018078|Ga0184612_10395843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 694 | Open in IMG/M |
| 3300018432|Ga0190275_10324471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1520 | Open in IMG/M |
| 3300018469|Ga0190270_11223051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 790 | Open in IMG/M |
| 3300019361|Ga0173482_10758423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 509 | Open in IMG/M |
| 3300019377|Ga0190264_11063740 | Not Available | 655 | Open in IMG/M |
| 3300019869|Ga0193705_1066329 | Not Available | 720 | Open in IMG/M |
| 3300021090|Ga0210377_10398153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 818 | Open in IMG/M |
| 3300021170|Ga0210400_11288085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 586 | Open in IMG/M |
| 3300021178|Ga0210408_10609719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 864 | Open in IMG/M |
| 3300021560|Ga0126371_11019210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 969 | Open in IMG/M |
| 3300022756|Ga0222622_10242990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1216 | Open in IMG/M |
| 3300025912|Ga0207707_10286420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1426 | Open in IMG/M |
| 3300025922|Ga0207646_10707894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 900 | Open in IMG/M |
| 3300025928|Ga0207700_10874867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 804 | Open in IMG/M |
| 3300025928|Ga0207700_11458104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 608 | Open in IMG/M |
| 3300025941|Ga0207711_10277430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1543 | Open in IMG/M |
| 3300025945|Ga0207679_10526098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1058 | Open in IMG/M |
| 3300026530|Ga0209807_1012966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4104 | Open in IMG/M |
| 3300027512|Ga0209179_1064625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 797 | Open in IMG/M |
| 3300027546|Ga0208984_1025126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1223 | Open in IMG/M |
| 3300027587|Ga0209220_1149620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 604 | Open in IMG/M |
| 3300027616|Ga0209106_1018733 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1497 | Open in IMG/M |
| 3300027862|Ga0209701_10204101 | Not Available | 1177 | Open in IMG/M |
| 3300027875|Ga0209283_10581571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 712 | Open in IMG/M |
| 3300027875|Ga0209283_10614879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
| 3300027880|Ga0209481_10041752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2106 | Open in IMG/M |
| 3300028712|Ga0307285_10134391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 670 | Open in IMG/M |
| 3300028720|Ga0307317_10029681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1703 | Open in IMG/M |
| 3300028791|Ga0307290_10300216 | Not Available | 588 | Open in IMG/M |
| 3300028793|Ga0307299_10054070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1479 | Open in IMG/M |
| 3300028803|Ga0307281_10423403 | Not Available | 512 | Open in IMG/M |
| 3300028875|Ga0307289_10034599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 1998 | Open in IMG/M |
| 3300031152|Ga0307501_10088829 | Not Available | 763 | Open in IMG/M |
| 3300031366|Ga0307506_10344297 | Not Available | 596 | Open in IMG/M |
| 3300031545|Ga0318541_10108380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1498 | Open in IMG/M |
| 3300031682|Ga0318560_10247543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 957 | Open in IMG/M |
| 3300031720|Ga0307469_10974681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 790 | Open in IMG/M |
| 3300031723|Ga0318493_10085855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1558 | Open in IMG/M |
| 3300031747|Ga0318502_10965763 | Not Available | 519 | Open in IMG/M |
| 3300031764|Ga0318535_10065104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1550 | Open in IMG/M |
| 3300031769|Ga0318526_10137840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 989 | Open in IMG/M |
| 3300031831|Ga0318564_10159073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1008 | Open in IMG/M |
| 3300031833|Ga0310917_10009723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5213 | Open in IMG/M |
| 3300031879|Ga0306919_11092812 | Not Available | 608 | Open in IMG/M |
| 3300031890|Ga0306925_10780374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 993 | Open in IMG/M |
| 3300031912|Ga0306921_10802164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1075 | Open in IMG/M |
| 3300031942|Ga0310916_10732744 | Not Available | 835 | Open in IMG/M |
| 3300031959|Ga0318530_10325916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 635 | Open in IMG/M |
| 3300032076|Ga0306924_10474380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1428 | Open in IMG/M |
| 3300032090|Ga0318518_10124604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1299 | Open in IMG/M |
| 3300032516|Ga0315273_11015088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1061 | Open in IMG/M |
| 3300033289|Ga0310914_11059862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 711 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.95% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.63% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.97% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.97% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.32% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.32% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.32% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.32% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.66% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.66% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.66% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.66% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.66% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.66% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.66% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.66% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.66% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.66% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.66% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004781 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh | Environmental | Open in IMG/M |
| 3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012188 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013066 | Enriched backyard soil microbial communities from Emeryville, California, USA - RNA 5th pass 37_C Kraft BY (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013075 | Enriched Organic Plus compost microbial communities from Emeryville, California, USA - RNA 5th pass 30_C Kraft OP (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014863 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT25_16_10D | Environmental | Open in IMG/M |
| 3300015248 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT530_16_10D | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1015580702 | 3300000364 | Soil | VGMVRAVVEEAATLASLALFLGMVAIWAQVIATL* |
| F14TC_1108451032 | 3300000559 | Soil | MFRALIEEAAALASLALFLGMIAIWAQIIATLGQVPQAWG* |
| JGI10216J12902_1015489812 | 3300000956 | Soil | LCRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| JGI12053J15887_100052462 | 3300001661 | Forest Soil | MIRAVVEEAATLASLALFLGMIAIWAQVIAALLTTSVM* |
| C688J35102_1183255311 | 3300002568 | Soil | FLLCRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| C688J35102_1209778833 | 3300002568 | Soil | LWDLAESIMIRAVVEEATTLTALALFIGMVAIWAQVIVTL* |
| Ga0062589_1003354621 | 3300004156 | Soil | MFRFRSQESPMFRAVVEEAAALTSIALFLGMIAIWAQVLATL* |
| Ga0062589_1007713252 | 3300004156 | Soil | MFRALIEEAAALASLALFLGMIAIWAQIVATLGHVPQAWG* |
| Ga0063356_1005266121 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MFLFRSQESPMFRAVVEEAAALTSIALFLGMIAIWAQVLATL* |
| Ga0062592_1017511992 | 3300004480 | Soil | MFRALIEEAAALASLALFLGMIAIWAQIVATLGHVPEAWG* |
| Ga0062592_1024327472 | 3300004480 | Soil | FRSQESPMFRAVVEEAAALTSIALFLGMIAIWAQVLATL* |
| Ga0062379_100500442 | 3300004781 | Wetland Sediment | MEVAMLRSVVEEAAALASLALFLGMIAIWAQVIATLTILN |
| Ga0068999_100359122 | 3300005205 | Natural And Restored Wetlands | FRSLWEGHMFRAVVEEAAALASLALFLGMIAIWAQVIATL* |
| Ga0066388_1010990622 | 3300005332 | Tropical Forest Soil | MFLLCSRREAMIRAAVTEAAALASLALFLGMIAIWAQVIATL* |
| Ga0070669_1016541081 | 3300005353 | Switchgrass Rhizosphere | GREDMFRALIEEAAALASLALFLGMIAIWAQIVATLGHVPEAWG* |
| Ga0070671_1017411662 | 3300005355 | Switchgrass Rhizosphere | MFCCVGVGIMVRAVVEEAAALASLTLFISMIAVWAQVLTAL* |
| Ga0066695_100018731 | 3300005553 | Soil | WELVSMVRAVVEEAATLASLALFLGMVAIWAHVIATL* |
| Ga0066661_103969811 | 3300005554 | Soil | VSMVRAVVEEAATLASLALFLGMVAIWAHVIATL* |
| Ga0066692_101159772 | 3300005555 | Soil | LSSGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0066670_110025182 | 3300005560 | Soil | LSGVCVMVRAVVEEAATLASLALFLGMVAIWAQVIATL* |
| Ga0066705_100083374 | 3300005569 | Soil | NGENDVMVRAVVEEAAALASLALFIGMIAIWAQVVAVQ* |
| Ga0066905_1001144242 | 3300005713 | Tropical Forest Soil | MIRAVVEEAAALASLTLFLGMIAIWAQVISSFLTTPTL* |
| Ga0066903_1001048904 | 3300005764 | Tropical Forest Soil | MIRAVVEEAAALASLALFLATIAIWAQVIGSVFATTTL* |
| Ga0066903_1006754263 | 3300005764 | Tropical Forest Soil | MVRAVVEEAAALASLALFLATIAVWAQVIGAFFATSTS* |
| Ga0066903_1017373642 | 3300005764 | Tropical Forest Soil | GGVGVMVRAVVEEAATLASLALFLGMVAIWAQVIASL* |
| Ga0066903_1033172651 | 3300005764 | Tropical Forest Soil | AIPMIRALVEEAAAITSIALFVAMIAVWAHVFAVL* |
| Ga0066903_1085838061 | 3300005764 | Tropical Forest Soil | RAVVEEAAALASLALFLGMIAIWAQVISSFLTTPTL* |
| Ga0068863_1006278472 | 3300005841 | Switchgrass Rhizosphere | MEEAMLRSVFEEAAALASLALFLGMIAIWAQVFATL* |
| Ga0081540_12710382 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MSNMGRAIVEEIATLASLALFVGMVAIWAQVIATL* |
| Ga0081539_101454652 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MIRAVVEEAATLASLALFVGMIAIWAQVIAALLTTSVM* |
| Ga0081539_103471682 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MFGSLVMLRAVVEEAAALASLALFLGMLVIWAQVIATL* |
| Ga0070717_104526843 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRAVVEEAATLASLALFLGMIAIWAQVIGALMATPTL* |
| Ga0075365_106973801 | 3300006038 | Populus Endosphere | MSSMFRAVVEEAAALASLAMFLGMIAIWSQVIATF* |
| Ga0075023_1001008621 | 3300006041 | Watersheds | FHESRGVEMFRTIVEEAAALASLALFLGMVAIWAQVIATL* |
| Ga0070712_1018659251 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRAVVEEAATLASLALFIGMIAIWAQVIGALMATPTL* |
| Ga0070712_1019392691 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MEETMLRSVFEEAAALASLALFLGMIAIWAQVFATL* |
| Ga0079222_109926291 | 3300006755 | Agricultural Soil | SSGVGVMVRAVVEDAATLASLALFLGMVAIWARVIATL* |
| Ga0079220_114853262 | 3300006806 | Agricultural Soil | SIGGSRCVMVRAVVEDAATLASLALFLGMVAIWAQVIATL* |
| Ga0075421_1000128097 | 3300006845 | Populus Rhizosphere | MFRALIEEAAALASLALFLGMIAIWAQIIATLGNVPQAWG* |
| Ga0075420_1015502712 | 3300006853 | Populus Rhizosphere | SFREGIMLRAVVEEAAAITSIALFLGMVAIWAQVIAAM* |
| Ga0075425_1003393682 | 3300006854 | Populus Rhizosphere | MIRAVVEEAATLASLALFIGMIAIWAQVIGALMATPTL* |
| Ga0075434_1020459572 | 3300006871 | Populus Rhizosphere | RGHMMRTVMEEAARLASLALFLGMVAVWAQVIAAL* |
| Ga0075424_1003785932 | 3300006904 | Populus Rhizosphere | WGEAHMFRAMIEEAAALASLALFLGMIAIWAQVISTL* |
| Ga0066710_1007150392 | 3300009012 | Grasslands Soil | MFRSLIEKAAAWASLALFLGMIAIWAQIVTTLGHVPEAWG |
| Ga0099830_117697081 | 3300009088 | Vadose Zone Soil | SSSGRKDMVRAVVAEAAALASLALFLGMIAIWAQVIATL* |
| Ga0099828_108248412 | 3300009089 | Vadose Zone Soil | MFRALIEEAAALASLALFLGMIAIWAQLIATLGQVPQAWG* |
| Ga0099827_101251092 | 3300009090 | Vadose Zone Soil | GEWEIMVRALVEEAATLASLALFLGMIAIWVQVIATL* |
| Ga0099827_103293231 | 3300009090 | Vadose Zone Soil | MEEAMLRSVFEEAAALASLALFLGMIAIWAQVIATL* |
| Ga0099827_108015712 | 3300009090 | Vadose Zone Soil | MEKDMFRAVVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0126374_102555972 | 3300009792 | Tropical Forest Soil | EWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0126374_114333422 | 3300009792 | Tropical Forest Soil | LFLGGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0105057_10721062 | 3300009813 | Groundwater Sand | MFQSVVEEAAAIASLALFLGMIAIWARIIATLGQVPEAWG* |
| Ga0126384_104802132 | 3300010046 | Tropical Forest Soil | MEEAMLRSVFEEAAALASLALFLGMIAIWAQVFSTL* |
| Ga0126384_119740341 | 3300010046 | Tropical Forest Soil | MGKVVNMIRAVVEEAATLASLALFLGMIPIWAQVIGALWSVPTL* |
| Ga0126382_101331162 | 3300010047 | Tropical Forest Soil | MSMVRAVVEEAASLASLALFLGMVAIWAQVIATL* |
| Ga0134109_104954832 | 3300010320 | Grasslands Soil | CVMVRAVVEEAATLASLALFLGMVAIWAQVIATL* |
| Ga0074046_101198382 | 3300010339 | Bog Forest Soil | MLRAVVEEAAILASLALFIGMIAVWAEVIATFWA* |
| Ga0074046_104035182 | 3300010339 | Bog Forest Soil | MLRAVVEEAAILASLALFIAMIAVWAQVIVTLWA* |
| Ga0126370_100725161 | 3300010358 | Tropical Forest Soil | EVMVRAVVEEAVTLASLTLFLGMIAIWAKVIAAL* |
| Ga0126376_130573791 | 3300010359 | Tropical Forest Soil | LEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL* |
| Ga0126372_111727961 | 3300010360 | Tropical Forest Soil | AGREAMVRAVVEEAATLASLALFVGMIAIWAQVIATL* |
| Ga0126372_127738342 | 3300010360 | Tropical Forest Soil | DRGGEIMIRAVVEEAATLASLALFLGMIAVWAHVIAVL* |
| Ga0126378_121432851 | 3300010361 | Tropical Forest Soil | VEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0126377_104446891 | 3300010362 | Tropical Forest Soil | RSLEVAMLRSVFEEAAALASLALFLGMIAIWAQVIATL* |
| Ga0126381_1006601202 | 3300010376 | Tropical Forest Soil | MIRAVVEEAAALASLALFLGMIAIWAQVISSFLTTPTL* |
| Ga0137393_105758322 | 3300011271 | Vadose Zone Soil | MFRALIEEAAALASLALFLGMIAIWAQIVATLGNVPEAWG* |
| Ga0136618_104322942 | 3300012188 | Polar Desert Sand | MFRMIIGEAAALTSLALFLGMIAVWAQVIATMTTTG* |
| Ga0137388_102619322 | 3300012189 | Vadose Zone Soil | MFRALIEEAAALASLALFLGMIAIWAQLVATLGHVPEAWG* |
| Ga0137365_101518212 | 3300012201 | Vadose Zone Soil | VGVVTMVRALVEEAATLASLALFLGMIAIWAHVIATL* |
| Ga0137399_110050642 | 3300012203 | Vadose Zone Soil | MEDAMLRSVFEEAAALASLALFLGMIAIWAQVFATL* |
| Ga0137374_100617082 | 3300012204 | Vadose Zone Soil | MFRALVEEAAALASLALFLGMIAIWAQIIAALGQVPEAWG* |
| Ga0137374_107602652 | 3300012204 | Vadose Zone Soil | MFRALIEEAAALASLALFLGMIAIWAQIVATLGHMPEAWG* |
| Ga0150985_1069121612 | 3300012212 | Avena Fatua Rhizosphere | WDLAESIMIRAVVEEATTLTALALFIGMVAIWAQVIVTL* |
| Ga0137387_110698691 | 3300012349 | Vadose Zone Soil | MLRSVFEEAAALASLALFLGMIAIWAQVIAALLTTSVM* |
| Ga0137397_100026312 | 3300012685 | Vadose Zone Soil | MEEAMLRSVFEEAAALASLALFLGMIAIWAQVLATL* |
| Ga0137396_107316191 | 3300012918 | Vadose Zone Soil | MEDAMLRSVFEEAAALASLALFLGMIAIWAQVIATL* |
| Ga0137404_103828652 | 3300012929 | Vadose Zone Soil | MEVAMLRSVFEEAAALASLALFLGMIAIWAQVFATL* |
| Ga0137407_107902372 | 3300012930 | Vadose Zone Soil | GVMIRAIVEEAAALASVALFIGMIAIWAQVIATL* |
| Ga0137407_122057641 | 3300012930 | Vadose Zone Soil | MEEAMLRSVFEEAAALASLALFLGMIAIWAQVFVTL* |
| Ga0164301_113531372 | 3300012960 | Soil | VSDMGRAVVEEVATLTSLALFVGMVAIWAQVIATL* |
| Ga0164304_104764062 | 3300012986 | Soil | MCRTIVEELATLASLALFLSMVAIWAQVIGIWVT* |
| Ga0164307_112558062 | 3300012987 | Soil | MEEAMLRSVFEEAAALSSLALFLGMIAIWAQVFATL* |
| Ga0164306_111782932 | 3300012988 | Soil | MGRTIVEELATLASLALFLSMVAIWAQVIGIWVT* |
| Ga0164281_1022222 | 3300013066 | Soil | ADMFRAVMEEAAALASLAMFLGMIAVWAQVIAAL* |
| Ga0164288_10820331 | 3300013075 | Soil | EVMIRAFLEEAAALASVTLFIGMIAIWAQVFSTF* |
| Ga0181516_105175501 | 3300014655 | Bog | ENAGRANMIRAVVEEAAALASITLFVGMIVVWAQVFSVL* |
| Ga0181519_100546325 | 3300014658 | Bog | MFENAGRANMIRAVVEEAAALASITLFVGMIVVWAQVFSVL* |
| Ga0180060_10332402 | 3300014863 | Soil | MESIMFRAVIEEAAALTSITLFLGMIAIWAQVIAAM* |
| Ga0180079_10761772 | 3300015248 | Soil | MESIMFRAVVEEAAALTSITLFLGMIAIWAQVIAAM* |
| Ga0137403_109334712 | 3300015264 | Vadose Zone Soil | VRMFRAVAEEAAALTSLALFIGMIAIWAQVLTQL* |
| Ga0132255_1045765862 | 3300015374 | Arabidopsis Rhizosphere | MGHTIVEELATLVSLALFLSMVAIWAQVIGIWVT* |
| Ga0182033_109540902 | 3300016319 | Soil | AKLHMLRRIAEEAAALTSLALFLGMIAIWAQVIAAL |
| Ga0183260_101814713 | 3300017787 | Polar Desert Sand | MFRAIVEEAAALASLALFLGMIAVWAQVIATMTTG |
| Ga0136617_106514712 | 3300017789 | Polar Desert Sand | MVRTMVEEAAALASLALFLGMIAVWAQVIATMATG |
| Ga0187785_106903851 | 3300017947 | Tropical Peatland | MIRAVVEEAATLASLALFLGMIAIWAQVIGALWAVPTL |
| Ga0187779_101031941 | 3300017959 | Tropical Peatland | MFSVRSEEDPMFRAVVEEAAALASLALFLGMFAIWANVIATL |
| Ga0184608_100057993 | 3300018028 | Groundwater Sediment | MEEAMLRSVFEEAAALASLALFLGMIAIWAQVFATL |
| Ga0184618_101834092 | 3300018071 | Groundwater Sediment | MFRALIEEAAALASLALFLGMIAIWAQIVATLGHVPEAWG |
| Ga0184635_100022252 | 3300018072 | Groundwater Sediment | MFRALIEEAAALASLALFLGMIAIWAQIIATLGQVPQAWG |
| Ga0184635_102566822 | 3300018072 | Groundwater Sediment | MEVAMLRSVVEEAAALASLALFLGMIAIWAQVIATL |
| Ga0184612_103958432 | 3300018078 | Groundwater Sediment | LVGEIVMFRALIEEAAALASLALFLGMIAIWAQIIATLGQVPQAWG |
| Ga0190275_103244713 | 3300018432 | Soil | MESLVMVRAVVEEAAALASLALFFGMIAVWAQVISAL |
| Ga0190270_112230511 | 3300018469 | Soil | MFRALIEEAAALASLTLFLGMIAIWAQILVTLGHVPEAWG |
| Ga0173482_107584231 | 3300019361 | Soil | MFRALIEEAAALASLALFLGMIAIWAQIVATLGHVPQAWG |
| Ga0190264_110637401 | 3300019377 | Soil | MEEPMFRAVVEEAAALTSLALFVGMLAVWVQVFAAM |
| Ga0193705_10663291 | 3300019869 | Soil | ELDMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0210377_103981531 | 3300021090 | Groundwater Sediment | MESIMFRAVIEEAAALTSITLFLGMIAIWAQVIAAM |
| Ga0210400_112880851 | 3300021170 | Soil | YGGLPMFRAVVEEAAALASLALFIGMIAIWVQVIAVL |
| Ga0210408_106097193 | 3300021178 | Soil | VSNMGRAIVEEIATLASLALFVGMIAIWAQVIATL |
| Ga0126371_110192101 | 3300021560 | Tropical Forest Soil | MIRAVVEEAAALASLALFLGMIAIWAQVISSFLTTPT |
| Ga0222622_102429902 | 3300022756 | Groundwater Sediment | MEEAMLRSVFEEAAALASLALFLGMIAIWAQVIATL |
| Ga0207707_102864203 | 3300025912 | Corn Rhizosphere | MKEKVMFRAFVEEAAALASLALFVGMVAIWAQVFSTI |
| Ga0207646_107078942 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VPVEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0207700_108748671 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | SNQRRVGMFRIFAEEAAALTSLALFLGMVAIWAQVIATL |
| Ga0207700_114581042 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VGIMVRAVVEEAAALASLTLFISMIAVWAQVLTAL |
| Ga0207711_102774301 | 3300025941 | Switchgrass Rhizosphere | FLLLRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0207679_105260981 | 3300025945 | Corn Rhizosphere | GSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0209807_10129661 | 3300026530 | Soil | NGENDVMVRAVVEEAAALASLALFIGMIAIWAQVVAVQ |
| Ga0209179_10646252 | 3300027512 | Vadose Zone Soil | TESGDKVMVRAIVEEAAALASLALFLGMIAIWAQVIATL |
| Ga0208984_10251261 | 3300027546 | Forest Soil | VMIRAVVEEAATLASLALFLGMIAIWAQVIAALLTTSVM |
| Ga0209220_11496202 | 3300027587 | Forest Soil | RDSMVRAVVEEAAALASLALFVGMIAIWAQFIAAL |
| Ga0209106_10187331 | 3300027616 | Forest Soil | MIRAVVEEAATLASLALFLGMIAIWAQVIAALLTTSVM |
| Ga0209701_102041011 | 3300027862 | Vadose Zone Soil | VQWEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0209283_105815711 | 3300027875 | Vadose Zone Soil | MFRALIEEAAALASLALFLGMIAIWAQLIATLGQVPQAWG |
| Ga0209283_106148791 | 3300027875 | Vadose Zone Soil | MFRALIEEAAALASLALFLGMIAIWAQVIASLLTTPTL |
| Ga0209481_100417522 | 3300027880 | Populus Rhizosphere | MFRALIEEAAALASLALFLGMIAIWAQIIATLGNVPQAWG |
| Ga0307285_101343912 | 3300028712 | Soil | PVGKKVMIRAVVEEAATLASLALFLGMIAIWAQVIAALLTTPTL |
| Ga0307317_100296813 | 3300028720 | Soil | MIRAVVEEAATLASLALFLGMIAIWAQVIAALLTTPTL |
| Ga0307290_103002161 | 3300028791 | Soil | AVVEEAATLASLALFLGMIAIWAQVIAALLTTSVM |
| Ga0307299_100540702 | 3300028793 | Soil | SCGELDMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0307281_104234032 | 3300028803 | Soil | MFRALIEEAAALASLALFLGMIAIWAQIVATLGHVPQ |
| Ga0307289_100345991 | 3300028875 | Soil | FSSVGKKVMIRAVVEEAATLASLALFLGMIAIWAQVIAALLTTPTL |
| Ga0307501_100888292 | 3300031152 | Soil | DLVMVRAVAVEAAALTSLALFLGMIAIWAQVIATL |
| Ga0307506_103442971 | 3300031366 | Soil | LLLGSCIMVRAVVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0318541_101083803 | 3300031545 | Soil | MVCAVVEETATLTSLALFLGMVAIWAQVIARFECAQR |
| Ga0318560_102475432 | 3300031682 | Soil | GVVIMVRALVEEAAALASLALFLGMIAIWAQVIATL |
| Ga0307469_109746812 | 3300031720 | Hardwood Forest Soil | MFPLCSREEAMLRSVFEEAAALASLALFLGMIAIWAQVFATL |
| Ga0318493_100858552 | 3300031723 | Soil | LWSGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0318502_109657631 | 3300031747 | Soil | SLSVHIGREPMIRAVAEEAAALASIAMFVGMIAIWAQVIAAL |
| Ga0318535_100651042 | 3300031764 | Soil | REWIMFRAFAEEAAALASLALFLGMIAIWAQVIAIL |
| Ga0318526_101378402 | 3300031769 | Soil | LSLGGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0318564_101590732 | 3300031831 | Soil | LEEEVSMFRGFIEEAAILASLALFIGTIAVWAQVIATL |
| Ga0310917_100097231 | 3300031833 | Soil | GRESPMFRAVVEEAAVLASLALFIGMIAVWAQVIAFY |
| Ga0306919_110928122 | 3300031879 | Soil | MIRAVVEEAAALASLTLFLGMIAIWAQVISSLLATPTL |
| Ga0306925_107803741 | 3300031890 | Soil | PGRFRMLRAVVEEAVALASLALFVGIVAIWVQIIAAL |
| Ga0306921_108021642 | 3300031912 | Soil | TPGRFRMLRAVVEEAVALASLALFVGIVAIWVQIIAAL |
| Ga0310916_107327441 | 3300031942 | Soil | VEIMVRALVEEAATLASPALFLGMIAIWAQVIATL |
| Ga0318530_103259162 | 3300031959 | Soil | GEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL |
| Ga0306924_104743801 | 3300032076 | Soil | SVHIGREPMIRAVAEEAAALASIAMFVGMIAIWAQVIAAL |
| Ga0318518_101246041 | 3300032090 | Soil | VGVVIMVRALVDEAATLASLALFLGMIAIWAQVIATL |
| Ga0315273_110150881 | 3300032516 | Sediment | MEDVMFRAVVEEAAALASITLFLGMIAIWAQVIAAM |
| Ga0310914_110598621 | 3300033289 | Soil | LSVLERCANVFRAIIEETAVLASLTLFLGMIAIWAQVIATL |
| ⦗Top⦘ |