NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045653

Metagenome / Metatranscriptome Family F045653

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045653
Family Type Metagenome / Metatranscriptome
Number of Sequences 152
Average Sequence Length 85 residues
Representative Sequence MNIFTYLSWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFKRS
Number of Associated Samples 113
Number of Associated Scaffolds 152

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 84.87 %
% of genes near scaffold ends (potentially truncated) 16.45 %
% of genes from short scaffolds (< 2000 bps) 67.76 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.70

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (76.316 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(36.184 % of family members)
Environment Ontology (ENVO) Unclassified
(67.105 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(81.579 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 57.02%    β-sheet: 0.00%    Coil/Unstructured: 42.98%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.70
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.104.1.0: automated matchesd3p3oa13p3o0.6515
a.104.1.0: automated matchesd3tkta_3tkt0.64569
a.104.1.0: automated matchesd4yt3a_4yt30.64527
a.104.1.0: automated matchesd3pm0a_3pm00.64308
a.104.1.0: automated matchesd5hiwa15hiw0.63884

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 152 Family Scaffolds
PF11753DUF3310 11.18
PF00149Metallophos 11.18
PF04404ERF 3.95
PF05766NinG 2.63
PF00959Phage_lysozyme 2.63
PF11351GTA_holin_3TM 1.97
PF03819MazG 1.32
PF12844HTH_19 0.66
PF04851ResIII 0.66
PF09588YqaJ 0.66
PF00583Acetyltransf_1 0.66
PF11134Phage_stabilise 0.66
PF02839CBM_5_12 0.66
PF04466Terminase_3 0.66
PF10145PhageMin_Tail 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 152 Family Scaffolds
COG1783Phage terminase large subunitMobilome: prophages, transposons [X] 0.66

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.16 %
UnclassifiedrootN/A11.84 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10005365All Organisms → cellular organisms → Bacteria9038Open in IMG/M
3300000101|DelMOSum2010_c10025891Not Available3311Open in IMG/M
3300000101|DelMOSum2010_c10032833All Organisms → cellular organisms → Bacteria → Proteobacteria2825Open in IMG/M
3300000101|DelMOSum2010_c10115881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1068Open in IMG/M
3300000115|DelMOSum2011_c10075906Not Available1188Open in IMG/M
3300000116|DelMOSpr2010_c10127636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium907Open in IMG/M
3300000117|DelMOWin2010_c10015247All Organisms → cellular organisms → Bacteria4183Open in IMG/M
3300000928|OpTDRAFT_10084660All Organisms → Viruses → Predicted Viral2723Open in IMG/M
3300000949|BBAY94_10212864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium520Open in IMG/M
3300001952|GOS2224_1036066All Organisms → Viruses → Predicted Viral1643Open in IMG/M
3300002144|M2t2BS2_11169896All Organisms → cellular organisms → Bacteria → Proteobacteria2151Open in IMG/M
3300003908|JGI26085J52751_1037322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium661Open in IMG/M
3300004448|Ga0065861_1088158All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1153Open in IMG/M
3300004460|Ga0066222_1142420All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1153Open in IMG/M
3300004461|Ga0066223_1264644All Organisms → cellular organisms → Bacteria → Proteobacteria574Open in IMG/M
3300005585|Ga0049084_10127230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium900Open in IMG/M
3300005747|Ga0076924_1153358All Organisms → Viruses → Predicted Viral2613Open in IMG/M
3300005747|Ga0076924_1340542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1117Open in IMG/M
3300005837|Ga0078893_10970214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium828Open in IMG/M
3300005913|Ga0075108_10024588All Organisms → Viruses → Predicted Viral2330Open in IMG/M
3300005933|Ga0075118_10106014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium981Open in IMG/M
3300006025|Ga0075474_10015919All Organisms → Viruses → Predicted Viral2789Open in IMG/M
3300006025|Ga0075474_10097477Not Available952Open in IMG/M
3300006026|Ga0075478_10046813All Organisms → Viruses → Predicted Viral1422Open in IMG/M
3300006027|Ga0075462_10000360All Organisms → cellular organisms → Bacteria13932Open in IMG/M
3300006027|Ga0075462_10067946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1122Open in IMG/M
3300006029|Ga0075466_1043816Not Available1344Open in IMG/M
3300006793|Ga0098055_1194057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium772Open in IMG/M
3300006802|Ga0070749_10007409All Organisms → cellular organisms → Bacteria7168Open in IMG/M
3300006802|Ga0070749_10599273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium594Open in IMG/M
3300006802|Ga0070749_10782141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium507Open in IMG/M
3300006803|Ga0075467_10683407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium523Open in IMG/M
3300006810|Ga0070754_10052356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2151Open in IMG/M
3300006810|Ga0070754_10389934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium611Open in IMG/M
3300006869|Ga0075477_10084261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1375Open in IMG/M
3300006916|Ga0070750_10004387All Organisms → cellular organisms → Bacteria7728Open in IMG/M
3300006916|Ga0070750_10047802Not Available2080Open in IMG/M
3300006916|Ga0070750_10146583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1069Open in IMG/M
3300007229|Ga0075468_10005735Not Available5098Open in IMG/M
3300007234|Ga0075460_10108722All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria991Open in IMG/M
3300007276|Ga0070747_1030651All Organisms → Viruses → Predicted Viral2136Open in IMG/M
3300007344|Ga0070745_1048030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1766Open in IMG/M
3300007346|Ga0070753_1027751All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2450Open in IMG/M
3300007346|Ga0070753_1122153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1002Open in IMG/M
3300007538|Ga0099851_1065268All Organisms → cellular organisms → Bacteria1416Open in IMG/M
3300007539|Ga0099849_1057583All Organisms → Viruses → Predicted Viral1605Open in IMG/M
3300007540|Ga0099847_1002708All Organisms → cellular organisms → Bacteria6136Open in IMG/M
3300007540|Ga0099847_1052248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1285Open in IMG/M
3300007540|Ga0099847_1065986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1124Open in IMG/M
3300007541|Ga0099848_1040505All Organisms → cellular organisms → Bacteria1908Open in IMG/M
3300007609|Ga0102945_1100765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium519Open in IMG/M
3300007609|Ga0102945_1100783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium519Open in IMG/M
3300009074|Ga0115549_1156645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium738Open in IMG/M
3300009074|Ga0115549_1189706All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium658Open in IMG/M
3300009076|Ga0115550_1020494All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium3153Open in IMG/M
3300009149|Ga0114918_10111179All Organisms → Viruses → Predicted Viral1685Open in IMG/M
3300009423|Ga0115548_1038057All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1790Open in IMG/M
3300009438|Ga0115559_1095262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1170Open in IMG/M
3300009438|Ga0115559_1111492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1054Open in IMG/M
3300009497|Ga0115569_10054650All Organisms → cellular organisms → Bacteria2185Open in IMG/M
3300009497|Ga0115569_10382535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium608Open in IMG/M
3300009599|Ga0115103_1665888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium989Open in IMG/M
3300010316|Ga0136655_1143361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium714Open in IMG/M
3300011253|Ga0151671_1012282All Organisms → cellular organisms → Bacteria12875Open in IMG/M
3300011253|Ga0151671_1097650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium586Open in IMG/M
3300011253|Ga0151671_1120606All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria826Open in IMG/M
3300011258|Ga0151677_1099881All Organisms → cellular organisms → Bacteria5202Open in IMG/M
3300013941|Ga0117792_1004753All Organisms → cellular organisms → Bacteria1779Open in IMG/M
3300014042|Ga0117790_1010863All Organisms → cellular organisms → Bacteria2721Open in IMG/M
3300017697|Ga0180120_10217610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium786Open in IMG/M
3300017735|Ga0181431_1109779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium617Open in IMG/M
3300017950|Ga0181607_10180239All Organisms → Viruses → Predicted Viral1257Open in IMG/M
3300017951|Ga0181577_10208320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1303Open in IMG/M
3300017951|Ga0181577_10466797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium794Open in IMG/M
3300018036|Ga0181600_10346597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium733Open in IMG/M
3300018041|Ga0181601_10131984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1558Open in IMG/M
3300018041|Ga0181601_10498245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium635Open in IMG/M
3300018048|Ga0181606_10191796All Organisms → Viruses → Predicted Viral1194Open in IMG/M
3300018416|Ga0181553_10598979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium582Open in IMG/M
3300018417|Ga0181558_10705760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium513Open in IMG/M
3300018420|Ga0181563_10436812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium742Open in IMG/M
3300018420|Ga0181563_10577172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium627Open in IMG/M
3300018682|Ga0188851_1001969All Organisms → cellular organisms → Bacteria → Proteobacteria3356Open in IMG/M
3300018682|Ga0188851_1007731All Organisms → Viruses → Predicted Viral1486Open in IMG/M
3300018775|Ga0188848_1000343Not Available6299Open in IMG/M
3300018775|Ga0188848_1009645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1060Open in IMG/M
3300020166|Ga0206128_1018967Not Available3971Open in IMG/M
3300020166|Ga0206128_1079229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1483Open in IMG/M
3300020185|Ga0206131_10321186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium682Open in IMG/M
3300020194|Ga0181597_10158898All Organisms → Viruses → Predicted Viral1147Open in IMG/M
3300021085|Ga0206677_10000806Not Available29952Open in IMG/M
3300021085|Ga0206677_10005186All Organisms → cellular organisms → Bacteria10354Open in IMG/M
3300021185|Ga0206682_10019740All Organisms → Viruses → Predicted Viral4324Open in IMG/M
3300021368|Ga0213860_10012073All Organisms → cellular organisms → Bacteria3542Open in IMG/M
3300021378|Ga0213861_10486948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium588Open in IMG/M
3300021957|Ga0222717_10007083All Organisms → Viruses7993Open in IMG/M
3300021957|Ga0222717_10108641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1728Open in IMG/M
3300021960|Ga0222715_10117947Not Available1690Open in IMG/M
3300021961|Ga0222714_10622186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium536Open in IMG/M
3300022063|Ga0212029_1005889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1375Open in IMG/M
3300022065|Ga0212024_1052386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium717Open in IMG/M
3300022068|Ga0212021_1003372All Organisms → cellular organisms → Bacteria → Proteobacteria2222Open in IMG/M
3300022068|Ga0212021_1012784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1465Open in IMG/M
3300022072|Ga0196889_1001201Not Available7125Open in IMG/M
3300022072|Ga0196889_1023782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1266Open in IMG/M
3300022164|Ga0212022_1005824All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1614Open in IMG/M
3300022164|Ga0212022_1027062Not Available873Open in IMG/M
3300022167|Ga0212020_1024590Not Available989Open in IMG/M
3300022178|Ga0196887_1019614Not Available2021Open in IMG/M
3300022183|Ga0196891_1001774All Organisms → cellular organisms → Bacteria4726Open in IMG/M
3300022187|Ga0196899_1072293Not Available1073Open in IMG/M
3300022187|Ga0196899_1173519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium586Open in IMG/M
3300022198|Ga0196905_1015037All Organisms → cellular organisms → Bacteria2494Open in IMG/M
3300022200|Ga0196901_1141516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium807Open in IMG/M
3300022885|Ga0222662_1012268All Organisms → cellular organisms → Bacteria2180Open in IMG/M
3300023683|Ga0228681_1023619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium713Open in IMG/M
(restricted) 3300024059|Ga0255040_10227177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium769Open in IMG/M
3300025084|Ga0208298_1063255All Organisms → cellular organisms → Bacteria → Proteobacteria705Open in IMG/M
3300025425|Ga0208646_1003494All Organisms → cellular organisms → Bacteria5937Open in IMG/M
3300025543|Ga0208303_1000321All Organisms → cellular organisms → Bacteria19740Open in IMG/M
3300025543|Ga0208303_1036254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1277Open in IMG/M
3300025621|Ga0209504_1020389All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2551Open in IMG/M
3300025645|Ga0208643_1166617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium545Open in IMG/M
3300025653|Ga0208428_1000946All Organisms → cellular organisms → Bacteria12590Open in IMG/M
3300025671|Ga0208898_1071899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1147Open in IMG/M
3300025674|Ga0208162_1047419All Organisms → Viruses → Predicted Viral1459Open in IMG/M
3300025767|Ga0209137_1034733All Organisms → cellular organisms → Bacteria2623Open in IMG/M
3300025769|Ga0208767_1259256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium537Open in IMG/M
3300025806|Ga0208545_1002073All Organisms → cellular organisms → Bacteria8633Open in IMG/M
3300025818|Ga0208542_1004333All Organisms → cellular organisms → Bacteria5409Open in IMG/M
3300025840|Ga0208917_1111145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium990Open in IMG/M
3300025860|Ga0209119_1004334Not Available11717Open in IMG/M
3300025879|Ga0209555_10043374All Organisms → cellular organisms → Bacteria → Proteobacteria2055Open in IMG/M
3300026097|Ga0209953_1000355Not Available16830Open in IMG/M
3300027612|Ga0209037_1134258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium600Open in IMG/M
3300027845|Ga0209271_10445633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium507Open in IMG/M
3300028008|Ga0228674_1115099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium926Open in IMG/M
3300028125|Ga0256368_1011494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1500Open in IMG/M
3300028125|Ga0256368_1019536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1192Open in IMG/M
3300028125|Ga0256368_1067069All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300028287|Ga0257126_1031971All Organisms → cellular organisms → Bacteria → Proteobacteria2361Open in IMG/M
3300031519|Ga0307488_10002599Not Available15238Open in IMG/M
3300031519|Ga0307488_10134058All Organisms → Viruses → Predicted Viral1756Open in IMG/M
3300031519|Ga0307488_10375932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium887Open in IMG/M
3300031519|Ga0307488_10589963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium647Open in IMG/M
3300031539|Ga0307380_11206067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium586Open in IMG/M
3300031629|Ga0307985_10076930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1349Open in IMG/M
3300031658|Ga0307984_1055657All Organisms → Viruses → Predicted Viral1223Open in IMG/M
3300031658|Ga0307984_1207589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium533Open in IMG/M
3300031669|Ga0307375_10514030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium719Open in IMG/M
3300034374|Ga0348335_118538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium790Open in IMG/M
3300034375|Ga0348336_213414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium503Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous36.18%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh7.89%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine5.92%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine4.61%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine3.29%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.29%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.63%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.63%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.63%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine2.63%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.63%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.97%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine1.97%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.97%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.97%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water1.97%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.32%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.32%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.32%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake1.32%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.32%
Epidermal MucusHost-Associated → Fish → Skin → Epidermal Mucus → Unclassified → Epidermal Mucus1.32%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.66%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.66%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.66%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.66%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.66%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.66%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.66%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.66%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.66%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.66%
MarineEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine0.66%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.66%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001952Marine microbial communities from Newport Harbor, Rhode Island, USA - GS008EnvironmentalOpen in IMG/M
3300002144Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f)EnvironmentalOpen in IMG/M
3300003908Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNAEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004460Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300005585Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRFEnvironmentalOpen in IMG/M
3300005747Seawater microbial communities from Vineyard Sound, MA, USA - control T14EnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300005913Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1EnvironmentalOpen in IMG/M
3300005933Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKEEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007609Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MGEnvironmentalOpen in IMG/M
3300009074Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430EnvironmentalOpen in IMG/M
3300009076Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009438Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300013941Epidermal mucus viral and microbial communities from European eel in Spain - water from Alfacada pond (Ebro delta)Host-AssociatedOpen in IMG/M
3300014042Epidermal mucus viral and microbial communities from European eel in Spain - Ebro delta (0.22 um filter)Host-AssociatedOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018682Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1EnvironmentalOpen in IMG/M
3300018775Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020194Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022063Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022167Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022885Saline water microbial communities from Ace Lake, Antarctica - #600EnvironmentalOpen in IMG/M
3300023683Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 22R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025425Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025621Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025767Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025860Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026097Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027612Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027845Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes)EnvironmentalOpen in IMG/M
3300028008Seawater microbial communities from Monterey Bay, California, United States - 1D_rEnvironmentalOpen in IMG/M
3300028125Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SBEnvironmentalOpen in IMG/M
3300028287Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120mEnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031629Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80EnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300031669Soil microbial communities from Risofladan, Vaasa, Finland - TR-1EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1000536543300000101MarineMNIFTYLSWVKKLWTTVVEIVKLIEETIPDDGAGKAKLAAFDLMLKAALEKADDIDESFDRLQPVAHDIVGAVVTLFNATGLFKRAE*
DelMOSum2010_1002589153300000101MarineMNIFTYLSWVKKLWVMVVDIVKLIEETIPDDGAGKEKLIAFDILLKAAIEKADDIDEEFDKLQPVAHDIVRAVIALFNATGLFKKK*
DelMOSum2010_1003283363300000101MarineMNIFTYLSWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFKRGE*
DelMOSum2010_1011588133300000101MarineMNLFEYLGWVKRLWSMVVDIVKLIEETIPDDGAGKEKLLAFDIMLKAAIEKADDIDAEFDKLQPVAHDIVSSVVTLFNTVGLFRRSK*
DelMOSum2011_1007590633300000115MarineMNLITYLGWVKKLWKTVIDIIKLIEETIPDNGAGKEKLAAFDLLLKAAIEKSEDIDEEFDKLQPVAHDIVNVAVALFNKTGLFKKS*
DelMOSpr2010_1012763623300000116MarineMSLFEYLGWVKRLWNMVVDIVKLIEETIPDDGAGKEKLMAFDVMLKAAIEKADDIDAEFDKLQPVAHDIVSSVVTLFNTVGLFRRSK*
DelMOWin2010_1001524763300000117MarineMGLFEYLKWVKRLWSTVVDIVKLIEETIPDDGAGNSKLAAFDAMLKGAIEKADDIDEDFDKLKPVAHDIVNAVVTLFNATGIFKKSS*
OpTDRAFT_1008466023300000928Freshwater And MarineMNLFEYLGWVKRLWSMVVDIVKLIEETIPDDGAGKEKLMAFDIMLKAAIEKADDIDESFDKLQPVAHDIVSTIITLFNTVGLFKRSK*
BBAY94_1021286413300000949Macroalgal SurfaceMNLFEYLGWVKRLWSMVVEIVKLIEETIPDDGAGKEKLAAFDVMLKAAIEKADDIDAEFDKLQPVAHDIVSSVVTLFNTVGLFKRSK*
GOS2224_103606653300001952MarineMNIFTYLSWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDEEFDKLQPVAHDIVRAVVTLFNATGLFKKK*
M2t2BS2_1116989653300002144MarineMNIFTYLNWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFKRGE*
JGI26085J52751_103732223300003908MarineMNILTYLSWVRKLWNTVVEIVKLIEETIPDDGAGKEKLAAFDVMLKAALEKADDIDESFDKLQPVAHDIV
Ga0065861_108815833300004448MarineMNIFTYLSWVKKLWTTVVEIVKLIEETIPDDGAGKEKLAAFDLMLKAALEKADDIVESFDRLQPVAHDIVGAVVTLFNATGLFKRAE*
Ga0066222_114242033300004460MarineMNIFTYLSWVKKLWTTVVEIVKLIEETIPDDGAGKEKLAAFDLMLKAALEKADDIDESFDRLQPVAHDIVGAVVTLFNATGLFKRAE*
Ga0066223_126464413300004461MarineMNIFTYLSWVKKLWTTVVEIVKLIEETIPDDGAGKEKLVAFDLMLKAALEKADDIDESFDKLQPVAHDIVGAVVTLFNATGLFKRAE*
Ga0049084_1012723033300005585Freshwater LenticMNIFTYLKLVKKLWVLVVDIVKLIEETIPDDGAGKEKLAAFDVILKSAIEKADDIDESFEKLQPVAHDIVAAVVVLFNARGIFRKSA*
Ga0076924_115335823300005747MarineMGLLAYLGWVKKLWTMVVDIVKLIEQTIPDDGAGKEKLAAFDLLLKAAIEKADDIDEEFEKLQPVAHDIVRAVVTLFNATGLFKKK*
Ga0076924_134054223300005747MarineMGLLEYLKWVKKLWTTVIDIVKLIEETIPDDGAGKAKLAAFDVLLKAAIDKAEDIDEQFDKLQPVAHDIAGAAVALFNATGLFKKS*
Ga0078893_1097021423300005837Marine Surface WaterMNLFTYLGWVKKLWSMVVDIIKLIEETIPDDGAGKQKLEAFDVMLKLAIEKAEDIDESFDKXXXXXXXLVGAVVTLFNATGVFKKKA*
Ga0075108_1002458853300005913Saline LakeMSLFEYLGWMRRLWSMVVEIVKLIEETIPDDGAGKEKLVAFDVMLKAAIEKADDIDASFDKLQPVAHDIVATVVTLFNTVGLFKRS*
Ga0075118_1010601443300005933Saline LakeMSLFEYLGWMRRLWSMVVEIVKLIEETIPDDGAGKEKLVAFDVMLKAAIEKADDIDASFDKLQPVAHDIVSTVVTLFNTVGLFKRS*
Ga0075474_1001591943300006025AqueousMNIMTYLSWVRKLWNTAVEIVKLIEETIPDDGAGKAKLAAFDVMLKAAIEKADDIDESFDKLQPVGHDIAAAVVTLFNSVGLFRKS*
Ga0075474_1009747743300006025AqueousLWSMVVEIVKLIEETIPDDGAGKEKLAAFDIMLKAAIAKANDIDAEFDKLQPVAHDIVSAVVTLFNTVGIFKRS*
Ga0075478_1004681343300006026AqueousMSLFEYLGWVKRLWSMVVEIVKLIEETIPDDGAGKEKLAAFDIMLKAAIAKANDIDAEFDKLQPVAHDIVSAVVTLFNTVGIFKRS*
Ga0075462_1000036063300006027AqueousMGLFEYLKWVKRLWTTVVDIVKLIEETIPDDGAGNSKLVAFDAMLKGAIEKADDIDEDFDKLKPVAHDIVNAVVTLFNATGIFKKSS*
Ga0075462_1006794643300006027AqueousMSLFEYLAWVKRLWSMVVEIVKLIEETIPDDGAGKEKLMAFDVMLKAAIEKADDIDAEFDKLQPVAHDIVSSVVTLFNTVGLFRRSK*
Ga0075466_104381633300006029AqueousMNLLTYLSWVKKLWKTVIDIIKLIEETIPDNGAGKEKLAAFDLLLKAAIEKSEDIDEEFDKLQPVAHDIVNVAVALFNKTGLFKKS*
Ga0098055_119405723300006793MarineMNIFTYLSWVKKLWTTVVEIVKLIEETIPDDGAGKQKLAAFDVMLKAALEKADDIDESFEKLQPVAHDIVGAVVTLFNATGLFKRAE*
Ga0070749_10007409173300006802AqueousMNILTYLSWVRKLWSTAVEIIKLIEETIPDDGAGKEKLAAFDVMLKAAIEKADDIDESFDKLRPVGHDIAAAVVTLFNATGIFKRSQ*
Ga0070749_1059927313300006802AqueousMSLFEYLGWVKRLWSMVVDIVKLIEETIPDDGAGKQKLLAFDIMLKAAIEKADDIDAEFDKLQPVAHDIVSSVVTLFNTVGLFRRSK*
Ga0070749_1078214113300006802AqueousTVVDIVKLIEETIPDDGAGNSKLVAFDAMLKGAIEKADDIDEDFDKLKPVAHDIVNAVVTLFNATGIFKKSS*
Ga0075467_1068340713300006803AqueousTYLSWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDVMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFKRSK*
Ga0070754_1005235643300006810AqueousMGFLDYLRWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFRRSK*
Ga0070754_1038993423300006810AqueousMGILAYLGWVKRLWVMVVDIVKLIEETIPDDGAGKEKLAAFDLLLRGAIEKADDIDEDFEKLQPVAHDIVRAAVTLFNATGLFKKKA*
Ga0075477_1008426133300006869AqueousMGFLDYLRWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDVMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFRRSK*
Ga0070750_1000438723300006916AqueousMVVDIVKLIEETIPDDGAGKEKLAAFDLLLRGAIEKADDIDEDFEKLQPVAHDIVRAAVTLFNATGLFKKKA*
Ga0070750_1004780243300006916AqueousMSLFEYLGWVKRLWSMVVDIVKLIEETIPDDGAGKEKLLAFDIMLKAAIEKADDIDAEFDKLQPVAHDIVSSVVTLFNTVGLFRRSK*
Ga0070750_1014658313300006916AqueousMGFLDYLRWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDVMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFKRC
Ga0075468_10005735123300007229AqueousMNIFTYLSWVKKLWVMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDEEFDKLQPVAHDIVRAVIALFNATGLFKKK*
Ga0075460_1010872233300007234AqueousVEIIKLIEETIPDDGAGKEKLAAFDVMLKAAIEKADDIDESFDKLRPVGHDIAAAVVTLFHATGIFKRSQ*
Ga0070747_103065153300007276AqueousMNILTYLSWVRKLWNTVVEIVKLIEETIPDDGAGKEKLAAFDVMLKAALEKADDIDESFDKLQPVAHDIVAAVVTLFNAT
Ga0070745_104803013300007344AqueousMNILTYLSWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFRRSK*
Ga0070753_102775153300007346AqueousMNILTYLGWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFRRSK*
Ga0070753_112215323300007346AqueousMSLFEYLGWVKRLWSMVVEIVKLIEETIPDDGAGKEKLMAFDIMLKAAIEKADDIDAEFDKLQPVAHDIVSSVVTLFNTVGLFRRSK*
Ga0099851_106526853300007538AqueousMSLFEYLSWVKRLWNLVVDIVKLIEETIPDDGAGKEKLQAFDVLLKAAIEKAEDIDAEFDKLQPVAHDIVSSVVTLFNTVGIFKRSR*
Ga0099849_105758353300007539AqueousMSLFEYLGWVKRLWSMVVEIVKLIEETIPDDGAGKEKLAAFDIMLKAAIAKADDIDAEFDKLQPVAHDIVSSVVTLFNTVGIFKRS*
Ga0099847_100270883300007540AqueousMGLLAYLGWVKKLWTMVVDIVKLIEQTIPDDGAGKEKLAAFDLLLKAAIEKADDIDEEFEKLQPVAHDIVRAVVTLFNATGMFKKK*
Ga0099847_105224823300007540AqueousMNILTYLGWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFKRSE*
Ga0099847_106598633300007540AqueousMSLFEYLGWVKRLWSMVVEIVKLIEETIPDDGAGKEKLAAFDLMLKAAIEKADDIDAEFDKLQPVAHDIVSSVITLFNTVGIFKRS*
Ga0099848_104050553300007541AqueousMSLFEYLSWVKRLWNLVVDIVKLIEETIPDDGAGKEKLQAFDVLLKAAIEKAEDIDAEFDKLQPVAHDIVSSVVTLFNTVGIFKRSK*
Ga0102945_110076523300007609Pond WaterMNIFTYLSWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFKRSE*
Ga0102945_110078323300007609Pond WaterMNIFTYLSWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDVDESFDKLQPVAHDIVSAVVTLFNATGLFKRSE*
Ga0115549_115664523300009074Pelagic MarineMNLFEYLSWVKRLWSMVVDIVKLIEETIPDDGAGKEKLLAFDIMLKAAIEKADDIDAEFDKLQPVAHDIVSSVVTLFNTVGLFRRSK*
Ga0115549_118970623300009074Pelagic MarineWSMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFKRS*
Ga0115550_102049433300009076Pelagic MarineMNIFTYLSWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFKRS*
Ga0114918_1011117923300009149Deep SubsurfaceMRRLWAMVVEIVKLIEETIPDDKAGSAKLAAFDVILKAALEKADDIDESFDKLQPVAHDIVAAVVTLFNATSLFKKKV*
Ga0115548_103805713300009423Pelagic MarineMGLLAYLGWVKKLWTMVVDIVKLIEQTIPDDGAGKEKLAAFDLLLKAAIEKADDIDEEFEKLQPVAHDIVRAVVTLFNAT
Ga0115559_109526223300009438Pelagic MarineMNIFTYLSWVKKLWSMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFKRGE*
Ga0115559_111149233300009438Pelagic MarineMSLFEYLGWVKRLWSMVVDIVKLIEETIPDDGAGKEKLLAFDIMLKAAIEKADDIDAEFSKLQPVAHDIVSSVVTLFNTVGLFRRSK*
Ga0115569_1005465023300009497Pelagic MarineMSLFEYLGWVKRLWSMVVDIVKLIEETIPDDGAGKEKLLAFDIMLKAAIEKADDIDAEFDKLQPVAHDIVSSVITLFNTVGIFKRS*
Ga0115569_1038253513300009497Pelagic MarineKRLWSMVVDIVKLIEETIPDDGAGKEKLLAFDIMLKAAIEKADDIDAEFDKLQPVAHDIVSSVVTLFNTVGLFRRSK*
Ga0115103_166588843300009599MarineMGLLAYLGWVKKLWSMVVDIVKLIEETIPDDGAGKEKLVAFDLLLKAAIEKADDIDEDFDKLQPVAHDIVRAVVTLFNATGLFKKK*
Ga0136655_114336133300010316Freshwater To Marine Saline GradientMSLFEYLGWVKRLWSMVVEIVRLIEETIPDDGAGKEKLMAFDIMLKAAIEKADDIDAEFDKLQPVAHDIVSSVVTLFNTVGLFRRSK*
Ga0151671_101228293300011253MarineMSLFEYLGWVKRLWSMVVEIVKLIEETIPDDGAGKEKLAAFDLMLKGAIETADDIDAEFDKLQPVAHDIVNVVVALFNKTGLFKKS*
Ga0151671_109765013300011253MarineMNILTYLSWVRKLWNTVVEIVKLIEETIPDDGAGKEKLAAFDVMLKAAIEKADDIDESFDKLQPVAHDIVATIITLFNTVGLFKRSK*
Ga0151671_112060613300011253MarineMSLFEYLGWVKRLWSMVVEIVKLIEETIPDDGAGKEKLAAFDLMLKAAIEKADEIEAEFDKLQPVAHDIVSSVITLFNTVGIFKRS*
Ga0151677_1099881143300011258MarineMNIFTYLSWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDVMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFKRSE*
Ga0117792_100475323300013941Epidermal MucusMTYLSWVKKLWAMVVDIVKLLEETIPDDGAGKEKLAAFDVMLKAAIEKSDDIDESFDKLQPVAHDIVSAVVTLFNATGLFRRSE*
Ga0117790_101086343300014042Epidermal MucusMNIMTYLSWVKKLWAMVVDIVKLLEETIPDDGAGKEKLAAFDVMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFRRSE*
Ga0180120_1021761023300017697Freshwater To Marine Saline GradientMNLITYLGWVKKLWKTVIDIIKLIEETIPDNGAGKEKLAAFDLLLKAAIEKSEDIDEEFDKLQPVAHDIVNVAVALFNKTGLFKKS
Ga0181431_110977913300017735SeawaterSWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFKRGE
Ga0181607_1018023923300017950Salt MarshMSLFEYLGWVKRLWSMVVEIVKLIEETIPDDGAGKEKLAAFDVMLKAAIAKADDIDAEFDKLQPVAHDIVSSVVTLFNTVGIFKRS
Ga0181577_1020832023300017951Salt MarshMGLFEYLKWVKRLWTTVVDIVKLIEETIPDDGAGNSKLVAFDAMLKGAIEKADDIDEDFDKLKPVAHDIVNAVVTLFNATGIFKKSS
Ga0181577_1046679723300017951Salt MarshMGLFEYLKWVKRLWSTVVDIVKLIEETIPDDGAGNSKLAAFDAMLKGAIEKADDIDEDFDKLKPVAHDIVNAVVTLFNATGIFKKKSS
Ga0181600_1034659723300018036Salt MarshMSLFEYLGWVKRLWSMVVDIVKLIEETIPDDGAGKEKLLAFDIMLKAAIEKADDIDAEFDKLQPVAHDIVSSVVTLFNTVGLFRRSK
Ga0181601_1013198433300018041Salt MarshMSLFEYLGWVKRLWSMVVDIVKLIEETIPDDGAGKEKLLAFDIMLKAAIEKADDIDAEFSKLQPVAHDIVSSVVTLFNTVGLFRRSK
Ga0181601_1049824513300018041Salt MarshMVVEIVKLIEETIPDDGAGKEKLAAFDVMLKAANAKADDIDAEFDKLQPVAHDIVSSVVTLFNTVGIFKRS
Ga0181606_1019179633300018048Salt MarshMSLFEYLGWVKRLWSMVVEIVKLIEETIPDDGAGKEKLAAFDLMLKAAIEKADDIDAEFDKLQPVAHDIVSSVITLFNTVGIFKRS
Ga0181553_1059897913300018416Salt MarshMNIMTYLSWVRKLWNTAVEIVKLIEETIPDGGAGKAKLAAFDVMLKAAIEKADDIDESFDKLQPVGHDIAAAVVTLFNRVGLFRKS
Ga0181558_1070576013300018417Salt MarshMNIMTYLSWVRKLWNTVVEIVKLIEETIPDGGAGKAKLAAFDVMLKAAIEKADDIDESFDKLQPVGHDIAAAVVTLFNSVGLFRKS
Ga0181563_1043681223300018420Salt MarshMNILTYLGWVRKLWTTVVEIVKLIEETIPDDGAGKEKLMAFDVMLKAAIEKADDIDESFDKLRPVGHDIAAAVVSLFNATGIFKRSE
Ga0181563_1057717223300018420Salt MarshMTYLSWVRKLWNTVVEIVKLIEETIPDGGAGKAKLAAFDVMLKAAIEKADDIDESFDKLQPVGHDIAAAVVTLFNSVGLFRKS
Ga0188851_100196953300018682Freshwater LakeMNIFTYLNWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFKRGE
Ga0188851_100773143300018682Freshwater LakeMNILTYLSWVRKLWNTVVEIVKLIEETIPDDGAGKEKLAAFDIMLKAALDKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFRKS
Ga0188848_100034363300018775Freshwater LakeMNLITYLGWVKKLWKTVIEIIKLIEETIPDNGAGKEKLAAFDLLLKAAIEKSEDIDEEFDKLQPVAHDIVNVAVALFNKTGLFKKS
Ga0188848_100964523300018775Freshwater LakeMNIFTYLSWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFKRGE
Ga0206128_101896743300020166SeawaterMGLLAYLGWVKKLWTMVVDIVKLIEQTIPDDGAGKEKLAAFDLLLKAAIEKADDIDEEFEKLQPVAHDIVRAVVTLFNATGLFKKK
Ga0206128_107922943300020166SeawaterMSLFEYLGWVKRLWNMVVDIVKLIEETIPDDGAGKEKLMAFDVMLKAAIEKADDIDAEFDKLQPVAHDIVSSVVTLFNTVGLFRRSK
Ga0206131_1032118623300020185SeawaterFTYLSWVKKLWTTVVEIVKLIEETIPDDGAGKAKLAAFDLMLKAALEKADDIDESFDRLQPVAHDIVGAVVTLFNATGLFKRAE
Ga0181597_1015889823300020194Salt MarshMSLFEYLGWVKRLWSMVVDIVKLIEETIPDDGAGKEKLLAFDIMLKAAIEKADDIDAEFDKLQPVAHDIVSSVITLFNTVGIFKRS
Ga0206677_1000080663300021085SeawaterMNIFTYLSWVKKLWSTVVEIVKLIEETIPDDGAGKEKLAAFDLMLKAALEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFKRAE
Ga0206677_1000518673300021085SeawaterMNILTYLNWVRKLWSTVVEIVKLIEETIPDDGAGKEKLIAFDIMLKAALEKADDIDESFDKLQPVAHDIVAAAVTLFNATGLFKKS
Ga0206682_1001974023300021185SeawaterMNLFEYLGWVKRLWSMVVDIVKLIEETIPDDGAGKEKLMAFDIMLKAAIEKADDIDESFDKLQPVAHDIVSTIITLFNTVGLFKRSK
Ga0213860_1001207353300021368SeawaterMGLFEYLKWVKRLWSTVVDIVKLIEETIPDDGAGNSKLVAFDAMLKGAIDKADDIDEDFDKLKPVAHDIVNAVVTLFNATGIFKKSA
Ga0213861_1048694823300021378SeawaterMNILTYLGWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFKRGE
Ga0222717_1000708383300021957Estuarine WaterMSIFEYLKWVKKLWSMVVDIVKLIEETIPDDGAGKEKLMAFDIMLKAAIEKADDIDEQFDKLQPVAHDIVNTVVTLFNTVGLFKRSK
Ga0222717_1010864153300021957Estuarine WaterMNIFTYLSWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDEEFDKLQPVAHDIVRAVIALFNATGLFKKK
Ga0222715_1011794723300021960Estuarine WaterMSLFEYLGWVKRLWNMVVEIVKLIEETIPDDGAGKEKLAAFDVMLKAAIAKADDIDAEFDKLQPVAHDIVSSVVTLFNTVGIFKRSK
Ga0222714_1062218623300021961Estuarine WaterMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDEEFDKLQPVAHDIVRAVIALFNATGLFKKK
Ga0212029_100588943300022063AqueousMSLFEYLSWVKRLWNLVVDIVKLIEETIPDDGAGKEKLQAFDVLLKAAIEKAEDIDAEFDKLQPVAHDIVSSVVTLFNTVGIFKRSK
Ga0212024_105238633300022065AqueousMGILAYLGWVKRLWVMVVDIVKLIEETIPDDGAGKEKLAAFDLLLRGAIEKADDIDEDFEKLQPVAHDIVRAAVTLFNATGLFKKKA
Ga0212021_100337243300022068AqueousMVVDIVKLIEETIPDDGAGKEKLAAFDLLLRGAIEKADDIDEDFEKLQPVAHDIVRAAVTLFNATGLFKKKA
Ga0212021_101278443300022068AqueousMSLFEYLAWVKRLWSMVVEIVKLIEETIPDDGAGKEKLMAFDVMLKAAIEKADDIDAEFDKLQPVAHDIVSSVVTLFNTVGLFRRSK
Ga0196889_1001201113300022072AqueousMNLLTYLSWVKKLWKTVIDIIKLIEETIPDNGAGKEKLAAFDLLLKAAIEKSEDIDEEFDKLQPVAHDIVNVAVALFNKTGLFKKS
Ga0196889_102378223300022072AqueousMNIFTYLSWVKKLWTTVVEIVKLIEETIPDDGAGKAKLAAFDLMLKAALEKADDIDESFDRLQPVAHDIVGAVVTLFNATGLFKRAE
Ga0212022_100582443300022164AqueousMNLLTYLSWVKKLWKTVIDIIKLIEETIPDNGAGKEKLAAFDLLLKAAIEKSEDIDEEFDKLQPVAHDIVNVAVAL
Ga0212022_102706213300022164AqueousKKLWTTVVEIVKLIEETIPDDGAGKAKLAAFDLMLKAALEKADDIDESFDRLQPVAHDIVGAVVTLFNATGLFKRAE
Ga0212020_102459023300022167AqueousMSLFEYLGWVKRLWSMVVEIVKLIEETIPDDGAGKEKLAAFDIMLKAAIAKANDIDAEFDKLQPVAHDIVSAVVTLFNTVGIFKRS
Ga0196887_101961453300022178AqueousMNIFTYLSWVKKLWVMVVDIVKLIEDTIPDDGAGKEKLIAFDILLKAAIEKADDIDEEFDKLQPVAHDIVRAVIALFNATGLFKKK
Ga0196891_100177463300022183AqueousMNILTYLSWVRKLWSTAVEIIKLIEETIPDDGAGKEKLAAFDVMLKAAIEKADDIDESFDKLRPVGHDIAAAVVTLFNATGIFKRSQ
Ga0196899_107229343300022187AqueousMNIMTYLSWVRKLWNTAVEIVKLIEETIPDDGAGKAKLAAFDVMLKAAIEKADDIDESFATLQPVGHDIAAAVVTLFNSVGLFRKS
Ga0196899_117351923300022187AqueousMNILTYLGWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFRRSK
Ga0196905_101503763300022198AqueousMSLFEYLSWVKRLWNLVVDIVKLIEETIPDDGAGKEKLQAFDVLLKAAIEKAEDIDAEFDKLQPVAHDIVSSVVTLFNTVGIFKRSR
Ga0196901_114151633300022200AqueousMSLFEYLSWVKRLWNLVVDIVKLIEETIPDDGAGKEKLQAFDVLLKAAIEKAEDIDAEFDKLQPVAHDIVSSVVTLFNTVGIFKRS
Ga0222662_101226853300022885Saline WaterMNIFTYLSWVKKLWTTVVEIVKLIEETIPDDGAGKEKLAAFDLMLKAALEKADDIDESFDKLQPVAHDIVGAVVTLFNATGLFKRAE
Ga0228681_102361923300023683SeawaterMNLFEYLGWVKRLWSMVVDIVKLIEETIPDDGAGKEKLLAFDIMLKAAIEKADDIDAEFDKLQPVAHDIVSSVVTLFNTVGLFKRSK
(restricted) Ga0255040_1022717723300024059SeawaterMGLLEYLKWVKKLWATVIDIVKLIEETIPDDGAGKAKLAAFDVLLKAAIDKAEDIDEQFDKLQPVAHDIASAAVALFNATGLFKKS
Ga0208298_106325513300025084MarineMNIFTYLSWVKKLWTTVVEIVKLIEETIPDDGAGKQKLAAFDVMLKAALEKADDIDESFEKLQPVAHDIVGAVVTLFNATGLFKRAE
Ga0208646_100349453300025425Saline LakeMSLFEYLGWMRRLWSMVVEIVKLIEETIPDDGAGKEKLVAFDVMLKAAIEKADDIDASFDKLQPVAHDIVATVVTLFNTVGLFKRS
Ga0208303_1000321403300025543AqueousMGLLAYLGWVKKLWTMVVDIVKLIEQTIPDDGAGKEKLAAFDLLLKAAIEKANDIDEEFEKLQPVAHDIVRAVVTLFNATGMFKKK
Ga0208303_103625443300025543AqueousMNILTYLGWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFKRSE
Ga0209504_102038953300025621Pelagic MarineMNIFTYLSWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFKRS
Ga0208643_116661713300025645AqueousMNILTYLSWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDVMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNA
Ga0208428_1000946103300025653AqueousMNIMTYLSWVRKLWNTAVEIVKLIEETIPDDGAGKAKLAAFDVMLKAAIEKADDIDESFDKLQPVGHDIAAAVVTLFNSVGLFRKS
Ga0208898_107189943300025671AqueousMNILTYLSWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDVMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFRRSK
Ga0208162_104741923300025674AqueousMSLFEYLGWVKRLWSMVVEIVKLIEETIPDDGAGKEKLAAFDIMLKAAIAKADDIDAEFDKLQPVAHDIVSSVVTLFNTVGIFKRS
Ga0209137_103473323300025767MarineMNILTYLSWVRKLWNTVVEIVKLIEETIPDDGAGKEKLAAFDVMLKAAIEKADDIDESFATLQPVGHDIAAAVVTLFNSVGLFRKS
Ga0208767_125925623300025769AqueousMSLFEYLGWVKRLWSMVVDIVKLIEETIPDDGAGKEKLLAFDIMLKAAIEKADDIDAEFDKLQPVAHDIVSSVVTLFNTVGLFRRS
Ga0208545_100207363300025806AqueousMNIFTYLSWVKKLWVMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDIDEEFDKLQPVAHDIVRAVIALFNATGLFKKK
Ga0208542_100433383300025818AqueousMGLFEYLKWVKRLWTTVVDIVKLIEETIPDDGAGNSKLVAFDAMLKGAIEKADDIDEDFDKLKPVAHDIVNAVVTLNATGIFKKKSS
Ga0208917_111114533300025840AqueousMGFLDYLRWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDVMLKAAIEKADDIDESFDKLQPVAHDIVSAVVTLFNATGLFRRSK
Ga0209119_100433413300025860Pelagic MarineMGLLAYLGWVKKLWTMVVDIVKLIEQTIPDDGAGKEKLAAFDLLLKAAIEKADDIDEEFEKLQPVAHDIVRAVVT
Ga0209555_1004337433300025879MarineMSILTYLSWVRKLWTTVVEIVKLIEETIPDDGAGKQKLAAFDVMLKSALEKADDIDESFDKLQPVAHDIVNAVVTLFNATGLFKRAE
Ga0209953_1000355163300026097Pond WaterMNIFTYLSWVKKLWTMVVDIVKLIEETIPDDGAGKEKLAAFDIMLKAAIEKADDVDESFDKLQPVAHDIVSAVVTLFNATGLFKRSE
Ga0209037_113425813300027612MarineLGWVKRLWSMVVEIVKLIEETIPDDGAGKEKLAAFDVMLKAAIAKADDIDAEFDKLQPVAHDIVSSVITLFNTVGIFKRS
Ga0209271_1044563313300027845Marine SedimentMNLWTYLTWVKRLWTMVADIVRLIEETIPDDGAGNAKLAAFDVLLKAAIEKADDIDESFEKLQPVAHDIVGAVVSLYN
Ga0228674_111509913300028008SeawaterMNIFTYLSWVKKLWTTVVEIVKLIEETIPDDGAGKEKLAAFDLMLKSALEKADDIDESFDKLQPVAHDIVGAVVTLFNATGLFKRAE
Ga0256368_101149433300028125Sea-Ice BrineMVVEIVKLIEETIPDDGAGKEKLVAFDIMLKAALDKADDIDESFDKLQPVAHDIVKAVVTLFNATSIFKKKV
Ga0256368_101953633300028125Sea-Ice BrineMSLFQYLSYMRKLWSTVVEIVKLIEETIPDDGAGKEKLIAFDIMLKAALEKADDIDESFDKLQPVAHDIVAAIVTLFNTVGLFKRS
Ga0256368_106706913300028125Sea-Ice BrineVEIVKLIEETIPDDGAGKEKLAAFDLMLKGAIEKADDIDAEFDKLQPVAHDIVNVVVALFNKTGLFKKS
Ga0257126_103197133300028287MarineMGLLAYLGWVKKLWTMVVDIVKLIEQTIPDDGAGKEKLAAFDLLLKAAIEKADDIDEEFEKLQPVAHDIVRAVVTLFNATGMFKKK
Ga0307488_1000259943300031519Sackhole BrineMGLLAYLGWVKKLWSMVVDIVKLIEETIPDDGAGQEKLVAFDLLLKAAIEKADDIDEDFDKLQPVAHDIVRAVVTLFNATGLFKKK
Ga0307488_1013405813300031519Sackhole BrineMSLFEYLGWVKRLWSMVVEIVKLIEETIPDDGAGKEKLAAFDLMLKGAIEKADDIDAEFDKLQPVAHDIVNVVVALFNKTGLFKKS
Ga0307488_1037593223300031519Sackhole BrineMSLFQYLSYMRKLWSMVVEIVKLIEETIPDDGAGKEKLLAFDIMLKAALEKADDIDESIKFESLQPVAHDIVKAVVTLFNATSVFKK
Ga0307488_1058996313300031519Sackhole BrineMNIFTYLSWVKKLWVMVVDIVKLIEETIPDDGAGKEKLIAFDILLKAAIEKADDIDEEFDKLQPVAHDIVRAVIA
Ga0307380_1120606723300031539SoilMSLFQYLSWMRRLWAMVVEIVKLIEETIPDDGAGKEKLLAFDIMLKAALEKADDIDESFDKLQPVAHDIVAAVVTLFNATSLFKKKV
Ga0307985_1007693023300031629MarineMSLLQYLRWIRRLWSMVVEIVKLIEETIPDDGAGKEKLMAFDIMLKAALEKADDIDESFDKLQPVAHDIVGAVVTLFNATSLFKKKSVEASIEK
Ga0307984_105565723300031658MarineMSLFEYLGWMRRLWSMVVEIVKLIEETIPDDGAGKEKLVAFDVMLKAAIEKADDIDASFDKLQPVAHDIVATVVTLFNTVGLFRRS
Ga0307984_120758923300031658MarineHFINCGVQIMNILTYLSWVKKLWTMVVDIVKLIEETIPDDGAGKEKLVAFDIMLKAAIEKADDIDESFDKLQPVAHDIVAAVVTLFHATGLFNRGK
Ga0307375_1051403013300031669SoilVEIVKLIEETIPDDGAGKEKLAAFDIMLKAALDKADDIDESFDKLQPVAHDIVAAVVTLFNATGLFRKS
Ga0348335_118538_547_7893300034374AqueousMSLFEYLGWVKRLWSMVVEIVKLIEETIPDDGAGKEKLMAFDIMLKAAIEKADDIDAEFDKLQPVAHDIVSSVVTLFNTVG
Ga0348336_213414_241_4593300034375AqueousMVVDIVKLIEETIPDDGAGKEKLAAFDVMLKAAIEKADDIDESFDKLQPVAHDIVAAVVTLFNATGLFRRSK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.