Basic Information | |
---|---|
Family ID | F045411 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 153 |
Average Sequence Length | 45 residues |
Representative Sequence | VSSWTPQRVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPTF |
Number of Associated Samples | 135 |
Number of Associated Scaffolds | 153 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 99.34 % |
% of genes near scaffold ends (potentially truncated) | 99.35 % |
% of genes from short scaffolds (< 2000 bps) | 94.12 % |
Associated GOLD sequencing projects | 130 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (52.288 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.183 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.261 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.176 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.70% β-sheet: 10.96% Coil/Unstructured: 75.34% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 153 Family Scaffolds |
---|---|---|
PF00753 | Lactamase_B | 10.46 |
PF01663 | Phosphodiest | 4.58 |
PF00580 | UvrD-helicase | 2.61 |
PF07690 | MFS_1 | 2.61 |
PF11298 | DUF3099 | 2.61 |
PF13673 | Acetyltransf_10 | 1.31 |
PF04672 | Methyltransf_19 | 1.31 |
PF13191 | AAA_16 | 0.65 |
PF00456 | Transketolase_N | 0.65 |
PF00581 | Rhodanese | 0.65 |
PF00583 | Acetyltransf_1 | 0.65 |
PF10722 | YbjN | 0.65 |
PF00903 | Glyoxalase | 0.65 |
PF07836 | DmpG_comm | 0.65 |
PF13305 | TetR_C_33 | 0.65 |
PF09900 | DUF2127 | 0.65 |
PF00378 | ECH_1 | 0.65 |
PF12679 | ABC2_membrane_2 | 0.65 |
PF13380 | CoA_binding_2 | 0.65 |
PF09290 | AcetDehyd-dimer | 0.65 |
PF00291 | PALP | 0.65 |
PF12697 | Abhydrolase_6 | 0.65 |
PF00857 | Isochorismatase | 0.65 |
PF07714 | PK_Tyr_Ser-Thr | 0.65 |
COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
---|---|---|---|
COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 2.61 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.61 |
COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 2.61 |
COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 2.61 |
COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.65 |
COG0119 | Isopropylmalate/homocitrate/citramalate synthases | Amino acid transport and metabolism [E] | 0.65 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.65 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.65 |
COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.65 |
COG4569 | Acetaldehyde dehydrogenase (acetylating) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 52.29 % |
Unclassified | root | N/A | 47.71 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459005|F1BAP7Q01AKMF6 | Not Available | 555 | Open in IMG/M |
2170459024|GZRSKLJ01E2WVZ | Not Available | 526 | Open in IMG/M |
3300004092|Ga0062389_103210908 | Not Available | 612 | Open in IMG/M |
3300005434|Ga0070709_10168806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1527 | Open in IMG/M |
3300005435|Ga0070714_101154046 | Not Available | 755 | Open in IMG/M |
3300005435|Ga0070714_101752136 | Not Available | 607 | Open in IMG/M |
3300005435|Ga0070714_101837657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 591 | Open in IMG/M |
3300005435|Ga0070714_102488749 | Not Available | 502 | Open in IMG/M |
3300005436|Ga0070713_100727564 | Not Available | 948 | Open in IMG/M |
3300005436|Ga0070713_101171952 | Not Available | 743 | Open in IMG/M |
3300005436|Ga0070713_101418883 | Not Available | 673 | Open in IMG/M |
3300005439|Ga0070711_100960622 | Not Available | 732 | Open in IMG/M |
3300005456|Ga0070678_101396621 | Not Available | 654 | Open in IMG/M |
3300005471|Ga0070698_101500036 | Not Available | 625 | Open in IMG/M |
3300005529|Ga0070741_10075955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3737 | Open in IMG/M |
3300005534|Ga0070735_10857707 | Not Available | 534 | Open in IMG/M |
3300005556|Ga0066707_11033482 | Not Available | 500 | Open in IMG/M |
3300005564|Ga0070664_101679709 | Not Available | 602 | Open in IMG/M |
3300005843|Ga0068860_100345934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1462 | Open in IMG/M |
3300006028|Ga0070717_10596912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1001 | Open in IMG/M |
3300006032|Ga0066696_10828275 | Not Available | 590 | Open in IMG/M |
3300006050|Ga0075028_100766133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
3300006086|Ga0075019_10611829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 684 | Open in IMG/M |
3300006163|Ga0070715_10156636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1121 | Open in IMG/M |
3300006175|Ga0070712_101669860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
3300006578|Ga0074059_12149980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | 1101 | Open in IMG/M |
3300006800|Ga0066660_11562329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
3300006804|Ga0079221_11487163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
3300006854|Ga0075425_101202036 | Not Available | 861 | Open in IMG/M |
3300006953|Ga0074063_14166469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | 776 | Open in IMG/M |
3300009012|Ga0066710_102249450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 794 | Open in IMG/M |
3300009098|Ga0105245_10841097 | Not Available | 957 | Open in IMG/M |
3300009137|Ga0066709_101038841 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
3300009698|Ga0116216_10133794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1525 | Open in IMG/M |
3300009700|Ga0116217_10038582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3562 | Open in IMG/M |
3300010343|Ga0074044_10993970 | Not Available | 550 | Open in IMG/M |
3300010343|Ga0074044_11052800 | Not Available | 533 | Open in IMG/M |
3300010360|Ga0126372_11074969 | Not Available | 821 | Open in IMG/M |
3300010868|Ga0124844_1104853 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
3300010876|Ga0126361_10645031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 807 | Open in IMG/M |
3300012356|Ga0137371_10599460 | Not Available | 846 | Open in IMG/M |
3300012361|Ga0137360_11449781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 590 | Open in IMG/M |
3300012498|Ga0157345_1018447 | Not Available | 689 | Open in IMG/M |
3300012988|Ga0164306_10765679 | Not Available | 774 | Open in IMG/M |
3300013105|Ga0157369_12190923 | Not Available | 560 | Open in IMG/M |
3300013297|Ga0157378_11825651 | Not Available | 656 | Open in IMG/M |
3300013307|Ga0157372_11652549 | Not Available | 737 | Open in IMG/M |
3300013308|Ga0157375_12071003 | Not Available | 677 | Open in IMG/M |
3300015357|Ga0134072_10130487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 806 | Open in IMG/M |
3300015374|Ga0132255_101318072 | Not Available | 1089 | Open in IMG/M |
3300016341|Ga0182035_12050370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura verrucosospora | 520 | Open in IMG/M |
3300017821|Ga0187812_1163414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 715 | Open in IMG/M |
3300017924|Ga0187820_1149960 | Not Available | 701 | Open in IMG/M |
3300017928|Ga0187806_1115330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 867 | Open in IMG/M |
3300017932|Ga0187814_10193462 | Not Available | 764 | Open in IMG/M |
3300017932|Ga0187814_10220431 | Not Available | 715 | Open in IMG/M |
3300017942|Ga0187808_10234552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 819 | Open in IMG/M |
3300017943|Ga0187819_10619398 | Not Available | 613 | Open in IMG/M |
3300017959|Ga0187779_10966258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
3300017972|Ga0187781_10451955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. 744 | 920 | Open in IMG/M |
3300017973|Ga0187780_10572725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 810 | Open in IMG/M |
3300017974|Ga0187777_10625009 | Not Available | 760 | Open in IMG/M |
3300017975|Ga0187782_11185692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
3300018001|Ga0187815_10415278 | Not Available | 573 | Open in IMG/M |
3300018007|Ga0187805_10503248 | Not Available | 568 | Open in IMG/M |
3300018042|Ga0187871_10316769 | Not Available | 863 | Open in IMG/M |
3300018085|Ga0187772_10442097 | Not Available | 910 | Open in IMG/M |
3300018468|Ga0066662_11048010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 811 | Open in IMG/M |
3300020579|Ga0210407_11368913 | Not Available | 526 | Open in IMG/M |
3300020581|Ga0210399_10107168 | All Organisms → cellular organisms → Bacteria | 2289 | Open in IMG/M |
3300020582|Ga0210395_10116748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1979 | Open in IMG/M |
3300021170|Ga0210400_11445760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
3300021181|Ga0210388_11446711 | Not Available | 576 | Open in IMG/M |
3300021388|Ga0213875_10369329 | Not Available | 682 | Open in IMG/M |
3300021403|Ga0210397_10129182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1743 | Open in IMG/M |
3300021406|Ga0210386_11655568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 530 | Open in IMG/M |
3300021432|Ga0210384_10555049 | Not Available | 1033 | Open in IMG/M |
3300021433|Ga0210391_10357813 | Not Available | 1145 | Open in IMG/M |
3300021444|Ga0213878_10187720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 867 | Open in IMG/M |
3300021474|Ga0210390_10819926 | Not Available | 769 | Open in IMG/M |
3300021560|Ga0126371_13624321 | Not Available | 521 | Open in IMG/M |
3300024225|Ga0224572_1077978 | Not Available | 611 | Open in IMG/M |
3300025906|Ga0207699_10893525 | Not Available | 655 | Open in IMG/M |
3300025915|Ga0207693_11480379 | Not Available | 501 | Open in IMG/M |
3300025916|Ga0207663_10837981 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300025916|Ga0207663_10921402 | Not Available | 699 | Open in IMG/M |
3300025916|Ga0207663_10947724 | Not Available | 689 | Open in IMG/M |
3300025916|Ga0207663_11332635 | Not Available | 578 | Open in IMG/M |
3300025928|Ga0207700_10378032 | Not Available | 1238 | Open in IMG/M |
3300025928|Ga0207700_11996243 | Not Available | 507 | Open in IMG/M |
3300025944|Ga0207661_10206957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1728 | Open in IMG/M |
3300027775|Ga0209177_10262612 | Not Available | 643 | Open in IMG/M |
3300027855|Ga0209693_10061307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1852 | Open in IMG/M |
3300027855|Ga0209693_10479115 | Not Available | 597 | Open in IMG/M |
3300027882|Ga0209590_10361064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 936 | Open in IMG/M |
3300027884|Ga0209275_10538537 | Not Available | 668 | Open in IMG/M |
3300028713|Ga0307303_10173304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 526 | Open in IMG/M |
3300028720|Ga0307317_10245163 | Not Available | 605 | Open in IMG/M |
3300028798|Ga0302222_10358589 | Not Available | 569 | Open in IMG/M |
3300028808|Ga0302228_10043235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cellulosae | 2195 | Open in IMG/M |
3300028879|Ga0302229_10384556 | Not Available | 625 | Open in IMG/M |
3300028906|Ga0308309_10460608 | Not Available | 1096 | Open in IMG/M |
3300029910|Ga0311369_10569029 | Not Available | 951 | Open in IMG/M |
3300030494|Ga0310037_10394404 | Not Available | 574 | Open in IMG/M |
3300030618|Ga0311354_10071783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 3943 | Open in IMG/M |
3300030677|Ga0302317_10259126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 785 | Open in IMG/M |
3300030706|Ga0310039_10039307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2141 | Open in IMG/M |
3300030906|Ga0302314_10824516 | Not Available | 924 | Open in IMG/M |
3300031543|Ga0318516_10373669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 822 | Open in IMG/M |
3300031543|Ga0318516_10514840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 686 | Open in IMG/M |
3300031543|Ga0318516_10722153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae | 565 | Open in IMG/M |
3300031549|Ga0318571_10133650 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 843 | Open in IMG/M |
3300031572|Ga0318515_10732838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
3300031708|Ga0310686_107268296 | Not Available | 837 | Open in IMG/M |
3300031713|Ga0318496_10221231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum | 1042 | Open in IMG/M |
3300031719|Ga0306917_11545026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
3300031724|Ga0318500_10408244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 676 | Open in IMG/M |
3300031748|Ga0318492_10544247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 617 | Open in IMG/M |
3300031765|Ga0318554_10333894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 862 | Open in IMG/M |
3300031769|Ga0318526_10332909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
3300031777|Ga0318543_10343053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
3300031779|Ga0318566_10192892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1011 | Open in IMG/M |
3300031782|Ga0318552_10636394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 544 | Open in IMG/M |
3300031793|Ga0318548_10184581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1022 | Open in IMG/M |
3300031799|Ga0318565_10573512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
3300031821|Ga0318567_10551662 | Not Available | 654 | Open in IMG/M |
3300031821|Ga0318567_10806182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae | 532 | Open in IMG/M |
3300031832|Ga0318499_10117186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum | 1035 | Open in IMG/M |
3300031896|Ga0318551_10409967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 771 | Open in IMG/M |
3300031912|Ga0306921_11689233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 685 | Open in IMG/M |
3300031942|Ga0310916_10865503 | Not Available | 759 | Open in IMG/M |
3300031996|Ga0308176_12079273 | Not Available | 607 | Open in IMG/M |
3300032039|Ga0318559_10436123 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 611 | Open in IMG/M |
3300032041|Ga0318549_10232347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 829 | Open in IMG/M |
3300032055|Ga0318575_10626243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
3300032059|Ga0318533_10846010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 671 | Open in IMG/M |
3300032065|Ga0318513_10455101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura verrucosospora | 626 | Open in IMG/M |
3300032067|Ga0318524_10374726 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 741 | Open in IMG/M |
3300032076|Ga0306924_10109636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3130 | Open in IMG/M |
3300032160|Ga0311301_11992726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 678 | Open in IMG/M |
3300032160|Ga0311301_12279888 | Not Available | 617 | Open in IMG/M |
3300032205|Ga0307472_100903331 | Not Available | 818 | Open in IMG/M |
3300032770|Ga0335085_11333765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 755 | Open in IMG/M |
3300032892|Ga0335081_11326301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 810 | Open in IMG/M |
3300032893|Ga0335069_10444477 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
3300032895|Ga0335074_10162513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus amargosae | 2801 | Open in IMG/M |
3300032895|Ga0335074_11317822 | Not Available | 594 | Open in IMG/M |
3300033004|Ga0335084_10660498 | Not Available | 1067 | Open in IMG/M |
3300033134|Ga0335073_11877338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
3300033158|Ga0335077_10372536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1542 | Open in IMG/M |
3300033158|Ga0335077_11035518 | Not Available | 816 | Open in IMG/M |
3300033290|Ga0318519_10906288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. CNU-125 | 545 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.18% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.11% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.88% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.88% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.58% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.92% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.61% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.61% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.61% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.31% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.31% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.31% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.31% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.31% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.31% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.65% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.65% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.65% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.65% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.65% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.65% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.65% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.65% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.65% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.65% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.65% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.65% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.65% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E41_03397610 | 2170459005 | Grass Soil | VLDAAVASQWRPDGAVEVLTDDYRLIRYPDWAHDSVFPVAQVTRSHSERAAAE |
FD1_00415630 | 2170459024 | Grass Soil | VLEAAAASQWCPDGAIEVLTDDYRLIRYPDWALDPAFPAAQVTW |
Ga0062389_1032109082 | 3300004092 | Bog Forest Soil | VSSWAPQRVLDAATAMEWQPDGAIEVRTNEYRLIRYPDWALDPTF |
Ga0066679_106192661 | 3300005176 | Soil | MSSWTAQRVLDAAAAMEFVPEGAIEVRTEDYRLLRHPDWVLGPSLGAAQVT |
Ga0070709_101688063 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VLNAWTRHRVLDAVAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFPAAQVTRSQSS |
Ga0070714_1011540461 | 3300005435 | Agricultural Soil | VLNAWTRHRVLDAAAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFP |
Ga0070714_1017521361 | 3300005435 | Agricultural Soil | VSSWTPQHVLDAAVAMEWCPDGDTEVLTDDYRLIRYPDWALDPTFPAAQVTRS |
Ga0070714_1018376571 | 3300005435 | Agricultural Soil | VSSWTPRHVLEAAAASQWCPDGAIEVLTDDYRLIRYPDWALDPAFPAAQVTW |
Ga0070714_1024887491 | 3300005435 | Agricultural Soil | VLNAWTRRRVLDAAAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFP |
Ga0070713_1007275642 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VLNAWTRHRVLDAVAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFPAAQVTR |
Ga0070713_1011719522 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VLNAWTRHRVLDAAAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFPAAQVTR |
Ga0070713_1014188831 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VLNAWTRHRVLDAVAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFPAAQVTRSQS |
Ga0070711_1009606222 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEWTPQRVLDAAAATEFVPEGAIEVRTNDYRLLRHPDWVLGPSLG |
Ga0070678_1013966212 | 3300005456 | Miscanthus Rhizosphere | VSSWTPRRVLEAAAARQWCPDGAVEVLTDDYRLIRYPDWALDPAFPAAQV |
Ga0070698_1015000362 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSWTPRHVLDAAAARQWCPDGAVEVLTDDYRLIRYPDWALD |
Ga0070741_100759555 | 3300005529 | Surface Soil | VLNEWTRRRVLDAVAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFPAAQVTRSHSG |
Ga0070735_108577073 | 3300005534 | Surface Soil | VSLWTTQRVLDAAAAMEWVPGGAIELRTEDYRLIRY |
Ga0066707_110334822 | 3300005556 | Soil | VSSWTPRRVLDAAVASEWRPDGAVEVLTDDYRLIRYPDWALDSAFPAAQVTRSHSERA |
Ga0070664_1016797092 | 3300005564 | Corn Rhizosphere | VLNAWTRHRVLDAVAGMEWHPDGAIEVLAEDYRLIRYPD |
Ga0068860_1003459342 | 3300005843 | Switchgrass Rhizosphere | VSSWTARHVLDAAAASQWCPDGAIEVLTDDYRLIRYPD |
Ga0070717_105969122 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSWTPRRVLDAAVAMEWRPDGAVEVLTDDYRLIRYPDWALDSAFPAAQVTRSHSERAAAEVI |
Ga0066696_108282751 | 3300006032 | Soil | VSSWTPRHVLDAAAASQWCPDGAIEVLTDDYRLIRYPD |
Ga0075028_1007661331 | 3300006050 | Watersheds | MSSWTPQRVLDAAIAMEWRPDGAIEVLADDYRLIRYPDWALDPALPAAHVTR |
Ga0075019_106118292 | 3300006086 | Watersheds | LSSWTPKRVLDAAAAMEWCPDGATEVLADGYRLIR |
Ga0070715_101566361 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSWTPRRVLEAAAASQWCPDGAIEVLTDDYRLIRYPDWALDPAFPAAQVT |
Ga0070712_1016698601 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VLNAWTRHRVLDAAAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFPAAQVTRSQSS |
Ga0074059_121499802 | 3300006578 | Soil | VSSWTPRHVLEAAAASQWCPDGAIEVLTDDYRLIRYPDWALDPAFPAAQVT |
Ga0066660_115623292 | 3300006800 | Soil | MSEWTPQRVLDAAAATEFLPEGGIEVRTNDYRLLRHPD |
Ga0079221_114871631 | 3300006804 | Agricultural Soil | VLNTWTRGRVLHAVAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFPAAQ |
Ga0075425_1012020362 | 3300006854 | Populus Rhizosphere | VSSWTPRRVLEAAAASQWCPDGAIEVLTDDYRLIRYPDWALDPA |
Ga0074063_141664692 | 3300006953 | Soil | VSSWTPRHVLEAAAASQWCPDGAVEVLTDDYRLIRYPDWALDPAFPAA |
Ga0066710_1022494501 | 3300009012 | Grasslands Soil | VSSWTPRRVLDAAVASEWRPDGAVEVLTDDYRLIRYPDW |
Ga0105245_108410971 | 3300009098 | Miscanthus Rhizosphere | VLEAAAASQWCPDGAIEVLTDDYRLIRYPDWALDPAFP |
Ga0066709_1010388411 | 3300009137 | Grasslands Soil | VLDAVAASQWCPDGATEVLTDDYRLIRYPDWALDPTFPAAQ |
Ga0116216_101337945 | 3300009698 | Peatlands Soil | VLDAAIAMEWRPHGAIEVLADDYRLIRYPDWALDPVFPAAQVTRSRAGRT |
Ga0116217_100385821 | 3300009700 | Peatlands Soil | VLDAAIAMEWRPHGAIEVLADDYRLIRYPDWALDPVLPAAH |
Ga0074044_109939702 | 3300010343 | Bog Forest Soil | VLDAAIAMEWRPHGAIEVLADDYRLIRYPDWALDPVFPA |
Ga0074044_110528002 | 3300010343 | Bog Forest Soil | VLDAAIAMEWRPHGAIEVLADDYRLIRYPDWALDPVFPAAQVTRSRAGRTQ |
Ga0126372_110749691 | 3300010360 | Tropical Forest Soil | VLDAVVAMEWSPDGAIEVRTDDYRLIRYPDWALDPTFRAAQVTRSRTGRA |
Ga0124844_11048533 | 3300010868 | Tropical Forest Soil | LSSWTAQRVLDAAAAMEWRPEGAVEVLADDYRLIRY |
Ga0126361_106450311 | 3300010876 | Boreal Forest Soil | LSTWTPQRVLDAAIMMEWRPDGALDVQADDYRLIRY |
Ga0137371_105994602 | 3300012356 | Vadose Zone Soil | VLDAAAASQWCPDGAIEVLTDDYRLIRYPDWALDPAFPAAQVTRS |
Ga0137360_114497811 | 3300012361 | Vadose Zone Soil | MSSWTAQRVLDAAAAMEFVPEGAIEVRTGDYRLLRHPD |
Ga0157345_10184471 | 3300012498 | Arabidopsis Rhizosphere | VLEAAAASQWCPDGAVEVLTDDYRLIRYPDWALDPAFPAAQVTWSRSERTA |
Ga0164306_107656791 | 3300012988 | Soil | VLEAAAASQWCPDGAIEVLTDDYRLIRYPDWALDPAFPAAQVTWSRSERTAAEVIG |
Ga0157369_121909232 | 3300013105 | Corn Rhizosphere | VLDTAAASQWCPDGAVEVLTDDYRLIRYPDWALDSAFP |
Ga0157378_118256511 | 3300013297 | Miscanthus Rhizosphere | VLEAAAASQLFPDGAIEVLTDDYRLIRYPDWALDPAFPAAQVTWSRS |
Ga0157372_116525492 | 3300013307 | Corn Rhizosphere | VLEAAAARQWCPDGAIEVLTDDYRLIRYPDWALDPAFPAAQVTW |
Ga0157375_120710032 | 3300013308 | Miscanthus Rhizosphere | VLEAAAARQWCPDGAIEVLTDDYRLIRYPDWALDPAFPAAQVTWSRSE |
Ga0134072_101304872 | 3300015357 | Grasslands Soil | MSSWTAQRVLDAAAAMEWVPEGAIEMRTDDYRLVRYPDVVL |
Ga0132255_1013180721 | 3300015374 | Arabidopsis Rhizosphere | VLEAAAARQWCPDGAIEVLTDDYRLIRYPDWALDPAFPAAQVTWS |
Ga0182035_120503701 | 3300016341 | Soil | VSSWTPQRVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVV |
Ga0187812_11634141 | 3300017821 | Freshwater Sediment | VSSWTPQRVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPT |
Ga0187820_11499602 | 3300017924 | Freshwater Sediment | VSSWTPQRVLDAAAAMEWVPSGAIELRTDDYRLIRYPDV |
Ga0187806_11153302 | 3300017928 | Freshwater Sediment | VSSWTPQRVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPTF |
Ga0187814_101934622 | 3300017932 | Freshwater Sediment | VSSWTPQQVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPTFRA |
Ga0187814_102204311 | 3300017932 | Freshwater Sediment | MSSWTAQRVLDAAAGMEWVPEGSIEMRTDDYRLIRYPDVVL |
Ga0187808_102345522 | 3300017942 | Freshwater Sediment | VSSWTPQRVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPTFRAA |
Ga0187819_106193981 | 3300017943 | Freshwater Sediment | VSSWTPQRVLDAAAAMEWVPSGAIELRTDDYRLIRYPDVVLDPTFRAA |
Ga0187779_109662581 | 3300017959 | Tropical Peatland | LSSWTPQRVLDAAAGMEWMPEGAIEMRNDDYRLVRYPDG |
Ga0187781_104519551 | 3300017972 | Tropical Peatland | HGPLDSQRVLDAAAAMEWVPSGAIELRTDDCRLIR |
Ga0187780_105727252 | 3300017973 | Tropical Peatland | MSSWTAQRVLDAAAAMEFVPEGAIEVRTDDYRLVR |
Ga0187777_106250091 | 3300017974 | Tropical Peatland | LGAWTPRRVLDAAVATEWWPDGAVEAPADDYRLIRYPDWAL |
Ga0187782_111856922 | 3300017975 | Tropical Peatland | LSTWTPQRVLDAAAGMEWVPEGAIEMRTEDYRRVRYPD |
Ga0187815_104152783 | 3300018001 | Freshwater Sediment | VSSWTPQQVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPTFRAA |
Ga0187805_105032482 | 3300018007 | Freshwater Sediment | VSSWTPQRVLDAAAAMEWVPSGAIELRTDDYRLIRYPDVVLDP |
Ga0187871_103167692 | 3300018042 | Peatland | LSPWTPQRVLDAATVMEWQPEDAVEVRTDGYRLIRYPDWALDPSFPAAQV |
Ga0187772_104420971 | 3300018085 | Tropical Peatland | LGAWTPRRVLDAAVATEWWPDGAVEAPADDYRLIRYPDWALDP |
Ga0066662_110480101 | 3300018468 | Grasslands Soil | MSSWTAQRVLDAAAAMEFVREGAIECRTGDYRLRRHADWVLGPSLGA |
Ga0210407_113689132 | 3300020579 | Soil | VSLWTTQRVLDAAAAMEWVPGGAIELRTDDYRLIRYPD |
Ga0210399_101071681 | 3300020581 | Soil | VSSWTPRRVLDAAVASEWRPDGAVEVLTDDYRLIRYPDWALDSAFPAAQVTRSHSERAAA |
Ga0210395_101167481 | 3300020582 | Soil | LTSWTPRRVHDAAIAMEWRPDGAIEVLAEDYRLVRYPDWALDPVFPA |
Ga0210400_114457601 | 3300021170 | Soil | LSSWTPERVLDAAIAMEWCPEGAIEVLADGYRLIRYPGWALDPAFPAAQVTRSRTDRPAD |
Ga0210388_114467112 | 3300021181 | Soil | LSPWTPQRVLDAATAMEWQPDGAIEVRTGDYRLIRYPDWAL |
Ga0213875_103693291 | 3300021388 | Plant Roots | LSSLTQRRVLDAATAMEWRPDGAVEVLTGDYRLIRYPDWALDPSFSAAQVTRSRTGRPARDII |
Ga0210397_101291824 | 3300021403 | Soil | LSSWTPERVLDAATAMEWCPDGAIEVLADGYRLIRYPAWALDPAFPAAQVTRSRTGRPVDEV |
Ga0210386_116555682 | 3300021406 | Soil | LSSWTPERVLDAATAMEWCPDGAIEVLADGYRLIRYPAWALDPAFPAAQVTRSRTG |
Ga0210384_105550491 | 3300021432 | Soil | LTSWTPRRVHDAAIAMEWRPDGAIEVLAEDYRLVRYPDWALDPVFPAAQVIRSQLY |
Ga0210391_103578131 | 3300021433 | Soil | MSSWTPQRVHDAAIAMEWRPDGAIEVLAEDYRLVRYPDWALDPVFPAAQVIR |
Ga0213878_101877201 | 3300021444 | Bulk Soil | MSSWTPQRVLDAAAGMEWVPEGAVELRTDDYRLVRYPDVVL |
Ga0210390_108199262 | 3300021474 | Soil | LSSWTPQRVHDAAIAMEWRPDGAIEVLAEDYRLVRYPDWALD |
Ga0126371_136243211 | 3300021560 | Tropical Forest Soil | VSSWTPRRVLDAVVAMEWSPDGATEILTDDYRLVRYPDWALD |
Ga0224572_10779781 | 3300024225 | Rhizosphere | LSSWTPQRVHDAAIAMEWRPDGAIEVLAEDYRLVRYPDWALDPVFPAAQVIRSRVYG |
Ga0207699_108935252 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VLNAWTRHRVLDAVAGMEWHPDGAIEVLADDYRLIRYPDW |
Ga0207693_114803791 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VLNSGTPHSWTARRVLDATILMEWRPDGAIEVLTDDYRLIRYPDWALDPSFPAAQVTR |
Ga0207663_108379811 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSWTPRRVLDAAVASEWRPDGAVEVLTDDYRLIRYPDWALDSAFPAA |
Ga0207663_109214022 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VLNAWTRHRVLDAVAGMEWHPDGAIEVLADDYRLIRYP |
Ga0207663_109477241 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSWTPRRVLEAAAASQWCPDGAIEVLTDDYRLIRY |
Ga0207663_113326352 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSWTPRRVLDAAVDMEWRPDGAVEVLTDDYRLIRYPDWALDSAFPAAQVTRSRSERSAAEV |
Ga0207700_103780321 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VLNAWTRHRVLDAVAGMEWHPDGAIEVLADDYRLIRYPD |
Ga0207700_119962431 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VLNAWTRHRVLDAVAGMEWHPDGAIEVLGDDYRLIRYPDWALDPTFPAAQVTRSQSS |
Ga0207661_102069573 | 3300025944 | Corn Rhizosphere | VLNAWTRHRVLDAVAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFPAA |
Ga0209177_102626122 | 3300027775 | Agricultural Soil | VSSWTPRRVLEAAAASQWCPDGAIEVLTDDYRLIRYPDWALDPAFPAAQ |
Ga0209693_100613073 | 3300027855 | Soil | VSLWTTQRVLDAAAAMEWVPGGAIELRTEDYRLIRYPD |
Ga0209693_104791151 | 3300027855 | Soil | MSSWTPQRVLDAAAGMEWVPGGAIELRTDDYRMIRYPDVVLDPSFRAA |
Ga0209590_103610642 | 3300027882 | Vadose Zone Soil | LSSWTQGRVLDAATAMEWRPDGAIEMLTGDYRLIRYPDWALDP |
Ga0209275_105385371 | 3300027884 | Soil | VSSWTPQRVLDAMAAMEWRPDGAIEVPADDYRLVRYPDWALDPIVPAAQ |
Ga0307303_101733042 | 3300028713 | Soil | VSSWTARHVLDAAAASQWCPDGAVEVLTDDYRLIRYPDWAL |
Ga0307317_102451631 | 3300028720 | Soil | VSSWTARHVLDAAAASQWCPDGAVEVLTDDYRLIRYPDWALDPAFPAAQVTRSR |
Ga0302222_103585891 | 3300028798 | Palsa | VLDAATVTEWTPDDAIEVRTDDYRLIRYPDWALDPSFPAAQVSRSHSGRPFGEL |
Ga0302228_100432353 | 3300028808 | Palsa | VLDAATVTEWTPDDAIEVRTDDYRLIRYPDWALDPSFPAAQVSRSHSGRPFGELVD |
Ga0302229_103845562 | 3300028879 | Palsa | LSAWTPQRVLEAAISLEWRPDGSLDVQTADYRLIRYPDWALDP |
Ga0308309_104606082 | 3300028906 | Soil | VSLWTTQRVLDAAAAMEWVPGGAIELRTEDYRLIRYPDVVLDPT |
Ga0311369_105690292 | 3300029910 | Palsa | LSAWTPRRVLDAAVSMEWRPAGAIDVQAADYRLIRYPDWALDPTFRAAQV |
Ga0310037_103944042 | 3300030494 | Peatlands Soil | LSSWTPRRVLDAAIAMEWRPHGAIEVLADDYRLIRYP |
Ga0311354_100717831 | 3300030618 | Palsa | LSPWTPQRVLDAATAMEWQPDGAIEVRTGDYRLIRYPDWALDP |
Ga0302317_102591261 | 3300030677 | Palsa | LSPWTPQRVLDAATVMEWQPDDAIEVRTDDYRLIRYP |
Ga0310039_100393074 | 3300030706 | Peatlands Soil | LSSWTPRRVLDAAIAMEWRPHGAIEVLTDDYRLIRYPDWALDPVLPAAQVTRSR |
Ga0302314_108245161 | 3300030906 | Palsa | VATDLRRQALSAWTPQRVLEAAISLEWRPDGSLDVQTADYRLIRYPDWALDPTF |
Ga0318516_103736691 | 3300031543 | Soil | VSSWTPERVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPTL |
Ga0318516_105148402 | 3300031543 | Soil | VSSWTSQRVLDAAAAMEWVPSGAVELRTDDYRLIRYPDVVLDPTLR |
Ga0318516_107221531 | 3300031543 | Soil | VLDAAAAIEWVPGGAVELRTDDYRLIRYPDVVLDPTLRAAQVTW |
Ga0318571_101336502 | 3300031549 | Soil | VSSWTPRRVLDALVAVEWSPDGATEVLTDDYRLIRYPDW |
Ga0318515_107328381 | 3300031572 | Soil | VSSWTPQRVLDAAAAMEWVPSGAVELRTDDYRLIRYPDVVLDPTLRAAQVT |
Ga0310686_1072682961 | 3300031708 | Soil | VSLWTTQRVLDAAAAMEWVPGGAIELRTEDYRMIRYPDVVLDP |
Ga0318496_102212312 | 3300031713 | Soil | VSSWTPRRVLDALVAVEWSPDGATEVLTDDYRLIRYPDWALDPAFPAAQVTRSRTG |
Ga0306917_115450261 | 3300031719 | Soil | VSSWTPQRVLDAAAAMEWVPGGAIELRTDDYRLIRYPDV |
Ga0318500_104082441 | 3300031724 | Soil | VSSWTPQRVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPTLRAAQV |
Ga0318492_105442471 | 3300031748 | Soil | VSSWTPQRVLDAAAAMEWVPSGAVELRTDDYRLIRYPDVV |
Ga0318554_103338941 | 3300031765 | Soil | VSSWTPERVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPTLRAA |
Ga0318526_103329092 | 3300031769 | Soil | MSSWIAQRVLDAAAAMEFVPEGAIEVRTEDYRLVRHPD |
Ga0318543_103430532 | 3300031777 | Soil | VSSWTSQRVLDAAAAMEWVPSGAVELRTDDYRLIRYPDVVLDPTLRA |
Ga0318566_101928923 | 3300031779 | Soil | VSSWTAQRVLDAAAGMEWVPEGVIEMRTDAYRLVRYPDVVLDPTFRAGQA |
Ga0318552_106363942 | 3300031782 | Soil | LNSWTPQRVLDHAAAIEFVPEGGSEVRTDDYRLVRHPDWV |
Ga0318548_101845811 | 3300031793 | Soil | VSSWTPRRVLDSVVAMEWSPDGAIEVRTDDYRLIRYPD |
Ga0318565_105735122 | 3300031799 | Soil | MSSWTAQRVLDAAAATEFVPEGAIEVRTDDYRLVR |
Ga0318567_105516621 | 3300031821 | Soil | VSSWTPQRVLDAAAAMEWVPSGAVELRTDDYRLIRYPDVVLDPT |
Ga0318567_108061821 | 3300031821 | Soil | MEWAPGGAIELRTDDYRVIRYPDLVLDPTFRAAQVTWSRTTRPLDEII |
Ga0318499_101171861 | 3300031832 | Soil | VSSWTPRRVLDALVAVEWSPDGATEVLTDDYRLIRYPDWALDPAFPAAQV |
Ga0318551_104099672 | 3300031896 | Soil | VSSWTPQRVLDAAAAMEWVPGGAIELRTDDYRLIRYPD |
Ga0306921_116892331 | 3300031912 | Soil | VSSWTPERVLDAAAAMEWVPGGAIELRTDDYRLIR |
Ga0310916_108655033 | 3300031942 | Soil | VSSWTAQRVLDAAAGMEWVPEGVIEMRTDAYRLVRYPDVVLDPTF |
Ga0308176_120792731 | 3300031996 | Soil | VLNAWTRGRVLDAVAGMEWHPDGAIEVLADDYRLIR |
Ga0318559_104361231 | 3300032039 | Soil | VSLWTPQRVLDAVVALEWFPDGAVEVRTDDYRLIRYPD |
Ga0318549_102323472 | 3300032041 | Soil | VSSWTPQRVLDAAADIEWVPGGAIELRTDDYRLVRYPDVVLDPT |
Ga0318575_106262432 | 3300032055 | Soil | VSSWTPRRVLDALVAVEWSPDGATEVLTDDYRLIRYPDWALDPAFSAAQVTRSRTG |
Ga0318533_108460102 | 3300032059 | Soil | VSSWTPQRVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPALRAAGYPLH |
Ga0318513_104551012 | 3300032065 | Soil | VSSWTPERVLDAAAAMEWVPGGAIELRTDDYRLIRYPDVVLDPT |
Ga0318524_103747261 | 3300032067 | Soil | VSSWTPRRVLDALVAVEWSPDGATEVLTDDYRLIRY |
Ga0306924_101096361 | 3300032076 | Soil | VSSWTPQRVLDAAAAMEWVPGGAIELRTDDYRLIR |
Ga0311301_119927261 | 3300032160 | Peatlands Soil | LSSWTPQRVLDAAIAMEWRPDGAIEVLTDDYRLIRYPDWALDAVFPAAQVTRSRAGRTRRPADE |
Ga0311301_122798882 | 3300032160 | Peatlands Soil | LSSWTPQRVLDAAIAMEWRPHGAIEVLADDYRLIRYPDWALD |
Ga0307472_1009033312 | 3300032205 | Hardwood Forest Soil | VSSWTPRRVLDAAVAMEWRPDGSLEVLADGYRLIR |
Ga0335085_113337652 | 3300032770 | Soil | VSSWTPRRVLDALVAVEWSPDGATEVLTDDYRLIRYPDWALDPAFPAAQITR |
Ga0335081_113263011 | 3300032892 | Soil | VSGAYSRVVSSWTPRRVLDAAIAMEWRPDGAVEAPSEDYRLI |
Ga0335069_104444771 | 3300032893 | Soil | VLNAWTRGRVLDAVAGMEWHPDGAIEVLADDYRLIRYPDWAL |
Ga0335074_101625131 | 3300032895 | Soil | VLDAAAGMEWVPGGAIELRTDDYKIIRYPDVVLDPTFSAAQVTWS |
Ga0335074_113178221 | 3300032895 | Soil | VSSWTPQRVLDAAAGMEWVPGGAIELRTDDYKIIRYPDVVLDPTFSAAQVTWS |
Ga0335084_106604983 | 3300033004 | Soil | VSSWTPRHVLDAAAASQWCPEGAVEVLTDDYRLIRY |
Ga0335073_118773381 | 3300033134 | Soil | VSSWTPQRVLDAAAAMEWVPAGSVELRTDDYRLIRYPDVVLDPTLR |
Ga0335077_103725361 | 3300033158 | Soil | LNSWTPGRVLDVANEMDWRPDGSIEAPAGDYRLIRYPDWAL |
Ga0335077_110355183 | 3300033158 | Soil | VLNAWTRHRVLDAVAGMEWHPDGAIEVLADDYRLIRYPDWALDPTFPA |
Ga0318519_109062881 | 3300033290 | Soil | VSSWTPQRVLDAAADIEWVSGAAIELRTDDYRLVRYPDVVLDP |
⦗Top⦘ |