NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045613

Metagenome / Metatranscriptome Family F045613

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045613
Family Type Metagenome / Metatranscriptome
Number of Sequences 152
Average Sequence Length 44 residues
Representative Sequence TMSTTSFRKIPDISSERLWLADAARTGLAAGLGLLGIGAPSRL
Number of Associated Samples 136
Number of Associated Scaffolds 152

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.66 %
% of genes near scaffold ends (potentially truncated) 96.71 %
% of genes from short scaffolds (< 2000 bps) 91.45 %
Associated GOLD sequencing projects 134
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.079 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(30.921 % of family members)
Environment Ontology (ENVO) Unclassified
(26.974 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(40.789 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.17%    β-sheet: 0.00%    Coil/Unstructured: 71.83%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 152 Family Scaffolds
PF02784Orn_Arg_deC_N 88.16
PF03447NAD_binding_3 3.95
PF00291PALP 1.32
PF13671AAA_33 0.66
PF00213OSCP 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 152 Family Scaffolds
COG0019Diaminopimelate decarboxylaseAmino acid transport and metabolism [E] 88.16
COG1166Arginine decarboxylase (spermidine biosynthesis)Amino acid transport and metabolism [E] 88.16
COG0712FoF1-type ATP synthase, delta subunitEnergy production and conversion [C] 0.66


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.08 %
UnclassifiedrootN/A5.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005367|Ga0070667_100253617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1573Open in IMG/M
3300005436|Ga0070713_102190803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia535Open in IMG/M
3300005436|Ga0070713_102438986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia506Open in IMG/M
3300005537|Ga0070730_10992064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae524Open in IMG/M
3300005542|Ga0070732_10123782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1533Open in IMG/M
3300005549|Ga0070704_100021641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales4173Open in IMG/M
3300005764|Ga0066903_106985695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia585Open in IMG/M
3300005993|Ga0080027_10289247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia650Open in IMG/M
3300006028|Ga0070717_11645099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia581Open in IMG/M
3300006804|Ga0079221_11499027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia541Open in IMG/M
3300006854|Ga0075425_101492636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia763Open in IMG/M
3300006871|Ga0075434_101195100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia772Open in IMG/M
3300006904|Ga0075424_102461948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300009143|Ga0099792_10931418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia577Open in IMG/M
3300009162|Ga0075423_13133154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia507Open in IMG/M
3300009520|Ga0116214_1060647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1375Open in IMG/M
3300009522|Ga0116218_1317028Not Available697Open in IMG/M
3300009525|Ga0116220_10280539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia731Open in IMG/M
3300009698|Ga0116216_10455013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia775Open in IMG/M
3300009792|Ga0126374_10211942Not Available1235Open in IMG/M
3300010341|Ga0074045_10344587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis972Open in IMG/M
3300010343|Ga0074044_10366195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis945Open in IMG/M
3300010360|Ga0126372_11954846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia632Open in IMG/M
3300010362|Ga0126377_12553058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia586Open in IMG/M
3300010371|Ga0134125_12113510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia612Open in IMG/M
3300010379|Ga0136449_104064978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300010396|Ga0134126_12248566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia595Open in IMG/M
3300010867|Ga0126347_1160563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia571Open in IMG/M
3300010880|Ga0126350_11991699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia963Open in IMG/M
3300011087|Ga0138570_1154014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia722Open in IMG/M
3300012096|Ga0137389_10929884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria746Open in IMG/M
3300012201|Ga0137365_11302698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia515Open in IMG/M
3300012207|Ga0137381_10382301Not Available1228Open in IMG/M
3300012210|Ga0137378_11552153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia572Open in IMG/M
3300012351|Ga0137386_11257387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia515Open in IMG/M
3300012357|Ga0137384_10249023Not Available1482Open in IMG/M
3300012357|Ga0137384_10713553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia814Open in IMG/M
3300013307|Ga0157372_12740922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300014166|Ga0134079_10551441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300014200|Ga0181526_10948801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia541Open in IMG/M
3300014499|Ga0182012_10938045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300014968|Ga0157379_12172481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia551Open in IMG/M
3300015371|Ga0132258_13604819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1058Open in IMG/M
3300015373|Ga0132257_103347741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia583Open in IMG/M
3300016294|Ga0182041_12240455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia511Open in IMG/M
3300016750|Ga0181505_10980422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia796Open in IMG/M
3300017932|Ga0187814_10021415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2434Open in IMG/M
3300017942|Ga0187808_10126624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1119Open in IMG/M
3300017946|Ga0187879_10207441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1098Open in IMG/M
3300017948|Ga0187847_10063709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2071Open in IMG/M
3300017970|Ga0187783_11016153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia597Open in IMG/M
3300017973|Ga0187780_10562212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia817Open in IMG/M
3300017973|Ga0187780_11027529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia601Open in IMG/M
3300017975|Ga0187782_10239855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1361Open in IMG/M
3300018001|Ga0187815_10444176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia554Open in IMG/M
3300018007|Ga0187805_10623962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300018058|Ga0187766_10860342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia637Open in IMG/M
3300018085|Ga0187772_10373921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis988Open in IMG/M
3300018085|Ga0187772_10607574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia778Open in IMG/M
3300018482|Ga0066669_11833793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia562Open in IMG/M
3300019787|Ga0182031_1053581Not Available1345Open in IMG/M
3300019877|Ga0193722_1116658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300020581|Ga0210399_10521685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia986Open in IMG/M
3300021401|Ga0210393_10665710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia849Open in IMG/M
3300021406|Ga0210386_10414643Not Available1161Open in IMG/M
3300021477|Ga0210398_10113029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2205Open in IMG/M
3300021477|Ga0210398_11010763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia663Open in IMG/M
3300021478|Ga0210402_11238142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia673Open in IMG/M
3300021479|Ga0210410_10643330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales939Open in IMG/M
3300021560|Ga0126371_12721740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia600Open in IMG/M
3300022724|Ga0242665_10318596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia549Open in IMG/M
3300025910|Ga0207684_10129029Not Available2170Open in IMG/M
3300025929|Ga0207664_11414808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia616Open in IMG/M
3300025972|Ga0207668_11181056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia687Open in IMG/M
3300026318|Ga0209471_1145784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia984Open in IMG/M
3300026369|Ga0257152_1036750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia531Open in IMG/M
3300027652|Ga0209007_1169265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia539Open in IMG/M
3300027853|Ga0209274_10324240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia792Open in IMG/M
3300027875|Ga0209283_10975431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia507Open in IMG/M
3300028742|Ga0302220_10160475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia853Open in IMG/M
3300028773|Ga0302234_10026856Not Available2702Open in IMG/M
3300029636|Ga0222749_10663672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia571Open in IMG/M
3300029943|Ga0311340_11165431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia622Open in IMG/M
3300029999|Ga0311339_11372364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia636Open in IMG/M
3300030490|Ga0302184_10052902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1971Open in IMG/M
3300030503|Ga0311370_10357530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1857Open in IMG/M
3300030509|Ga0302183_10294837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia627Open in IMG/M
3300030580|Ga0311355_10148559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2522Open in IMG/M
3300030617|Ga0311356_10069923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3716Open in IMG/M
3300030707|Ga0310038_10118685Not Available1355Open in IMG/M
3300030906|Ga0302314_10785476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia955Open in IMG/M
3300031027|Ga0302308_10791631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia529Open in IMG/M
3300031236|Ga0302324_101431694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia902Open in IMG/M
3300031469|Ga0170819_11975754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia651Open in IMG/M
3300031525|Ga0302326_12302514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia683Open in IMG/M
3300031544|Ga0318534_10776798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia539Open in IMG/M
3300031544|Ga0318534_10843858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia514Open in IMG/M
3300031573|Ga0310915_10663114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia737Open in IMG/M
3300031640|Ga0318555_10048109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2154Open in IMG/M
3300031680|Ga0318574_10542981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia681Open in IMG/M
3300031708|Ga0310686_116033817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis913Open in IMG/M
3300031713|Ga0318496_10327141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia846Open in IMG/M
3300031719|Ga0306917_10938814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia676Open in IMG/M
3300031751|Ga0318494_10640283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia622Open in IMG/M
3300031765|Ga0318554_10194033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1155Open in IMG/M
3300031765|Ga0318554_10508879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia681Open in IMG/M
3300031768|Ga0318509_10070054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1838Open in IMG/M
3300031770|Ga0318521_10648028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia640Open in IMG/M
3300031770|Ga0318521_10825282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300031770|Ga0318521_10901814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia540Open in IMG/M
3300031797|Ga0318550_10625933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia516Open in IMG/M
3300031831|Ga0318564_10139172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1081Open in IMG/M
3300031835|Ga0318517_10354843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia662Open in IMG/M
3300031845|Ga0318511_10047525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1709Open in IMG/M
3300031846|Ga0318512_10418478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia674Open in IMG/M
3300031846|Ga0318512_10530771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia598Open in IMG/M
3300031859|Ga0318527_10349367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia630Open in IMG/M
3300031859|Ga0318527_10387922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia595Open in IMG/M
3300031879|Ga0306919_10958376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia655Open in IMG/M
3300031894|Ga0318522_10404058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia518Open in IMG/M
3300031941|Ga0310912_11314911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia548Open in IMG/M
3300031959|Ga0318530_10110494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1099Open in IMG/M
3300032009|Ga0318563_10796182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia506Open in IMG/M
3300032035|Ga0310911_10407302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia787Open in IMG/M
3300032039|Ga0318559_10609239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300032043|Ga0318556_10042155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2176Open in IMG/M
3300032052|Ga0318506_10039904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1850Open in IMG/M
3300032054|Ga0318570_10191904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia921Open in IMG/M
3300032065|Ga0318513_10031108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2306Open in IMG/M
3300032065|Ga0318513_10251119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia857Open in IMG/M
3300032067|Ga0318524_10169279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1110Open in IMG/M
3300032067|Ga0318524_10271352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia875Open in IMG/M
3300032160|Ga0311301_11428009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia860Open in IMG/M
3300032261|Ga0306920_100519868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1765Open in IMG/M
3300032770|Ga0335085_11069746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia866Open in IMG/M
3300032782|Ga0335082_11101879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia660Open in IMG/M
3300032783|Ga0335079_11427719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia686Open in IMG/M
3300032805|Ga0335078_11096505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia931Open in IMG/M
3300032805|Ga0335078_11446573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia772Open in IMG/M
3300032829|Ga0335070_11003178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia770Open in IMG/M
3300032892|Ga0335081_11251913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia841Open in IMG/M
3300032892|Ga0335081_11363181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis795Open in IMG/M
3300032895|Ga0335074_10002180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia26697Open in IMG/M
3300032898|Ga0335072_10924164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia813Open in IMG/M
3300033134|Ga0335073_10087905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales4043Open in IMG/M
3300033289|Ga0310914_11719023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia531Open in IMG/M
3300033289|Ga0310914_11819870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia513Open in IMG/M
3300033290|Ga0318519_11066076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia503Open in IMG/M
3300033433|Ga0326726_10863725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia877Open in IMG/M
3300033818|Ga0334804_061208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1056Open in IMG/M
3300034124|Ga0370483_0258261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia597Open in IMG/M
3300034163|Ga0370515_0221792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia803Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil30.92%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.55%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil7.24%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.92%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.26%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.61%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.29%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.63%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.63%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.32%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.32%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.32%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.32%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.32%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.32%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.32%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.32%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.66%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.66%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.66%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.66%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.66%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.66%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.66%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.66%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.66%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.66%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.66%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011087Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026369Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-AEnvironmentalOpen in IMG/M
3300027652Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070667_10025361713300005367Switchgrass RhizosphereTIDTMSTSSFRKIPDISSERLWLADAARTGLAAGLGLVGIDAPPRL*
Ga0070713_10219080323300005436Corn, Switchgrass And Miscanthus RhizosphereSSFRKIPDISSERLWLADAARTGLAAGLGLLGIDAPTRL*
Ga0070713_10243898623300005436Corn, Switchgrass And Miscanthus RhizosphereMSTTGFTKIADISSERLWLADAAQTGLAAGLGLLGIGAPGRL*
Ga0070730_1099206423300005537Surface SoilLATKTIDTMSTTGFTTGPAVSPERLWLARAARTGLAASLGLLGITAPDRI*
Ga0070732_1012378213300005542Surface SoilDTMSTSGFTNVSAISSERLWLAAAARTGLAASLGLLGIGAPERL*
Ga0070704_10002164113300005549Corn, Switchgrass And Miscanthus RhizosphereMSTSSFRKIPDISSERLWLADAARTGLAAGLGLLGIDAPPRL*
Ga0066903_10698569513300005764Tropical Forest SoilSTTSFRKIPDISSERLWLADAARTGLAAGLGLLGIAAPPRL*
Ga0080027_1028924723300005993Prmafrost SoilKVADISSERLWLADAARTGLAAGLGLLGIGAPDRL*
Ga0070717_1164509913300006028Corn, Switchgrass And Miscanthus RhizosphereMSTSSFRKIPDISSERLWLADAARTGLAAGLGLLGIDAPTRL*
Ga0079221_1149902713300006804Agricultural SoilRTIDTMSTTSFTKIADIGSERLWLADAARTGLAAGLGLLGIGAPGRL*
Ga0075425_10149263623300006854Populus RhizosphereFRKIPDISSERLWLADAARTGLAAGLGLLGIDAPPRL*
Ga0075434_10119510013300006871Populus RhizosphereKIPDISSERLWLADAARTGLAAGLGLLGIDAPPRL*
Ga0075424_10246194813300006904Populus RhizosphereMSTSSFRKIPDISSERLWLADAARTGLAAGLGLLGIDAPARL*
Ga0099792_1093141823300009143Vadose Zone SoilSFRKIPDISSERLWLADAARTGLAAGLGLLGIDAPPRL*
Ga0075423_1313315413300009162Populus RhizosphereTTSFRTVPDIRSERLWLADAARTGLAAGLGLLGIDAPSRL*
Ga0116214_106064723300009520Peatlands SoilIETMSTTSFTTVSSISSERLWLADAAQTGLAAGLGLLGIGAPSRL*
Ga0116218_131702813300009522Peatlands SoilLEELAARTIETMSTTSFTTVSSISSERLWLADAARTGLAAGLGLLGIGASSRL*
Ga0116220_1028053913300009525Peatlands SoilNVSTISSERLWLAAAARTGLAASLGLLGIGAPERL*
Ga0116216_1045501313300009698Peatlands SoilISSISSERLWLADAVRTGLAASLELLGIGAPGRL*
Ga0126374_1021194213300009792Tropical Forest SoilTSFRKIPDISSERLWLADAARTGLAAGLGLLGIAAPPRL*
Ga0074045_1034458713300010341Bog Forest SoilRTIETMSTTSFTTVSSISSERLWLADAARTGLAAGLGLLGIGAPSRL*
Ga0074044_1036619523300010343Bog Forest SoilMSTTSFTTISSISSERLWLADAARTGLAASLGLLEIGAPGRL*
Ga0126372_1195484613300010360Tropical Forest SoilTSFRTVPDISSERLWLADAARTGLAAGLGLLGIDAPGRL*
Ga0126377_1255305823300010362Tropical Forest SoilYLAELAARTIDTMSTTSFTKIADIGSEQLWLADAARTGLAAGLGLLGIGAPGRL*
Ga0134125_1211351023300010371Terrestrial SoilSTSSFRKIPDISSERLWLADAARTGLAAGLGLLGIDAPPRL*
Ga0136449_10406497813300010379Peatlands SoilTSGFTNVSAISSERLWLAAAARTGLAASLGLLGIGAPERL*
Ga0134126_1224856613300010396Terrestrial SoilRTIDTMSTSSFRKIQDISSERLWLADAARTGLAAALGLLGIDAPPRL*
Ga0126347_116056313300010867Boreal Forest SoilTMSTTSFTKVADISSERLWLADAARTGLAAGLNLLGVGAPDRL*
Ga0126350_1199169913300010880Boreal Forest SoilSTASISTERLWLADAARTGLSAGLGLLGVSAPDRL*
Ga0138570_115401423300011087Peatlands SoilTVPSISSERLWLADAARTGLAASLELLGIGAPGRL*
Ga0137389_1092988423300012096Vadose Zone SoilMSTTGFTTISSISSERLWLADAARTGLAAGLGLLGIGAPSRM*
Ga0137365_1130269813300012201Vadose Zone SoilKIPDISSERLWLADAARTGLAAGLGLLGIDAPSRL*
Ga0137381_1038230113300012207Vadose Zone SoilAELAARTIDTMSTSSFRKIPDISSERLWLADAARTGLAAGLGLLGIDAPARL*
Ga0137378_1155215323300012210Vadose Zone SoilLAACTIDTMSTSSFRKIPDISSERLWLADAARTGLAAGLGLLGIDAPSRL*
Ga0137386_1125738723300012351Vadose Zone SoilDTMSTTSFTKIADISSERLWLADAARTGLAAGLGLLGIGAPSRM*
Ga0137384_1024902323300012357Vadose Zone SoilTIEVMSTSSFRKIPDISSERLWLADAARTGLAAGLGLLGIDAPPRL*
Ga0137384_1071355313300012357Vadose Zone SoilACTIEVMSTSSFRKIPDISSERLWLADAARTGLAAGLGLLGIDAPPRL*
Ga0157372_1274092213300013307Corn RhizosphereIDTMSTSSFRKIPDISSERLWLADAARTGLAAGLGLLGIEAPSRL*
Ga0134079_1055144123300014166Grasslands SoilGFTKIADISSERLWLADAARTGLAAGLGLLGIDAPGRL*
Ga0181526_1094880113300014200BogGFTRISTISSERLWLADAARTGLGAGLGLLGVSAPGRL*
Ga0182012_1093804523300014499BogGYLEELAARTIEIMNTTGFTTISSISSERLWLADAARTGLAAGLGLLGVGAPARL*
Ga0157379_1217248113300014968Switchgrass RhizosphereIDTMSTTSFTKIADIGSERLWLADAARTGLAAGLGLLGIDAPGRL*
Ga0132258_1360481923300015371Arabidopsis RhizosphereAELAARTIDTMSTSSFRKIPDISSERLWLADAARTGLAAGLGLLGIDAPPRL*
Ga0132257_10334774113300015373Arabidopsis RhizosphereKIPDISSERLWLADAARTGLAAGLGLLGIAAPPRL*
Ga0182041_1224045523300016294SoilRKIPDISSERLWLADAARTGLAAGLGLLGIAAPNRL
Ga0181505_1098042213300016750PeatlandTTSFTTVSSISSERLWLADAARAGLAAGLGLLGIDAPSRL
Ga0187814_1002141513300017932Freshwater SedimentARTIDTMSTTGFTTISSISSERLWLADAARIGLAAGLGLLGVDAPERI
Ga0187808_1012662423300017942Freshwater SedimentYLEELAARTIDTMSTTGFRKVASIGSERLWLAAAARAGLAASLGLLEVGAPDRL
Ga0187879_1020744123300017946PeatlandELAARTIETMDTTGFTKISSISSERLWLADAARTALAAGLGLLGVGAPGRL
Ga0187847_1006370913300017948PeatlandTRTIDTMNTTGFTTISSISSERLWLADAAQTALAIGLGLLGVGAPGRL
Ga0187783_1101615323300017970Tropical PeatlandEELAARTIDTMSTTGFTTISRISSERLWLADAARTGLAAGLGLLGVGAPRRL
Ga0187780_1056221213300017973Tropical PeatlandTIDTMSTTSFTKIPDISSERLWLADAARTGLAAGLGLLGIGAPNRL
Ga0187780_1102752923300017973Tropical PeatlandFAGYVEGLAARTTETMSTTCFTTLASISSERLWLADAARTGLAVGLGLLGIAAPGRL
Ga0187782_1023985523300017975Tropical PeatlandRPDEFAGYVEGLAARTIDTMSTTGFRKVASIGSERLWLAAAARAGLAASLGLLEVRAPDR
Ga0187815_1044417623300018001Freshwater SedimentPDEFAGYVEGLAARTIDTMSTTGFRKVASIGSERLWLAAAARAGLAASLGLLEVGAPDRL
Ga0187805_1062396223300018007Freshwater SedimentAGYLEELAARTIDTMSTTGFTMISSISSERLWLAAAARTGLAVSLGLLGVSTPDRM
Ga0187766_1086034213300018058Tropical PeatlandRTIDTMSTTGFTTIPNISSERLWLADAARTALAVGLGLLGVGAPERI
Ga0187772_1037392113300018085Tropical PeatlandTDTMSTTGFTTIPNISSERLWLAAAARTGLAAGLGLLGIDAPSRL
Ga0187772_1060757423300018085Tropical PeatlandGYVEGLAARTIDTMSTTGFRKVASIGSERLWLAAAARAGLAASLGLLEVGAPDRL
Ga0066669_1183379313300018482Grasslands SoilSTSSFRKIPDISSERLWLADAARTGLAAGLGLLGIDAPTRL
Ga0182031_105358113300019787BogEFAGYLEELAARTFDTMNTTGFTTISSISSERLWLADAARTGLAAGLGLLGVGAPARL
Ga0193722_111665823300019877SoilMSTSSFRKIPDISSERLWLADAARTGLAAGLGLLGIDAPPRL
Ga0210399_1052168513300020581SoilRKIPDINSERLWLADAARTGLAAGLGLLGIDAPTRL
Ga0210393_1066571013300021401SoilEELAARTIETMSTTSFTTISSISSERLWLADAARTGLAAGLGLLEIGAPGRL
Ga0210386_1041464313300021406SoilSFTALSTISSERLWLADAARTGLAAGLGLLEVSAPDRL
Ga0210398_1011302933300021477SoilFAGYLEELAARTIETMSTTSFTTISSISSERLWLADAARTGLAAGLGLLEIGAPGRL
Ga0210398_1101076323300021477SoilNVAEISSERLWLAAAARVGLAVGLGLLGVSAPERL
Ga0210402_1123814213300021478SoilTIDTMSTTSFRKIPDISSERLWLADAARTGLAAGLGLLGIDAPSRL
Ga0210410_1064333023300021479SoilTTSFRKIPDISSERLWLADAARTGLAAALGLLGIDAPSRL
Ga0126371_1272174023300021560Tropical Forest SoilFRKIPDISSERLWLADAARTGLAAGLGLLGIAAPSRL
Ga0242665_1031859613300022724SoilKIPDISSERLWLADAARTGLAAGLGLLGIDAPTRL
Ga0207684_1012902913300025910Corn, Switchgrass And Miscanthus RhizosphereGYLAELAARTVDTMSTTSFTTISSISSERLWLADAARTGLAAGLGLLGIGAPSRL
Ga0207664_1141480823300025929Agricultural SoilMSTTSFTKIADISSERLWLADAARTGLAAGLGLLGIDAPGRL
Ga0207668_1118105623300025972Switchgrass RhizosphereRKIPDISSERLWLADAARTGLAAGLGLVGIDAPPRL
Ga0209471_114578423300026318SoilFRKIADISSERLWLADAARTGLAAGLGLLGIDAPSRL
Ga0257152_103675023300026369SoilRKIPDISSERLWLADAARTGLAAGLGLLGIDAPPRL
Ga0209007_116926523300027652Forest SoilDTMSTTGFTTISSITSERLWLAHAARTGLAAGLGLLGLDAPNRL
Ga0209274_1032424023300027853SoilAGYLEELAARTIDTMSTTGFTTISSITSERLWLAHAARTGLAAGLGLLGLDAPNRL
Ga0209283_1097543123300027875Vadose Zone SoilEVAGYLAELAARTIDTMSTTSFRKVPDISSERLWLADAARTGLAASLGLLGIGAPSRL
Ga0302220_1016047523300028742PalsaTGFTTISSISSERLWLADAARTALAAGLGLLGVGAPSRL
Ga0302234_1002685633300028773PalsaTTGFTTISSISSERLWLADAARTALAAGLGLLGVGAPSRL
Ga0222749_1066367213300029636SoilTIETMSTTSFRTVPDISSERLWLADAARTGLAAGLGLLGIDAPSRL
Ga0311340_1116543113300029943PalsaEELAARTIDTMNTTGFTTISSISSERLWLADAARTALAAGLGLLGVGAPSRL
Ga0311339_1137236413300029999PalsaLAARTIDTMNTTGFTTISSISSERLWLADAARTALAAGLGLLGVGAPSRL
Ga0302184_1005290213300030490PalsaFTTISSISSERLWLADAARTALATGLGLFGVGAPSRL
Ga0311370_1035753013300030503PalsaFVGYLEELAARTIDTMNTTGFTTISSISSERLWLADAARTALAAGLGLLGAGAPSRL
Ga0302183_1029483723300030509PalsaNTTGFTTISSISSERLWLADAARTALAAGLGLLGVGAPSRL
Ga0311355_1014855913300030580PalsaAARTIDTMSTTGFTTISSITSERLWLAHAARTGLAAGLGLLGLDAPNRL
Ga0311356_1006992313300030617PalsaDEFAGYLEELAARTIDTMNTTGFTTISSISSERLWLADAARTALATGLGLFGVGAPSRL
Ga0310038_1011868513300030707Peatlands SoilETMSMTSFTTVSSISSERLWLADAARTGLAASLELLGIGAPGRL
Ga0302314_1078547623300030906PalsaIDTMNTTGFTTISSISSERLWLADAARTALAAGLGLLGVGAPSRL
Ga0302308_1079163123300031027PalsaELAARTIDTMNTTGFTTISSISSERLWLADAARTALAAGLGLLGVGAPSRL
Ga0302324_10143169423300031236PalsaDTMDTTGFTAISTISSERLWLADAARTGLATGLGLLEVSAPGRL
Ga0170819_1197575413300031469Forest SoilSFRKIPDISSERLWLADAARTGLAAGLGLLGIDAPSRL
Ga0302326_1230251413300031525PalsaYLEELAARTIDTMNTTGFTTISSISSERLWLADAARTALAAGLGLLGVGAPSRL
Ga0318534_1077679813300031544SoilIDTMSTTSFRKIPDISSERLWLADAARTGLAAGLGLLGIGAPSRL
Ga0318534_1084385813300031544SoilTIDTMSTTSFRKIPDISSERLWLADAARTGLAAGLGLLGIAAPSRL
Ga0310915_1066311423300031573SoilRKIPDISSERLWLADAARTGLAAGLGLLGIAAPPRL
Ga0318555_1004810933300031640SoilAARTIDTMSTTGFTMIPTISSERLWLAAAARTGLAAGLGLLGVGAPERI
Ga0318574_1054298123300031680SoilRTIDTMSTTSFRKIPDISSERLWLADAARTGLAAGLGLLGITAPSRL
Ga0310686_11603381723300031708SoilARTIETMSTTSFTTVSSSSERLWLADAARTGLAAGLGLLGIGAPGRL
Ga0318496_1032714113300031713SoilSTTSFRKIPDISSERLWLADAARTGLAAGLGLLGIAAPSRL
Ga0306917_1093881413300031719SoilARTIGTMSTTRFRKIPDISSERLWLADAARTGLAAGLGLLGIAAPPRL
Ga0318494_1064028313300031751SoilELAARTAGTMSTSGYTHLSAISSERLWLAAAARTGLAASLGLLGIDAPERL
Ga0318554_1019403323300031765SoilIDTMSTTGFTMIPTISSERLWLAAAARTGLAAGLGLLGVGAPERI
Ga0318554_1050887923300031765SoilTIDTMSTTGFTTIPNIGSERLWLAAAARTGLAAGLGLLGIGAPERI
Ga0318509_1007005433300031768SoilTMSTTGFTMIPTISSERLWLAAAARTGLAAGLGLLGVGAPERI
Ga0318521_1064802813300031770SoilARTIDTMSTTGFTTIPNISSERLWLAAAARTGLAAGLGLLGIGAPERI
Ga0318521_1082528213300031770SoilARTIDTMSTTGFTMIPTISSERLWLAAAARTGLAAGLGLLGVGAPERI
Ga0318521_1090181413300031770SoilTIDTMSTTSFRKVPDISSERLWLADAARTGLAAGLGLLGIGAPIRL
Ga0318550_1062593313300031797SoilRTIDTMSTTGFTMIPTISSERLWLAAAARTGLAAGLGLLGVGAPERI
Ga0318564_1013917223300031831SoilSTTSFRKIPDISSERLWLADAARTGLAAGLGLLGIAAPNRL
Ga0318517_1035484323300031835SoilGYLAELAARTIDTMSTTSFRKIPDISSERLWLADAARTGLAASLGLLGISAPDRL
Ga0318511_1004752513300031845SoilSARTIDTMSTTSFRKIPDISSERLWLADAARTGLAAGLGLLGIAAPNRL
Ga0318512_1041847813300031846SoilTIPNISSERLWLAAAARTGLAAGLGLLGIGAPERI
Ga0318512_1053077113300031846SoilTMSTTSFRKIPDISSERLWLADAARTGLAAGLGLLGIGAPSRL
Ga0318527_1034936723300031859SoilGFRKVPSSSERLWLADAARTGLAASLGLLGISAPDRL
Ga0318527_1038792213300031859SoilTTGFTMIPTISSERLWLAAAARTGLAAGLGLLGVGAPERI
Ga0306919_1095837623300031879SoilYLAELAARTIDTMSTTSFRKIPDISSERLWLADAARTGLAAGLGLLGIGAPSRL
Ga0318522_1040405813300031894SoilIDTMSTTSFRKIPDISSERLWLADAARTGLAAGLGLLGIAAPNRL
Ga0310912_1131491123300031941SoilMSTTSFRKIPDISSERLWLADAARTGLAAGLGLLGIAAPPRL
Ga0318530_1011049413300031959SoilPGELAARTIDTMSTTSFRKIPDISSERLWLADAARTGLAAGLGLLGIAAPNRL
Ga0318563_1079618223300032009SoilARTIDTMSTTGFTTIPNIGSERLWLAAAARTGLAAGLGLLGIGAPERI
Ga0310911_1040730223300032035SoilMSTTRFRKIPDISSERLWLADAARTGLAAGLGLLGIAAPPRL
Ga0318559_1060923913300032039SoilKVASISSERLWLAAAARAGLAASLGLLEVGAPDRL
Ga0318556_1004215533300032043SoilLEELAARTIDTMSTTGFTMIPTISSERLWLAAAARTGLAAGLGLLGIGAPERI
Ga0318506_1003990413300032052SoilTIDTMSTTGFRKVPSSSERLWLADAARVGLAASLGLLEVSAPDRL
Ga0318570_1019190423300032054SoilYLAELAARTIGTMSTTRFRKIPDISSERLWLADAARTGLAAGLGLLGIAAPPRL
Ga0318513_1003110833300032065SoilYLEELAARTIDTMSTTGFTTIPNISSERLWLAAAARTGLAAGLGLLGVGAPERI
Ga0318513_1025111913300032065SoilDTMSTTSFTKIPDISSERLWLADAARTGLAAGLGLLGIDAPNRL
Ga0318524_1016927923300032067SoilTMETMSTTGFRKVPSSSERLWLADAARTGLAASLGLLGISAPDRL
Ga0318524_1027135213300032067SoilMDTMSTTGFTTIPNISSERLWLAAAARTGLAAGLGLLGIGAPERI
Ga0311301_1142800923300032160Peatlands SoilTMSTSGFTNVSVISSERLWLAAAARTGLAASLGLLGIGAPERL
Ga0306920_10051986813300032261SoilSTTGFTTIPNISSERLWLAAAARTGLAAGLGLLGVGAPERI
Ga0335085_1106974623300032770SoilFRKIPDISSERLWLADAARTGLAAGLGLLGIAAPNRL
Ga0335082_1110187913300032782SoilSTTSFRTVPNISSERLWLADAARTGLAAGLGLLGIGAPSRL
Ga0335079_1142771913300032783SoilTTGFTTIPNISSERLWLADAARTALAAGLGLLGVGAPERT
Ga0335078_1109650513300032805SoilTIDTMSTTSFRKIPDISSERLWLADAARTGLAAGLGLLGIAAPNRL
Ga0335078_1144657313300032805SoilRTLDTMSTTSFTKIPDISSERLWLADAARTGLAAGLGLLGIAAPSRL
Ga0335070_1100317813300032829SoilFTKIADIGSERLWLADAARTGLAAGLGLLGIGAPDRL
Ga0335081_1125191323300032892SoilTTGFTTIPSISSERLWLADAARTGLAAGLGLLGIDAPSRL
Ga0335081_1136318123300032892SoilSFTKVPDISSERLWLADAARTGLAAGLGLLGIAAPSRL
Ga0335074_10002180273300032895SoilEELDARTLDTMSTSGFTHMSAISSERLWLAAAARTGLAASLGLLGIGAPERL
Ga0335072_1092416423300032898SoilKIPDISSERLWLADAARTGLAAGLGLLGIAAPPRL
Ga0335073_1008790513300033134SoilTSFTKIPDISSERLWLADAARTGLAAGLGLLGIGAPSRL
Ga0310914_1171902313300033289SoilAARTIDTMSTTGFTMIPTISSERLWLAAAARTGLAAGLGLLGIGAPERI
Ga0310914_1181987013300033289SoilDTMSTTGFTMISSISSERLWLAAAARTGLAAGLGLLGVGAPERI
Ga0318519_1106607623300033290SoilGTMSTTRFRKIPDISSERLWLADAARTGLAAGLGLLGIAAPPRL
Ga0326726_1086372513300033433Peat SoilELAACTIDTMSTSNFRKIPDISSERLWLADAARTGLAAGLGLLGIDAPPRL
Ga0334804_061208_907_10353300033818SoilMNTTCFTTISSISSERLWLADAARTGLAAGLGLLGVGAPARL
Ga0370483_0258261_9_1373300034124Untreated Peat SoilMDTTGFTTISSISSERLWLADAARTALAAGLGLLGISAPGRL
Ga0370515_0221792_690_8033300034163Untreated Peat SoilFTTISSISSERLWLADAARTALAAGLGLLGVGAPGRL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.