NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045411

Metagenome / Metatranscriptome Family F045411

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045411
Family Type Metagenome / Metatranscriptome
Number of Sequences 153
Average Sequence Length 45 residues
Representative Sequence VSSWTPQRVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPTF
Number of Associated Samples 135
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.34 %
% of genes near scaffold ends (potentially truncated) 99.35 %
% of genes from short scaffolds (< 2000 bps) 94.12 %
Associated GOLD sequencing projects 130
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (52.288 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(24.183 % of family members)
Environment Ontology (ENVO) Unclassified
(20.261 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.176 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.70%    β-sheet: 10.96%    Coil/Unstructured: 75.34%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 153 Family Scaffolds
PF00753Lactamase_B 10.46
PF01663Phosphodiest 4.58
PF00580UvrD-helicase 2.61
PF07690MFS_1 2.61
PF11298DUF3099 2.61
PF13673Acetyltransf_10 1.31
PF04672Methyltransf_19 1.31
PF13191AAA_16 0.65
PF00456Transketolase_N 0.65
PF00581Rhodanese 0.65
PF00583Acetyltransf_1 0.65
PF10722YbjN 0.65
PF00903Glyoxalase 0.65
PF07836DmpG_comm 0.65
PF13305TetR_C_33 0.65
PF09900DUF2127 0.65
PF00378ECH_1 0.65
PF12679ABC2_membrane_2 0.65
PF13380CoA_binding_2 0.65
PF09290AcetDehyd-dimer 0.65
PF00291PALP 0.65
PF12697Abhydrolase_6 0.65
PF00857Isochorismatase 0.65
PF07714PK_Tyr_Ser-Thr 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 153 Family Scaffolds
COG0210Superfamily I DNA or RNA helicaseReplication, recombination and repair [L] 2.61
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.61
COG10743’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 2.61
COG3973DNA helicase IVReplication, recombination and repair [L] 2.61
COG0021TransketolaseCarbohydrate transport and metabolism [G] 0.65
COG0119Isopropylmalate/homocitrate/citramalate synthasesAmino acid transport and metabolism [E] 0.65
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.65
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.65
COG3959Transketolase, N-terminal subunitCarbohydrate transport and metabolism [G] 0.65
COG4569Acetaldehyde dehydrogenase (acetylating)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms52.29 %
UnclassifiedrootN/A47.71 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q01AKMF6Not Available555Open in IMG/M
2170459024|GZRSKLJ01E2WVZNot Available526Open in IMG/M
3300004092|Ga0062389_103210908Not Available612Open in IMG/M
3300005434|Ga0070709_10168806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1527Open in IMG/M
3300005435|Ga0070714_101154046Not Available755Open in IMG/M
3300005435|Ga0070714_101752136Not Available607Open in IMG/M
3300005435|Ga0070714_101837657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae591Open in IMG/M
3300005435|Ga0070714_102488749Not Available502Open in IMG/M
3300005436|Ga0070713_100727564Not Available948Open in IMG/M
3300005436|Ga0070713_101171952Not Available743Open in IMG/M
3300005436|Ga0070713_101418883Not Available673Open in IMG/M
3300005439|Ga0070711_100960622Not Available732Open in IMG/M
3300005456|Ga0070678_101396621Not Available654Open in IMG/M
3300005471|Ga0070698_101500036Not Available625Open in IMG/M
3300005529|Ga0070741_10075955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3737Open in IMG/M
3300005534|Ga0070735_10857707Not Available534Open in IMG/M
3300005556|Ga0066707_11033482Not Available500Open in IMG/M
3300005564|Ga0070664_101679709Not Available602Open in IMG/M
3300005843|Ga0068860_100345934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae1462Open in IMG/M
3300006028|Ga0070717_10596912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1001Open in IMG/M
3300006032|Ga0066696_10828275Not Available590Open in IMG/M
3300006050|Ga0075028_100766133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria586Open in IMG/M
3300006086|Ga0075019_10611829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia684Open in IMG/M
3300006163|Ga0070715_10156636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1121Open in IMG/M
3300006175|Ga0070712_101669860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria557Open in IMG/M
3300006578|Ga0074059_12149980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales1101Open in IMG/M
3300006800|Ga0066660_11562329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia521Open in IMG/M
3300006804|Ga0079221_11487163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria543Open in IMG/M
3300006854|Ga0075425_101202036Not Available861Open in IMG/M
3300006953|Ga0074063_14166469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales776Open in IMG/M
3300009012|Ga0066710_102249450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales794Open in IMG/M
3300009098|Ga0105245_10841097Not Available957Open in IMG/M
3300009137|Ga0066709_101038841All Organisms → cellular organisms → Bacteria1202Open in IMG/M
3300009698|Ga0116216_10133794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1525Open in IMG/M
3300009700|Ga0116217_10038582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3562Open in IMG/M
3300010343|Ga0074044_10993970Not Available550Open in IMG/M
3300010343|Ga0074044_11052800Not Available533Open in IMG/M
3300010360|Ga0126372_11074969Not Available821Open in IMG/M
3300010868|Ga0124844_1104853All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300010876|Ga0126361_10645031All Organisms → cellular organisms → Bacteria → Terrabacteria group807Open in IMG/M
3300012356|Ga0137371_10599460Not Available846Open in IMG/M
3300012361|Ga0137360_11449781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia590Open in IMG/M
3300012498|Ga0157345_1018447Not Available689Open in IMG/M
3300012988|Ga0164306_10765679Not Available774Open in IMG/M
3300013105|Ga0157369_12190923Not Available560Open in IMG/M
3300013297|Ga0157378_11825651Not Available656Open in IMG/M
3300013307|Ga0157372_11652549Not Available737Open in IMG/M
3300013308|Ga0157375_12071003Not Available677Open in IMG/M
3300015357|Ga0134072_10130487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia806Open in IMG/M
3300015374|Ga0132255_101318072Not Available1089Open in IMG/M
3300016341|Ga0182035_12050370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura verrucosospora520Open in IMG/M
3300017821|Ga0187812_1163414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia715Open in IMG/M
3300017924|Ga0187820_1149960Not Available701Open in IMG/M
3300017928|Ga0187806_1115330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia867Open in IMG/M
3300017932|Ga0187814_10193462Not Available764Open in IMG/M
3300017932|Ga0187814_10220431Not Available715Open in IMG/M
3300017942|Ga0187808_10234552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia819Open in IMG/M
3300017943|Ga0187819_10619398Not Available613Open in IMG/M
3300017959|Ga0187779_10966258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia589Open in IMG/M
3300017972|Ga0187781_10451955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. 744920Open in IMG/M
3300017973|Ga0187780_10572725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia810Open in IMG/M
3300017974|Ga0187777_10625009Not Available760Open in IMG/M
3300017975|Ga0187782_11185692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria597Open in IMG/M
3300018001|Ga0187815_10415278Not Available573Open in IMG/M
3300018007|Ga0187805_10503248Not Available568Open in IMG/M
3300018042|Ga0187871_10316769Not Available863Open in IMG/M
3300018085|Ga0187772_10442097Not Available910Open in IMG/M
3300018468|Ga0066662_11048010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia811Open in IMG/M
3300020579|Ga0210407_11368913Not Available526Open in IMG/M
3300020581|Ga0210399_10107168All Organisms → cellular organisms → Bacteria2289Open in IMG/M
3300020582|Ga0210395_10116748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1979Open in IMG/M
3300021170|Ga0210400_11445760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia547Open in IMG/M
3300021181|Ga0210388_11446711Not Available576Open in IMG/M
3300021388|Ga0213875_10369329Not Available682Open in IMG/M
3300021403|Ga0210397_10129182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1743Open in IMG/M
3300021406|Ga0210386_11655568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia530Open in IMG/M
3300021432|Ga0210384_10555049Not Available1033Open in IMG/M
3300021433|Ga0210391_10357813Not Available1145Open in IMG/M
3300021444|Ga0213878_10187720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces867Open in IMG/M
3300021474|Ga0210390_10819926Not Available769Open in IMG/M
3300021560|Ga0126371_13624321Not Available521Open in IMG/M
3300024225|Ga0224572_1077978Not Available611Open in IMG/M
3300025906|Ga0207699_10893525Not Available655Open in IMG/M
3300025915|Ga0207693_11480379Not Available501Open in IMG/M
3300025916|Ga0207663_10837981All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300025916|Ga0207663_10921402Not Available699Open in IMG/M
3300025916|Ga0207663_10947724Not Available689Open in IMG/M
3300025916|Ga0207663_11332635Not Available578Open in IMG/M
3300025928|Ga0207700_10378032Not Available1238Open in IMG/M
3300025928|Ga0207700_11996243Not Available507Open in IMG/M
3300025944|Ga0207661_10206957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1728Open in IMG/M
3300027775|Ga0209177_10262612Not Available643Open in IMG/M
3300027855|Ga0209693_10061307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1852Open in IMG/M
3300027855|Ga0209693_10479115Not Available597Open in IMG/M
3300027882|Ga0209590_10361064All Organisms → cellular organisms → Bacteria → Terrabacteria group936Open in IMG/M
3300027884|Ga0209275_10538537Not Available668Open in IMG/M
3300028713|Ga0307303_10173304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae526Open in IMG/M
3300028720|Ga0307317_10245163Not Available605Open in IMG/M
3300028798|Ga0302222_10358589Not Available569Open in IMG/M
3300028808|Ga0302228_10043235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cellulosae2195Open in IMG/M
3300028879|Ga0302229_10384556Not Available625Open in IMG/M
3300028906|Ga0308309_10460608Not Available1096Open in IMG/M
3300029910|Ga0311369_10569029Not Available951Open in IMG/M
3300030494|Ga0310037_10394404Not Available574Open in IMG/M
3300030618|Ga0311354_10071783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces3943Open in IMG/M
3300030677|Ga0302317_10259126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis785Open in IMG/M
3300030706|Ga0310039_10039307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2141Open in IMG/M
3300030906|Ga0302314_10824516Not Available924Open in IMG/M
3300031543|Ga0318516_10373669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia822Open in IMG/M
3300031543|Ga0318516_10514840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia686Open in IMG/M
3300031543|Ga0318516_10722153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae565Open in IMG/M
3300031549|Ga0318571_10133650All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus843Open in IMG/M
3300031572|Ga0318515_10732838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300031708|Ga0310686_107268296Not Available837Open in IMG/M
3300031713|Ga0318496_10221231All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum1042Open in IMG/M
3300031719|Ga0306917_11545026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300031724|Ga0318500_10408244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria676Open in IMG/M
3300031748|Ga0318492_10544247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia617Open in IMG/M
3300031765|Ga0318554_10333894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia862Open in IMG/M
3300031769|Ga0318526_10332909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia621Open in IMG/M
3300031777|Ga0318543_10343053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria669Open in IMG/M
3300031779|Ga0318566_10192892All Organisms → cellular organisms → Bacteria → Terrabacteria group1011Open in IMG/M
3300031782|Ga0318552_10636394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia544Open in IMG/M
3300031793|Ga0318548_10184581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae1022Open in IMG/M
3300031799|Ga0318565_10573512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia543Open in IMG/M
3300031821|Ga0318567_10551662Not Available654Open in IMG/M
3300031821|Ga0318567_10806182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae532Open in IMG/M
3300031832|Ga0318499_10117186All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum1035Open in IMG/M
3300031896|Ga0318551_10409967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia771Open in IMG/M
3300031912|Ga0306921_11689233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia685Open in IMG/M
3300031942|Ga0310916_10865503Not Available759Open in IMG/M
3300031996|Ga0308176_12079273Not Available607Open in IMG/M
3300032039|Ga0318559_10436123All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus611Open in IMG/M
3300032041|Ga0318549_10232347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia829Open in IMG/M
3300032055|Ga0318575_10626243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300032059|Ga0318533_10846010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria671Open in IMG/M
3300032065|Ga0318513_10455101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura verrucosospora626Open in IMG/M
3300032067|Ga0318524_10374726All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus741Open in IMG/M
3300032076|Ga0306924_10109636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3130Open in IMG/M
3300032160|Ga0311301_11992726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia678Open in IMG/M
3300032160|Ga0311301_12279888Not Available617Open in IMG/M
3300032205|Ga0307472_100903331Not Available818Open in IMG/M
3300032770|Ga0335085_11333765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae755Open in IMG/M
3300032892|Ga0335081_11326301All Organisms → cellular organisms → Bacteria → Terrabacteria group810Open in IMG/M
3300032893|Ga0335069_10444477All Organisms → cellular organisms → Bacteria1514Open in IMG/M
3300032895|Ga0335074_10162513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus amargosae2801Open in IMG/M
3300032895|Ga0335074_11317822Not Available594Open in IMG/M
3300033004|Ga0335084_10660498Not Available1067Open in IMG/M
3300033134|Ga0335073_11877338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia555Open in IMG/M
3300033158|Ga0335077_10372536All Organisms → cellular organisms → Bacteria → Terrabacteria group1542Open in IMG/M
3300033158|Ga0335077_11035518Not Available816Open in IMG/M
3300033290|Ga0318519_10906288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. CNU-125545Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil24.18%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.11%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.88%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.58%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.92%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.61%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.61%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.96%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.31%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.31%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.31%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.31%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.31%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.31%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.65%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.65%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.65%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.65%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.65%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.65%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.65%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.65%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.65%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2170459024Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012498Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410Host-AssociatedOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024225Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030677Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E41_033976102170459005Grass SoilVLDAAVASQWRPDGAVEVLTDDYRLIRYPDWAHDSVFPVAQVTRSHSERAAAE
FD1_004156302170459024Grass SoilVLEAAAASQWCPDGAIEVLTDDYRLIRYPDWALDPAFPAAQVTW
Ga0062389_10321090823300004092Bog Forest SoilVSSWAPQRVLDAATAMEWQPDGAIEVRTNEYRLIRYPDWALDPTF
Ga0066679_1061926613300005176SoilMSSWTAQRVLDAAAAMEFVPEGAIEVRTEDYRLLRHPDWVLGPSLGAAQVT
Ga0070709_1016880633300005434Corn, Switchgrass And Miscanthus RhizosphereVLNAWTRHRVLDAVAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFPAAQVTRSQSS
Ga0070714_10115404613300005435Agricultural SoilVLNAWTRHRVLDAAAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFP
Ga0070714_10175213613300005435Agricultural SoilVSSWTPQHVLDAAVAMEWCPDGDTEVLTDDYRLIRYPDWALDPTFPAAQVTRS
Ga0070714_10183765713300005435Agricultural SoilVSSWTPRHVLEAAAASQWCPDGAIEVLTDDYRLIRYPDWALDPAFPAAQVTW
Ga0070714_10248874913300005435Agricultural SoilVLNAWTRRRVLDAAAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFP
Ga0070713_10072756423300005436Corn, Switchgrass And Miscanthus RhizosphereVLNAWTRHRVLDAVAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFPAAQVTR
Ga0070713_10117195223300005436Corn, Switchgrass And Miscanthus RhizosphereVLNAWTRHRVLDAAAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFPAAQVTR
Ga0070713_10141888313300005436Corn, Switchgrass And Miscanthus RhizosphereVLNAWTRHRVLDAVAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFPAAQVTRSQS
Ga0070711_10096062223300005439Corn, Switchgrass And Miscanthus RhizosphereMSEWTPQRVLDAAAATEFVPEGAIEVRTNDYRLLRHPDWVLGPSLG
Ga0070678_10139662123300005456Miscanthus RhizosphereVSSWTPRRVLEAAAARQWCPDGAVEVLTDDYRLIRYPDWALDPAFPAAQV
Ga0070698_10150003623300005471Corn, Switchgrass And Miscanthus RhizosphereVSSWTPRHVLDAAAARQWCPDGAVEVLTDDYRLIRYPDWALD
Ga0070741_1007595553300005529Surface SoilVLNEWTRRRVLDAVAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFPAAQVTRSHSG
Ga0070735_1085770733300005534Surface SoilVSLWTTQRVLDAAAAMEWVPGGAIELRTEDYRLIRY
Ga0066707_1103348223300005556SoilVSSWTPRRVLDAAVASEWRPDGAVEVLTDDYRLIRYPDWALDSAFPAAQVTRSHSERA
Ga0070664_10167970923300005564Corn RhizosphereVLNAWTRHRVLDAVAGMEWHPDGAIEVLAEDYRLIRYPD
Ga0068860_10034593423300005843Switchgrass RhizosphereVSSWTARHVLDAAAASQWCPDGAIEVLTDDYRLIRYPD
Ga0070717_1059691223300006028Corn, Switchgrass And Miscanthus RhizosphereVSSWTPRRVLDAAVAMEWRPDGAVEVLTDDYRLIRYPDWALDSAFPAAQVTRSHSERAAAEVI
Ga0066696_1082827513300006032SoilVSSWTPRHVLDAAAASQWCPDGAIEVLTDDYRLIRYPD
Ga0075028_10076613313300006050WatershedsMSSWTPQRVLDAAIAMEWRPDGAIEVLADDYRLIRYPDWALDPALPAAHVTR
Ga0075019_1061182923300006086WatershedsLSSWTPKRVLDAAAAMEWCPDGATEVLADGYRLIR
Ga0070715_1015663613300006163Corn, Switchgrass And Miscanthus RhizosphereVSSWTPRRVLEAAAASQWCPDGAIEVLTDDYRLIRYPDWALDPAFPAAQVT
Ga0070712_10166986013300006175Corn, Switchgrass And Miscanthus RhizosphereVLNAWTRHRVLDAAAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFPAAQVTRSQSS
Ga0074059_1214998023300006578SoilVSSWTPRHVLEAAAASQWCPDGAIEVLTDDYRLIRYPDWALDPAFPAAQVT
Ga0066660_1156232923300006800SoilMSEWTPQRVLDAAAATEFLPEGGIEVRTNDYRLLRHPD
Ga0079221_1148716313300006804Agricultural SoilVLNTWTRGRVLHAVAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFPAAQ
Ga0075425_10120203623300006854Populus RhizosphereVSSWTPRRVLEAAAASQWCPDGAIEVLTDDYRLIRYPDWALDPA
Ga0074063_1416646923300006953SoilVSSWTPRHVLEAAAASQWCPDGAVEVLTDDYRLIRYPDWALDPAFPAA
Ga0066710_10224945013300009012Grasslands SoilVSSWTPRRVLDAAVASEWRPDGAVEVLTDDYRLIRYPDW
Ga0105245_1084109713300009098Miscanthus RhizosphereVLEAAAASQWCPDGAIEVLTDDYRLIRYPDWALDPAFP
Ga0066709_10103884113300009137Grasslands SoilVLDAVAASQWCPDGATEVLTDDYRLIRYPDWALDPTFPAAQ
Ga0116216_1013379453300009698Peatlands SoilVLDAAIAMEWRPHGAIEVLADDYRLIRYPDWALDPVFPAAQVTRSRAGRT
Ga0116217_1003858213300009700Peatlands SoilVLDAAIAMEWRPHGAIEVLADDYRLIRYPDWALDPVLPAAH
Ga0074044_1099397023300010343Bog Forest SoilVLDAAIAMEWRPHGAIEVLADDYRLIRYPDWALDPVFPA
Ga0074044_1105280023300010343Bog Forest SoilVLDAAIAMEWRPHGAIEVLADDYRLIRYPDWALDPVFPAAQVTRSRAGRTQ
Ga0126372_1107496913300010360Tropical Forest SoilVLDAVVAMEWSPDGAIEVRTDDYRLIRYPDWALDPTFRAAQVTRSRTGRA
Ga0124844_110485333300010868Tropical Forest SoilLSSWTAQRVLDAAAAMEWRPEGAVEVLADDYRLIRY
Ga0126361_1064503113300010876Boreal Forest SoilLSTWTPQRVLDAAIMMEWRPDGALDVQADDYRLIRY
Ga0137371_1059946023300012356Vadose Zone SoilVLDAAAASQWCPDGAIEVLTDDYRLIRYPDWALDPAFPAAQVTRS
Ga0137360_1144978113300012361Vadose Zone SoilMSSWTAQRVLDAAAAMEFVPEGAIEVRTGDYRLLRHPD
Ga0157345_101844713300012498Arabidopsis RhizosphereVLEAAAASQWCPDGAVEVLTDDYRLIRYPDWALDPAFPAAQVTWSRSERTA
Ga0164306_1076567913300012988SoilVLEAAAASQWCPDGAIEVLTDDYRLIRYPDWALDPAFPAAQVTWSRSERTAAEVIG
Ga0157369_1219092323300013105Corn RhizosphereVLDTAAASQWCPDGAVEVLTDDYRLIRYPDWALDSAFP
Ga0157378_1182565113300013297Miscanthus RhizosphereVLEAAAASQLFPDGAIEVLTDDYRLIRYPDWALDPAFPAAQVTWSRS
Ga0157372_1165254923300013307Corn RhizosphereVLEAAAARQWCPDGAIEVLTDDYRLIRYPDWALDPAFPAAQVTW
Ga0157375_1207100323300013308Miscanthus RhizosphereVLEAAAARQWCPDGAIEVLTDDYRLIRYPDWALDPAFPAAQVTWSRSE
Ga0134072_1013048723300015357Grasslands SoilMSSWTAQRVLDAAAAMEWVPEGAIEMRTDDYRLVRYPDVVL
Ga0132255_10131807213300015374Arabidopsis RhizosphereVLEAAAARQWCPDGAIEVLTDDYRLIRYPDWALDPAFPAAQVTWS
Ga0182035_1205037013300016341SoilVSSWTPQRVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVV
Ga0187812_116341413300017821Freshwater SedimentVSSWTPQRVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPT
Ga0187820_114996023300017924Freshwater SedimentVSSWTPQRVLDAAAAMEWVPSGAIELRTDDYRLIRYPDV
Ga0187806_111533023300017928Freshwater SedimentVSSWTPQRVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPTF
Ga0187814_1019346223300017932Freshwater SedimentVSSWTPQQVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPTFRA
Ga0187814_1022043113300017932Freshwater SedimentMSSWTAQRVLDAAAGMEWVPEGSIEMRTDDYRLIRYPDVVL
Ga0187808_1023455223300017942Freshwater SedimentVSSWTPQRVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPTFRAA
Ga0187819_1061939813300017943Freshwater SedimentVSSWTPQRVLDAAAAMEWVPSGAIELRTDDYRLIRYPDVVLDPTFRAA
Ga0187779_1096625813300017959Tropical PeatlandLSSWTPQRVLDAAAGMEWMPEGAIEMRNDDYRLVRYPDG
Ga0187781_1045195513300017972Tropical PeatlandHGPLDSQRVLDAAAAMEWVPSGAIELRTDDCRLIR
Ga0187780_1057272523300017973Tropical PeatlandMSSWTAQRVLDAAAAMEFVPEGAIEVRTDDYRLVR
Ga0187777_1062500913300017974Tropical PeatlandLGAWTPRRVLDAAVATEWWPDGAVEAPADDYRLIRYPDWAL
Ga0187782_1118569223300017975Tropical PeatlandLSTWTPQRVLDAAAGMEWVPEGAIEMRTEDYRRVRYPD
Ga0187815_1041527833300018001Freshwater SedimentVSSWTPQQVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPTFRAA
Ga0187805_1050324823300018007Freshwater SedimentVSSWTPQRVLDAAAAMEWVPSGAIELRTDDYRLIRYPDVVLDP
Ga0187871_1031676923300018042PeatlandLSPWTPQRVLDAATVMEWQPEDAVEVRTDGYRLIRYPDWALDPSFPAAQV
Ga0187772_1044209713300018085Tropical PeatlandLGAWTPRRVLDAAVATEWWPDGAVEAPADDYRLIRYPDWALDP
Ga0066662_1104801013300018468Grasslands SoilMSSWTAQRVLDAAAAMEFVREGAIECRTGDYRLRRHADWVLGPSLGA
Ga0210407_1136891323300020579SoilVSLWTTQRVLDAAAAMEWVPGGAIELRTDDYRLIRYPD
Ga0210399_1010716813300020581SoilVSSWTPRRVLDAAVASEWRPDGAVEVLTDDYRLIRYPDWALDSAFPAAQVTRSHSERAAA
Ga0210395_1011674813300020582SoilLTSWTPRRVHDAAIAMEWRPDGAIEVLAEDYRLVRYPDWALDPVFPA
Ga0210400_1144576013300021170SoilLSSWTPERVLDAAIAMEWCPEGAIEVLADGYRLIRYPGWALDPAFPAAQVTRSRTDRPAD
Ga0210388_1144671123300021181SoilLSPWTPQRVLDAATAMEWQPDGAIEVRTGDYRLIRYPDWAL
Ga0213875_1036932913300021388Plant RootsLSSLTQRRVLDAATAMEWRPDGAVEVLTGDYRLIRYPDWALDPSFSAAQVTRSRTGRPARDII
Ga0210397_1012918243300021403SoilLSSWTPERVLDAATAMEWCPDGAIEVLADGYRLIRYPAWALDPAFPAAQVTRSRTGRPVDEV
Ga0210386_1165556823300021406SoilLSSWTPERVLDAATAMEWCPDGAIEVLADGYRLIRYPAWALDPAFPAAQVTRSRTG
Ga0210384_1055504913300021432SoilLTSWTPRRVHDAAIAMEWRPDGAIEVLAEDYRLVRYPDWALDPVFPAAQVIRSQLY
Ga0210391_1035781313300021433SoilMSSWTPQRVHDAAIAMEWRPDGAIEVLAEDYRLVRYPDWALDPVFPAAQVIR
Ga0213878_1018772013300021444Bulk SoilMSSWTPQRVLDAAAGMEWVPEGAVELRTDDYRLVRYPDVVL
Ga0210390_1081992623300021474SoilLSSWTPQRVHDAAIAMEWRPDGAIEVLAEDYRLVRYPDWALD
Ga0126371_1362432113300021560Tropical Forest SoilVSSWTPRRVLDAVVAMEWSPDGATEILTDDYRLVRYPDWALD
Ga0224572_107797813300024225RhizosphereLSSWTPQRVHDAAIAMEWRPDGAIEVLAEDYRLVRYPDWALDPVFPAAQVIRSRVYG
Ga0207699_1089352523300025906Corn, Switchgrass And Miscanthus RhizosphereVLNAWTRHRVLDAVAGMEWHPDGAIEVLADDYRLIRYPDW
Ga0207693_1148037913300025915Corn, Switchgrass And Miscanthus RhizosphereVLNSGTPHSWTARRVLDATILMEWRPDGAIEVLTDDYRLIRYPDWALDPSFPAAQVTR
Ga0207663_1083798113300025916Corn, Switchgrass And Miscanthus RhizosphereVSSWTPRRVLDAAVASEWRPDGAVEVLTDDYRLIRYPDWALDSAFPAA
Ga0207663_1092140223300025916Corn, Switchgrass And Miscanthus RhizosphereVLNAWTRHRVLDAVAGMEWHPDGAIEVLADDYRLIRYP
Ga0207663_1094772413300025916Corn, Switchgrass And Miscanthus RhizosphereVSSWTPRRVLEAAAASQWCPDGAIEVLTDDYRLIRY
Ga0207663_1133263523300025916Corn, Switchgrass And Miscanthus RhizosphereVSSWTPRRVLDAAVDMEWRPDGAVEVLTDDYRLIRYPDWALDSAFPAAQVTRSRSERSAAEV
Ga0207700_1037803213300025928Corn, Switchgrass And Miscanthus RhizosphereVLNAWTRHRVLDAVAGMEWHPDGAIEVLADDYRLIRYPD
Ga0207700_1199624313300025928Corn, Switchgrass And Miscanthus RhizosphereVLNAWTRHRVLDAVAGMEWHPDGAIEVLGDDYRLIRYPDWALDPTFPAAQVTRSQSS
Ga0207661_1020695733300025944Corn RhizosphereVLNAWTRHRVLDAVAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFPAA
Ga0209177_1026261223300027775Agricultural SoilVSSWTPRRVLEAAAASQWCPDGAIEVLTDDYRLIRYPDWALDPAFPAAQ
Ga0209693_1006130733300027855SoilVSLWTTQRVLDAAAAMEWVPGGAIELRTEDYRLIRYPD
Ga0209693_1047911513300027855SoilMSSWTPQRVLDAAAGMEWVPGGAIELRTDDYRMIRYPDVVLDPSFRAA
Ga0209590_1036106423300027882Vadose Zone SoilLSSWTQGRVLDAATAMEWRPDGAIEMLTGDYRLIRYPDWALDP
Ga0209275_1053853713300027884SoilVSSWTPQRVLDAMAAMEWRPDGAIEVPADDYRLVRYPDWALDPIVPAAQ
Ga0307303_1017330423300028713SoilVSSWTARHVLDAAAASQWCPDGAVEVLTDDYRLIRYPDWAL
Ga0307317_1024516313300028720SoilVSSWTARHVLDAAAASQWCPDGAVEVLTDDYRLIRYPDWALDPAFPAAQVTRSR
Ga0302222_1035858913300028798PalsaVLDAATVTEWTPDDAIEVRTDDYRLIRYPDWALDPSFPAAQVSRSHSGRPFGEL
Ga0302228_1004323533300028808PalsaVLDAATVTEWTPDDAIEVRTDDYRLIRYPDWALDPSFPAAQVSRSHSGRPFGELVD
Ga0302229_1038455623300028879PalsaLSAWTPQRVLEAAISLEWRPDGSLDVQTADYRLIRYPDWALDP
Ga0308309_1046060823300028906SoilVSLWTTQRVLDAAAAMEWVPGGAIELRTEDYRLIRYPDVVLDPT
Ga0311369_1056902923300029910PalsaLSAWTPRRVLDAAVSMEWRPAGAIDVQAADYRLIRYPDWALDPTFRAAQV
Ga0310037_1039440423300030494Peatlands SoilLSSWTPRRVLDAAIAMEWRPHGAIEVLADDYRLIRYP
Ga0311354_1007178313300030618PalsaLSPWTPQRVLDAATAMEWQPDGAIEVRTGDYRLIRYPDWALDP
Ga0302317_1025912613300030677PalsaLSPWTPQRVLDAATVMEWQPDDAIEVRTDDYRLIRYP
Ga0310039_1003930743300030706Peatlands SoilLSSWTPRRVLDAAIAMEWRPHGAIEVLTDDYRLIRYPDWALDPVLPAAQVTRSR
Ga0302314_1082451613300030906PalsaVATDLRRQALSAWTPQRVLEAAISLEWRPDGSLDVQTADYRLIRYPDWALDPTF
Ga0318516_1037366913300031543SoilVSSWTPERVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPTL
Ga0318516_1051484023300031543SoilVSSWTSQRVLDAAAAMEWVPSGAVELRTDDYRLIRYPDVVLDPTLR
Ga0318516_1072215313300031543SoilVLDAAAAIEWVPGGAVELRTDDYRLIRYPDVVLDPTLRAAQVTW
Ga0318571_1013365023300031549SoilVSSWTPRRVLDALVAVEWSPDGATEVLTDDYRLIRYPDW
Ga0318515_1073283813300031572SoilVSSWTPQRVLDAAAAMEWVPSGAVELRTDDYRLIRYPDVVLDPTLRAAQVT
Ga0310686_10726829613300031708SoilVSLWTTQRVLDAAAAMEWVPGGAIELRTEDYRMIRYPDVVLDP
Ga0318496_1022123123300031713SoilVSSWTPRRVLDALVAVEWSPDGATEVLTDDYRLIRYPDWALDPAFPAAQVTRSRTG
Ga0306917_1154502613300031719SoilVSSWTPQRVLDAAAAMEWVPGGAIELRTDDYRLIRYPDV
Ga0318500_1040824413300031724SoilVSSWTPQRVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPTLRAAQV
Ga0318492_1054424713300031748SoilVSSWTPQRVLDAAAAMEWVPSGAVELRTDDYRLIRYPDVV
Ga0318554_1033389413300031765SoilVSSWTPERVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPTLRAA
Ga0318526_1033290923300031769SoilMSSWIAQRVLDAAAAMEFVPEGAIEVRTEDYRLVRHPD
Ga0318543_1034305323300031777SoilVSSWTSQRVLDAAAAMEWVPSGAVELRTDDYRLIRYPDVVLDPTLRA
Ga0318566_1019289233300031779SoilVSSWTAQRVLDAAAGMEWVPEGVIEMRTDAYRLVRYPDVVLDPTFRAGQA
Ga0318552_1063639423300031782SoilLNSWTPQRVLDHAAAIEFVPEGGSEVRTDDYRLVRHPDWV
Ga0318548_1018458113300031793SoilVSSWTPRRVLDSVVAMEWSPDGAIEVRTDDYRLIRYPD
Ga0318565_1057351223300031799SoilMSSWTAQRVLDAAAATEFVPEGAIEVRTDDYRLVR
Ga0318567_1055166213300031821SoilVSSWTPQRVLDAAAAMEWVPSGAVELRTDDYRLIRYPDVVLDPT
Ga0318567_1080618213300031821SoilMEWAPGGAIELRTDDYRVIRYPDLVLDPTFRAAQVTWSRTTRPLDEII
Ga0318499_1011718613300031832SoilVSSWTPRRVLDALVAVEWSPDGATEVLTDDYRLIRYPDWALDPAFPAAQV
Ga0318551_1040996723300031896SoilVSSWTPQRVLDAAAAMEWVPGGAIELRTDDYRLIRYPD
Ga0306921_1168923313300031912SoilVSSWTPERVLDAAAAMEWVPGGAIELRTDDYRLIR
Ga0310916_1086550333300031942SoilVSSWTAQRVLDAAAGMEWVPEGVIEMRTDAYRLVRYPDVVLDPTF
Ga0308176_1207927313300031996SoilVLNAWTRGRVLDAVAGMEWHPDGAIEVLADDYRLIR
Ga0318559_1043612313300032039SoilVSLWTPQRVLDAVVALEWFPDGAVEVRTDDYRLIRYPD
Ga0318549_1023234723300032041SoilVSSWTPQRVLDAAADIEWVPGGAIELRTDDYRLVRYPDVVLDPT
Ga0318575_1062624323300032055SoilVSSWTPRRVLDALVAVEWSPDGATEVLTDDYRLIRYPDWALDPAFSAAQVTRSRTG
Ga0318533_1084601023300032059SoilVSSWTPQRVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPALRAAGYPLH
Ga0318513_1045510123300032065SoilVSSWTPERVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPT
Ga0318524_1037472613300032067SoilVSSWTPRRVLDALVAVEWSPDGATEVLTDDYRLIRY
Ga0306924_1010963613300032076SoilVSSWTPQRVLDAAAAMEWVPGGAIELRTDDYRLIR
Ga0311301_1199272613300032160Peatlands SoilLSSWTPQRVLDAAIAMEWRPDGAIEVLTDDYRLIRYPDWALDAVFPAAQVTRSRAGRTRRPADE
Ga0311301_1227988823300032160Peatlands SoilLSSWTPQRVLDAAIAMEWRPHGAIEVLADDYRLIRYPDWALD
Ga0307472_10090333123300032205Hardwood Forest SoilVSSWTPRRVLDAAVAMEWRPDGSLEVLADGYRLIR
Ga0335085_1133376523300032770SoilVSSWTPRRVLDALVAVEWSPDGATEVLTDDYRLIRYPDWALDPAFPAAQITR
Ga0335081_1132630113300032892SoilVSGAYSRVVSSWTPRRVLDAAIAMEWRPDGAVEAPSEDYRLI
Ga0335069_1044447713300032893SoilVLNAWTRGRVLDAVAGMEWHPDGAIEVLADDYRLIRYPDWAL
Ga0335074_1016251313300032895SoilVLDAAAGMEWVPGGAIELRTDDYKIIRYPDVVLDPTFSAAQVTWS
Ga0335074_1131782213300032895SoilVSSWTPQRVLDAAAGMEWVPGGAIELRTDDYKIIRYPDVVLDPTFSAAQVTWS
Ga0335084_1066049833300033004SoilVSSWTPRHVLDAAAASQWCPEGAVEVLTDDYRLIRY
Ga0335073_1187733813300033134SoilVSSWTPQRVLDAAAAMEWVPAGSVELRTDDYRLIRYPDVVLDPTLR
Ga0335077_1037253613300033158SoilLNSWTPGRVLDVANEMDWRPDGSIEAPAGDYRLIRYPDWAL
Ga0335077_1103551833300033158SoilVLNAWTRHRVLDAVAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFPA
Ga0318519_1090628813300033290SoilVSSWTPQRVLDAAADIEWVSGAAIELRTDDYRLVRYPDVVLDP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.