NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045307

Metagenome / Metatranscriptome Family F045307

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045307
Family Type Metagenome / Metatranscriptome
Number of Sequences 153
Average Sequence Length 40 residues
Representative Sequence DTLNQVWPEQKKLEPLWFWNNYDVPKAGEPLSYGKTVQP
Number of Associated Samples 137
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.31 %
% of genes near scaffold ends (potentially truncated) 97.39 %
% of genes from short scaffolds (< 2000 bps) 88.89 %
Associated GOLD sequencing projects 127
AlphaFold2 3D model prediction Yes
3D model pTM-score0.16

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.771 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(24.183 % of family members)
Environment Ontology (ENVO) Unclassified
(26.797 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.288 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.48%    β-sheet: 0.00%    Coil/Unstructured: 95.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.16
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 153 Family Scaffolds
PF01370Epimerase 45.75
PF16363GDP_Man_Dehyd 16.34
PF11306DUF3108 7.19
PF13950Obsolete Pfam Family 3.27
PF01904DUF72 1.31
PF12704MacB_PCD 1.31
PF01925TauE 0.65
PF00704Glyco_hydro_18 0.65
PF00696AA_kinase 0.65
PF01979Amidohydro_1 0.65
PF13533Biotin_lipoyl_2 0.65
PF07676PD40 0.65
PF13683rve_3 0.65
PF13646HEAT_2 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 153 Family Scaffolds
COG1801Sugar isomerase-related protein YecE, UPF0759/DUF72 familyGeneral function prediction only [R] 1.31
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.77 %
UnclassifiedrootN/A5.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_100443089All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1176Open in IMG/M
3300002917|JGI25616J43925_10091807All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1261Open in IMG/M
3300003505|JGIcombinedJ51221_10468925All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6508Open in IMG/M
3300004092|Ga0062389_104301435All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6536Open in IMG/M
3300004631|Ga0058899_10867137All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6504Open in IMG/M
3300005177|Ga0066690_10106868All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1804Open in IMG/M
3300005186|Ga0066676_10349797All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium988Open in IMG/M
3300005332|Ga0066388_105229938All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6658Open in IMG/M
3300005434|Ga0070709_10365920All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1069Open in IMG/M
3300005445|Ga0070708_100920892All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium820Open in IMG/M
3300005447|Ga0066689_10069536All Organisms → cellular organisms → Bacteria1947Open in IMG/M
3300005467|Ga0070706_101456575All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6626Open in IMG/M
3300005518|Ga0070699_101782102All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300005542|Ga0070732_10307843All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium951Open in IMG/M
3300005555|Ga0066692_10348795All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300005557|Ga0066704_10067870All Organisms → cellular organisms → Bacteria → Acidobacteria2289Open in IMG/M
3300005560|Ga0066670_10322013All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6941Open in IMG/M
3300005586|Ga0066691_10280670All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium981Open in IMG/M
3300005610|Ga0070763_10537976All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300005844|Ga0068862_101919956All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium602Open in IMG/M
3300006041|Ga0075023_100526222All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6537Open in IMG/M
3300006046|Ga0066652_101392557All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia657Open in IMG/M
3300006059|Ga0075017_101163996All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6603Open in IMG/M
3300006102|Ga0075015_100695562All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia603Open in IMG/M
3300006162|Ga0075030_100365606All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300006173|Ga0070716_100724435All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia762Open in IMG/M
3300006175|Ga0070712_101402350All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6610Open in IMG/M
3300006176|Ga0070765_100849709All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia863Open in IMG/M
3300006176|Ga0070765_101574964All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium618Open in IMG/M
3300006354|Ga0075021_11168449All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6505Open in IMG/M
3300006794|Ga0066658_10924658All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6504Open in IMG/M
3300006797|Ga0066659_10863482All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia754Open in IMG/M
3300006804|Ga0079221_10789952All Organisms → cellular organisms → Bacteria → Acidobacteria678Open in IMG/M
3300006854|Ga0075425_101910960All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia665Open in IMG/M
3300007255|Ga0099791_10165453All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1037Open in IMG/M
3300007258|Ga0099793_10041536All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1997Open in IMG/M
3300007265|Ga0099794_10391433All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300007265|Ga0099794_10743990All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6523Open in IMG/M
3300009038|Ga0099829_10316914All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1280Open in IMG/M
3300009088|Ga0099830_10273906All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1341Open in IMG/M
3300009162|Ga0075423_10677094All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1088Open in IMG/M
3300009792|Ga0126374_10307842All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1066Open in IMG/M
3300010043|Ga0126380_11374160All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300010046|Ga0126384_10081044All Organisms → cellular organisms → Bacteria → Acidobacteria2339Open in IMG/M
3300010325|Ga0134064_10134229Not Available843Open in IMG/M
3300010325|Ga0134064_10338928All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6584Open in IMG/M
3300010326|Ga0134065_10498992All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6507Open in IMG/M
3300010358|Ga0126370_11334780All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300010359|Ga0126376_12560589All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300010361|Ga0126378_10718256All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1111Open in IMG/M
3300010361|Ga0126378_12225446All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6626Open in IMG/M
3300010361|Ga0126378_12570218All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6582Open in IMG/M
3300010362|Ga0126377_11511214Not Available745Open in IMG/M
3300010379|Ga0136449_104330350All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6524Open in IMG/M
3300011120|Ga0150983_13605025All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6532Open in IMG/M
3300011120|Ga0150983_14284306All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6568Open in IMG/M
3300011270|Ga0137391_10451565All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1093Open in IMG/M
3300011270|Ga0137391_11006607All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6678Open in IMG/M
3300011271|Ga0137393_10812366All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium799Open in IMG/M
3300012189|Ga0137388_10170546All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1943Open in IMG/M
3300012189|Ga0137388_10280108All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1525Open in IMG/M
3300012189|Ga0137388_11122854All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300012199|Ga0137383_10019978All Organisms → cellular organisms → Bacteria4622Open in IMG/M
3300012200|Ga0137382_10797992All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300012202|Ga0137363_11469492All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6572Open in IMG/M
3300012202|Ga0137363_11831227All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6500Open in IMG/M
3300012203|Ga0137399_10768722All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium811Open in IMG/M
3300012203|Ga0137399_11207743All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300012210|Ga0137378_11661255All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6546Open in IMG/M
3300012211|Ga0137377_10116541All Organisms → cellular organisms → Bacteria → Acidobacteria2543Open in IMG/M
3300012285|Ga0137370_10134479All Organisms → cellular organisms → Bacteria1420Open in IMG/M
3300012351|Ga0137386_10062982All Organisms → cellular organisms → Bacteria → Acidobacteria2579Open in IMG/M
3300012361|Ga0137360_10327248All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1278Open in IMG/M
3300012362|Ga0137361_10733517All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium901Open in IMG/M
3300012683|Ga0137398_10796214All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300012683|Ga0137398_11116016All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6542Open in IMG/M
3300012918|Ga0137396_10414023All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium999Open in IMG/M
3300012923|Ga0137359_11671177All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300012925|Ga0137419_10569936All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium906Open in IMG/M
3300012944|Ga0137410_10838063All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300012948|Ga0126375_11700546All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6547Open in IMG/M
3300012948|Ga0126375_11721975All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6544Open in IMG/M
3300013297|Ga0157378_12252330All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300014325|Ga0163163_12663719Not Available557Open in IMG/M
3300015053|Ga0137405_1408795Not Available5760Open in IMG/M
3300015054|Ga0137420_1317565All Organisms → cellular organisms → Bacteria4318Open in IMG/M
3300015357|Ga0134072_10391420All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6545Open in IMG/M
3300015373|Ga0132257_101456069All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium873Open in IMG/M
3300016270|Ga0182036_10341681All Organisms → cellular organisms → Bacteria1151Open in IMG/M
3300016341|Ga0182035_12178160Not Available502Open in IMG/M
3300017972|Ga0187781_11306105All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300017975|Ga0187782_11057459All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300017995|Ga0187816_10263399All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300018433|Ga0066667_12170790All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6516Open in IMG/M
3300019789|Ga0137408_1067809All Organisms → cellular organisms → Bacteria → Acidobacteria2279Open in IMG/M
3300020170|Ga0179594_10039400All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1551Open in IMG/M
3300020581|Ga0210399_10032339All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4178Open in IMG/M
3300021168|Ga0210406_10249692All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1456Open in IMG/M
3300021171|Ga0210405_10850011All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300021181|Ga0210388_10411920All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus1188Open in IMG/M
3300021420|Ga0210394_10382307All Organisms → cellular organisms → Bacteria1238Open in IMG/M
3300021478|Ga0210402_10325160All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1425Open in IMG/M
3300021478|Ga0210402_11566135All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6586Open in IMG/M
3300021559|Ga0210409_10062182All Organisms → cellular organisms → Bacteria → Acidobacteria3486Open in IMG/M
3300024182|Ga0247669_1088552All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6521Open in IMG/M
3300024251|Ga0247679_1041423All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300024288|Ga0179589_10231548All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300024331|Ga0247668_1010037All Organisms → cellular organisms → Bacteria → Acidobacteria1976Open in IMG/M
3300025898|Ga0207692_10443130All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium816Open in IMG/M
3300025916|Ga0207663_11479520All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6547Open in IMG/M
3300025935|Ga0207709_11026474All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium675Open in IMG/M
3300026304|Ga0209240_1008720All Organisms → cellular organisms → Bacteria3835Open in IMG/M
3300026324|Ga0209470_1261920All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6685Open in IMG/M
3300026325|Ga0209152_10204074All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300026332|Ga0209803_1089955All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1270Open in IMG/M
3300026335|Ga0209804_1057592All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1876Open in IMG/M
3300026497|Ga0257164_1060377All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6620Open in IMG/M
3300026538|Ga0209056_10034144All Organisms → cellular organisms → Bacteria4753Open in IMG/M
3300026557|Ga0179587_10030096All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3005Open in IMG/M
3300027105|Ga0207944_1008343All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria921Open in IMG/M
3300027565|Ga0209219_1092522All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6747Open in IMG/M
3300027671|Ga0209588_1153098All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300027825|Ga0209039_10035021All Organisms → cellular organisms → Bacteria → Acidobacteria2382Open in IMG/M
3300027855|Ga0209693_10547593All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300027879|Ga0209169_10041421All Organisms → cellular organisms → Bacteria2412Open in IMG/M
3300027895|Ga0209624_10975194All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300027908|Ga0209006_10514490Not Available997Open in IMG/M
3300027908|Ga0209006_11135416All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300028047|Ga0209526_10092659All Organisms → cellular organisms → Bacteria → Acidobacteria2127Open in IMG/M
3300028792|Ga0307504_10395840All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6542Open in IMG/M
3300028906|Ga0308309_10001079All Organisms → cellular organisms → Bacteria16236Open in IMG/M
3300030879|Ga0265765_1002485All Organisms → cellular organisms → Bacteria → Acidobacteria1790Open in IMG/M
3300031421|Ga0308194_10101261All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium828Open in IMG/M
3300031446|Ga0170820_17575997All Organisms → cellular organisms → Bacteria → Acidobacteria997Open in IMG/M
3300031719|Ga0306917_10939107All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium676Open in IMG/M
3300031720|Ga0307469_10539428All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1031Open in IMG/M
3300031720|Ga0307469_11903360All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6576Open in IMG/M
3300031754|Ga0307475_10608643All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium874Open in IMG/M
3300031763|Ga0318537_10150636All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium866Open in IMG/M
3300031823|Ga0307478_10243041All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1461Open in IMG/M
3300031879|Ga0306919_10899723All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6679Open in IMG/M
3300031910|Ga0306923_11647663All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium665Open in IMG/M
3300031912|Ga0306921_11526516All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium729Open in IMG/M
3300031941|Ga0310912_10406222All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1060Open in IMG/M
3300031945|Ga0310913_10194257All Organisms → cellular organisms → Bacteria1416Open in IMG/M
3300031954|Ga0306926_10447744Not Available1591Open in IMG/M
3300031962|Ga0307479_11537655All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6622Open in IMG/M
3300032001|Ga0306922_10550841All Organisms → cellular organisms → Bacteria1226Open in IMG/M
3300032173|Ga0315268_10342965All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera borealis1454Open in IMG/M
3300032205|Ga0307472_101446584All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6669Open in IMG/M
3300032261|Ga0306920_101530288All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium951Open in IMG/M
3300032782|Ga0335082_10798948All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium805Open in IMG/M
3300033004|Ga0335084_11098024Not Available798Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil24.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.19%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil7.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.23%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.92%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.27%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.96%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.31%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.31%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.31%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.31%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.65%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.65%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.65%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.65%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024182Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10EnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027105Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF018 (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030879Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10044308923300002245Forest SoilLDQIWPEKKKLEPLFFWNFDTPKAGEPLSYGKTSLP*
JGI25616J43925_1009180723300002917Grasslands SoilKNEELFEGDTLNHVWPEEKFKPLWFWNYDQSKPGTPLSYGKTVQP*
JGIcombinedJ51221_1046892523300003505Forest SoilFEGDTLNQVWPEQKKLEPLWFWNYDQPKKGEPLSYGTTTQP*
Ga0062389_10430143513300004092Bog Forest SoilGDTLDQVWPEQKKLEPLYFWNFDKPKVGEPLSYGKTVTP*
Ga0058899_1086713723300004631Forest SoilLFEGDTLNEVWPEQKKLEPLWFWNNYDVPKAGEPLSYGNTVQP*
Ga0066690_1010686833300005177SoilFEGDTLNQVWPEQKKLEPLWFWSNYDVPKPGEPLRYGKTAQP*
Ga0066676_1034979723300005186SoilFEGDTLNQVWPEQKKLDPLWFWNNYDAPKAGDPLNYGKITQP*
Ga0066388_10522993813300005332Tropical Forest SoilFEGDTLNQVWPEQKKLEPLWFWNNYDAPKSGEALGYGKTATP*
Ga0070709_1036592023300005434Corn, Switchgrass And Miscanthus RhizosphereDTLNQVWPEQKKLEPLWFWNNYDAPKAGDPLEYGKTVQP*
Ga0070708_10092089223300005445Corn, Switchgrass And Miscanthus RhizosphereVFEGDTLNQVWPEQKKLEPLWFWNNYDAPKAGDPLQYGKTVQP*
Ga0066689_1006953613300005447SoilFEGDTLNQVWPEQKKMEPLWFWNNYDTPKPGDPLNYGKTTQP*
Ga0070706_10145657513300005467Corn, Switchgrass And Miscanthus RhizosphereGDTLNQVWPEQKRLEPLWFWNNYDVPKAGEPLNYGKTVQP*
Ga0070699_10178210213300005518Corn, Switchgrass And Miscanthus RhizosphereFEGDTLNQVWPEQKKLEPLWFWNNYDAPKAGDPLQYGKTVQP*
Ga0070732_1030784323300005542Surface SoilQVWPEQKKLEPLFFWNYDTPKAGEPLSYGKTTLP*
Ga0066692_1034879513300005555SoilGELFEGDTLDQVWPEQRKLGPLWFWNNYDVPKAGDPLSYGKTTQP*
Ga0066704_1006787013300005557SoilNQVWPEQKKLEPLWFRNYDQPKTDGSLSYGKTTTP*
Ga0066670_1032201323300005560SoilGDTLNEVWPEQKKLEPLWFWNYDQPKTGTSMSYGKTMLP*
Ga0066691_1028067013300005586SoilDTLNQVWPEQKKLEPLWFWNNYDAPKAGDPLQYGKTVQP*
Ga0070763_1053797613300005610SoilNQVWPEQKKLEPLYFWNFDAPKAGEPLSYGKTVTP*
Ga0068862_10191995623300005844Switchgrass RhizosphereELFEGDTLNQVWPEQRKLEPLWFWNKYDEPKTGDPLSYGKTAAP*
Ga0075023_10052622213300006041WatershedsLDQVWPEQKKLEPLWFWNFDKPKAGEPLHYGVMTKP*
Ga0066652_10139255713300006046SoilGEVFEGDTLNQVWPEQKKLEPLWFWNNYDAPKAGEPLQYGKTAQP*
Ga0075017_10116399623300006059WatershedsNEVWPEQKKLEPLWFWNNYDVPKSGDPLSYGKTTQP*
Ga0075015_10069556213300006102WatershedsFEGDTLDQVWPEQKKLGPLYFWNFDKPKAGEPLSYGKTVTP*
Ga0075030_10036560613300006162WatershedsTLNQVWPEQKKLEPLFFWNNYDVPKSGDPLSYGKPTQP*
Ga0070716_10072443523300006173Corn, Switchgrass And Miscanthus RhizosphereFEGDTLDQVWPEQKKLEPLYFWNFDKPKAGEPLSYGKTLNP*
Ga0070712_10140235013300006175Corn, Switchgrass And Miscanthus RhizosphereNQVWPEQKKLEPLWFWNNYDVPKSGEPLQYGRTTQP*
Ga0070765_10084970923300006176SoilNGELFEGDTLDQVWPEQKKLEPLYFWNFDKPKAGEPLSYGKTVNP*
Ga0070765_10157496423300006176SoilTLNQVWPDQKKLEPLYFWNYDAPKATEPLSYGKTVTP*
Ga0075021_1116844923300006354WatershedsDTLNEVWPEQKKLEPLWFWNNYDVPKAGDPLSYGKTTQP*
Ga0066658_1092465823300006794SoilTLNQVWPEQRKLEPLWFWNNYDVPKAGEPLNYGKTIQP*
Ga0066659_1086348223300006797SoilFEGDTLNEVWPEQKKLEPLWFWNYDQPKPGAPLSYGKTMLP*
Ga0079221_1078995223300006804Agricultural SoilFEGDTLNEIWPEQKKLEPLWFWNYDQPKSGAPMSYGKTMLP*
Ga0075425_10191096023300006854Populus RhizosphereELFEGDTLNQVWPEQKKLEPLWFWNSYDTPKAGEPLSYGKTTTP*
Ga0099791_1016545313300007255Vadose Zone SoilGDTLNEVWPEQKKLEPLWFWNDYDAPKAGNPLGYGKTTQP*
Ga0099793_1004153613300007258Vadose Zone SoilVWPEQKKLEPLWFWNNYDVPKAGEPLNYGKTAQP*
Ga0099794_1039143323300007265Vadose Zone SoilVWPEQKKLEPLWFWNNYDVPKAGEPLNYGKTLQP*
Ga0099794_1074399013300007265Vadose Zone SoilGDTLNEVWPEQKKLEPLWFWNNYDVPKAGEPLNYGKTVQP*
Ga0099829_1031691423300009038Vadose Zone SoilVWPEQKKLEPLFFWNHYDAPKAGEPLSYGKTAQP*
Ga0099830_1027390613300009088Vadose Zone SoilNGELFEGDTLDQVWPEQKKLEPLFFWSYDTPKAGESLSYGKTTLP*
Ga0075423_1067709413300009162Populus RhizosphereLFEGDTLNQVWPEQKKLEPLWFWNNYDEPKAGDPLSYGKTATP*
Ga0126374_1030784223300009792Tropical Forest SoilELFEGDTLNQVWPEQKKLEPLWFWNKYDEPKAGDSLSYGKTANP*
Ga0126380_1137416013300010043Tropical Forest SoilEGDTMNQVWPEQKKLEPLWFWNNYDVPKAGDPLSYGKTAQP*
Ga0126384_1008104413300010046Tropical Forest SoilTLNQVWPEQKKLEPLWFWNNYDQPKAGDALGYGKTATP*
Ga0134064_1013422923300010325Grasslands SoilEGDTLNEMWPEQKKLEPLWFWNYDQPKTGTSMSYGKTMLP*
Ga0134064_1033892823300010325Grasslands SoilMNGVGVVDETLNQVRPEQKKLEPLFFWNNYDVPTPGEPLSYGKTTTP*
Ga0134065_1049899213300010326Grasslands SoilLDQVWPEQKKLGPLWFWNSYDVPKAGDPLSYGKTTQP*
Ga0126370_1133478013300010358Tropical Forest SoilGELFEGDTLDQVWPEQKKLAPLFFWNHYDEPKAGDPLSYGKTTQP*
Ga0126376_1256058923300010359Tropical Forest SoilVWPEQKKLEPLWFWNSYDAPKAGEPLHYGNTMQP*
Ga0126378_1071825613300010361Tropical Forest SoilGELFEGDTLNQVWPEEKKLEPLFFSNSYDVPKSGDPLSYGKTTTP*
Ga0126378_1222544613300010361Tropical Forest SoilGELFEGDTLNQVWPEEKKLEPLFFSNSYDVPKSGDPLSYGRTTTP*
Ga0126378_1257021823300010361Tropical Forest SoilLNQVWPEQKKLEPLWFWNYDQPKAGAPMSYGKTMLP*
Ga0126377_1151121413300010362Tropical Forest SoilLFEGDTLNQVWPEQKKLEPLWFWNKYDEPKAGDPLSCGKAATP*
Ga0136449_10433035023300010379Peatlands SoilKNGVLYEGDTLNQLWPEQKKLAALWFWDFDKPKAGEPLQYGATNKP*
Ga0150983_1360502513300011120Forest SoilGELFEGDTLDQVWPEQKKLEPLHFWNFDKPKAGEPLSYGKTANP*
Ga0150983_1428430613300011120Forest SoilELFEGDTLDEVWPDEKKLEPLYFWSFDKPKAGEPLSYGKTVNP*
Ga0137391_1045156513300011270Vadose Zone SoilFEGDTLNQVWPEQKKLEPLWFWNNYDAPKPGEPLNYGKTAQP*
Ga0137391_1100660723300011270Vadose Zone SoilEVWPEQKKLEPLWFWNNYDAPKAGDPLSYGKTTQP*
Ga0137393_1081236623300011271Vadose Zone SoilLDQEWRGQKTFEPLWFWKNYDEPKPGEPLNYGKTAQP*
Ga0137388_1017054613300012189Vadose Zone SoilFEGDTLNQVWPEQKTLEPLWFWNNHDAPKAGEPLSYGATAQP*
Ga0137388_1028010833300012189Vadose Zone SoilDTLNQVWPEQKKLEPLWFWNYDQPKNGAPLSYGKTATP*
Ga0137388_1112285423300012189Vadose Zone SoilVWPEQKKLEPLWFWNNYDAPKAGDPLSYGKTTQP*
Ga0137383_1001997853300012199Vadose Zone SoilNQVWPEQKKLEPLWFWNNYDVPKAGEPLNYGKTTQP*
Ga0137382_1079799213300012200Vadose Zone SoilDTLNQVWPEQKKLEPLWFWNNYDVPKPGEPLNYGETKQP*
Ga0137363_1146949223300012202Vadose Zone SoilDTLNQVWPEQKKLEPLWFWNDYDVPKSGEPLSYGKTTQP*
Ga0137363_1183122723300012202Vadose Zone SoilLNQVWPEQKKLEPLWFWNDYDVPKSGAPLSYGKTVTP*
Ga0137399_1076872213300012203Vadose Zone SoilELFEGETLNQVWPEQKKLPPLWFWNNYDVPKAGEPLRYGKTVQP*
Ga0137399_1120774323300012203Vadose Zone SoilDQIWPEQKKLEPLFFWNYDTPKAGEPLSYGKTSLP*
Ga0137378_1166125523300012210Vadose Zone SoilEGDTLDQVWPEQKKLEPLWFWNNYDVPKSGDPLSYGKTTQP*
Ga0137377_1011654133300012211Vadose Zone SoilLDQVWPEQKKLEPLWFWNNYDVPKAGEPLQYGKTATP*
Ga0137370_1013447913300012285Vadose Zone SoilDTLNQVWPEQKKLEPLWFWNNYDVPKAGEPLNYGKTTQP*
Ga0137386_1006298243300012351Vadose Zone SoilFEGDTLNQVWPEQKKLEPLWFWSYDQPKTDGSLSYGKTTTP*
Ga0137360_1032724823300012361Vadose Zone SoilDTLNQVWPEQKKLEPLWFWNDYDVPKSGAPLSYGKTVTP*
Ga0137361_1073351713300012362Vadose Zone SoilGDTLNEVWPEQKKLEPLWFWNNYDVPKAGEPLSYGKTAQP*
Ga0137398_1079621413300012683Vadose Zone SoilTLDQIWPEQKKLEPLFFWNYDTPKAGEPLSYGKTTLP*
Ga0137398_1111601623300012683Vadose Zone SoilGDTLNEVWPEQKKLEPLWFWNNYDAPKAGNPLSYGKTTQP*
Ga0137396_1041402323300012918Vadose Zone SoilDTLNQVWPEQKKLEPLWFWNNYDVPKAGEPLNYGKTAQP*
Ga0137359_1167117723300012923Vadose Zone SoilLNQVWPEQKKLDPLWFWNYDQPNEGPPLSYGKPTQP*
Ga0137419_1056993613300012925Vadose Zone SoilTLNQVWPEQKKLEPLWFWNNYDVPKAGEPLQYGKTATP*
Ga0137410_1083806323300012944Vadose Zone SoilDTLNQVWPEQKKLEPLWFWNNYDVPKAGEPLSYGKTVQP*
Ga0126375_1170054613300012948Tropical Forest SoilEGDTLNQVWPEQKKLEPLWFWSNYDAPKSGDALSYGKTATP*
Ga0126375_1172197513300012948Tropical Forest SoilFEGDTLNQVWPEQKKLEPLWFWNYDQPKQGGALSYGKTTLP*
Ga0157378_1225233013300013297Miscanthus RhizosphereNQVWPEQKKLEPLWFWNKYDEPKVGDPLSYGKTATP*
Ga0163163_1266371913300014325Switchgrass RhizosphereLFEGDTLNQVWPEQKKLEPLWFWNKYDEPKAGDPLSYGKTATP*
Ga0137405_140879533300015053Vadose Zone SoilVKNGEVFEGGYAQPGVAEQKKLEPLWFWNNYDAPKAGEPLEYGKTVQP*
Ga0137420_131756533300015054Vadose Zone SoilLNEVWPEQKKLEPLWFWNNYDMPKQGEPLNYGRPNNLKP*
Ga0134072_1039142013300015357Grasslands SoilKNGELFEGETLNQVWPEQKKLEPLFFWNNYDVPTPGEPLSYGKTTTP*
Ga0132257_10145606923300015373Arabidopsis RhizosphereVWPEQKKLEPLWFWNSYDTPKAGEPLSYGKTTTP*
Ga0182036_1034168113300016270SoilEVWPEEKKLEPLFFWNNYDVPKPGDPLSYGKTTTP
Ga0182035_1217816013300016341SoilEGDTLNQLWPQQKKLEALWFWDFDKQKAGEPLQYGATNKP
Ga0187781_1130610533300017972Tropical PeatlandELFEGDTLNQVWPEQKKLEPLWFWNYDVPKAGEPLSYGKTTQP
Ga0187782_1105745913300017975Tropical PeatlandDTLNQVWPEQKKLEPLFFWNNYDAPKAGEPLSYGKTVQP
Ga0187816_1026339923300017995Freshwater SedimentEVWPEQKKLEPLWFWNNYDAPKAGEPLSYGKTTQP
Ga0066667_1217079013300018433Grasslands SoilQVWPEQKKLEPLWFWNNYDAPKAGDPLSYGKTTQP
Ga0137408_106780913300019789Vadose Zone SoilDTLNRDTLNQVWPEQKKLEPLWFWNNYDAPKAGAPLSYGKTALP
Ga0179594_1003940013300020170Vadose Zone SoilQVWPEQKKLEPLWFWNNYDVPKAGEPLNYGKTVQP
Ga0210399_1003233943300020581SoilNQGWPEQKKLEPLWFWNNYDVPKAGEPLSYGKTATP
Ga0210406_1024969223300021168SoilLFEGDTLNQVWPEQKKLEPLWFWNNHDVPKSGDPLSYGKTTQP
Ga0210405_1085001123300021171SoilDTLDQIWPAQKKLEPLFFWNYDTPKAGEPLSYGKTGLP
Ga0210388_1041192023300021181SoilELFEGDTLNQVWPEQKKLEPLYFWNYDAPKVTEPLSYGKTVTP
Ga0210394_1038230713300021420SoilNQVWPEQKKLEPLWFWNYDQPKKGEPLSYGTTTQP
Ga0210402_1032516023300021478SoilLNEVWPEQKKLEPLWFWNNYDVPKAGEPLSYGKTAQP
Ga0210402_1156613523300021478SoilGDTLNELWPEQKKLEPLWFWNNYDVPKAGEPLSYGKITQP
Ga0210409_1006218213300021559SoilDSLDQVWPQQKKLEPLWFWSFDKPKAGEPLHYGAMTKP
Ga0247669_108855223300024182SoilNGELFVGDTLDQVWPEQKKLEPLYFWNFDKPKAGEPLSYGKTANP
Ga0247679_104142323300024251SoilTLDQVWPEQKKLEPLYFWNFDKPKAGAPLSYGKTANP
Ga0179589_1023154813300024288Vadose Zone SoilFEGDTLNQVWPEQKKLEPLWFWNNYDAPKSGAPLSYGKTVTP
Ga0247668_101003713300024331SoilLDQVWPEQKKLGPLWFWNNYDVPKAGDPLSYGKTAQP
Ga0207692_1044313023300025898Corn, Switchgrass And Miscanthus RhizosphereNGELFEGDTLDQVWPEQKKLEPLFFWNYDTPKAGDPLSYGKTSLP
Ga0207663_1147952013300025916Corn, Switchgrass And Miscanthus RhizosphereDTLDQVWPEQKKLEPLYFWNFDKPKAGEPLSYGKTVNP
Ga0207709_1102647423300025935Miscanthus RhizosphereQVWPEQKKLEPLWFWNKYDEPKAGDPLSYGKTATP
Ga0209240_100872053300026304Grasslands SoilLNQVWPEQKKLEPLWFWNNYDVPKAGEPLNYGKTAQP
Ga0209470_126192013300026324SoilFEGDTLNQVWPEQKKLDPLWLWNNYDAPKAGDPLNYGKITQP
Ga0209152_1020407413300026325SoilTLNQVWPEQRKLEPLWFWNNYDVPKAGEPLNYGKTIQP
Ga0209803_108995523300026332SoilGEMFEGDTLNQVWPEQKKMEPLWFWNNYDTPKPGDPLNYGKTTQP
Ga0209804_105759213300026335SoilFEGDTLNQVWPEQKKLEPLWFWSNYDVPKPGEPLRYGKTAQP
Ga0257164_106037713300026497SoilNQVWPEQKKLEPLWFWNNYDVPKPGEPLNYGKTVQP
Ga0209056_1003414413300026538SoilLNQVWPEQKKLEPLWFWNNYDVPKAGEPLNYGKTVQP
Ga0179587_1003009613300026557Vadose Zone SoilLFEGDTLNQVWPEQKKLEPLWFWNNYDAPRAGDPLTYGKTTQP
Ga0207944_100834323300027105Forest SoilDTLNQLWPQQKKLEALWFWDFDKPKAGEPLQYGATNKP
Ga0209219_109252213300027565Forest SoilFEGDTLDEVWPEQKKLEPLYFWNFDKPKVGEPLSYGKTVNP
Ga0209588_115309813300027671Vadose Zone SoilEVWPEQKKLEPLWFWNNYDVPKAGEPLNYGKTLQP
Ga0209039_1003502113300027825Bog Forest SoilLFEGDTLDQVWPEQKKLEPLYFWNFDKPKVGEPLSYGKTVTP
Ga0209693_1054759323300027855SoilNQVWPEQKKLEPLYFWNFDAPKAGEPLSYGKTVTP
Ga0209169_1004142113300027879SoilEMFEGDTLNQVWPEQKKLEPLYFWNYDAPKVTEPLSYGKTVTP
Ga0209624_1097519423300027895Forest SoilDQVWPEQKKLEPLWFWNNYDAPKAGEPLSYGPTVQP
Ga0209006_1051449013300027908Forest SoilTLDQVWPQKEKLEPLWFWNNYDVPKAGEPLSYGPTVQP
Ga0209006_1113541623300027908Forest SoilLKQVWPERKKLEPLYFWNYDAPKVTKPLSYGKTVTP
Ga0209526_1009265913300028047Forest SoilLEGDTLDQIWPEKKKLEPLFFWNFDTPKAGEPLSYGKTSLP
Ga0307504_1039584023300028792SoilNGELFEGDTLDQVWPEQKKLEPLFFWNFDTPKAGEPLSYGKTTLP
Ga0308309_1000107913300028906SoilDQVWPQQKKLEPLWFWSFDKAKAGEPLHYGDMTKP
Ga0265765_100248513300030879SoilELFEGDTLDQVWPEQKKLEPLYFWNFDKPKAGEPLSYGKTVNP
Ga0308194_1010126123300031421SoilFEGDTLNQVWPQQKKLEPLWFWNNYDVPKPGEPLNYGETKQP
Ga0170820_1757599713300031446Forest SoilGDTLDQVWPEQKKLEPLWFWNNYDVPKAGEPLQYGKTATP
Ga0306917_1093910713300031719SoilFEGDTLDQVWPEQKKLQPLWFWGNYDVPKSGEPLSYGTTTTP
Ga0307469_1053942813300031720Hardwood Forest SoilNQVWPEQKKLEPLWFWNNYDTPKAGEPLSYGKTTAP
Ga0307469_1190336023300031720Hardwood Forest SoilNQVWPEQKKLEPLWFWNNYDVPNSGAPLSYGKTVTP
Ga0307475_1060864313300031754Hardwood Forest SoilFEGDTLNQVWPEQKKLEPLWFWNYDTPKAGEPLSYGKTVTP
Ga0318537_1015063613300031763SoilFEGDTLDQVWPEEKKLETLFFWNHYDVPKPGEPLSYGKTTAP
Ga0307478_1024304123300031823Hardwood Forest SoilLDQVWPEQKKLGPLYFWNFDKPKVGEPLSYGKTVTP
Ga0306919_1089972323300031879SoilDTLNQLWPEQKKLEALWFWDFDKPKAGEPLQYGASNKP
Ga0306923_1164766323300031910SoilQVWPEEKKLEPLFFWNNYDVPKPGDPLSYGKTTTP
Ga0306921_1152651613300031912SoilLNQVWPEQKKLEPLWFWNNYDVPKAGEPLQYGKTTTP
Ga0310912_1040622223300031941SoilTLDQVWPQQKKLPPLWFWSNYDVPKSGEPLSYGKTATP
Ga0310913_1019425723300031945SoilDQIWPEQKKLEPLWFWKFDQPKKGEPLHYGTTTKP
Ga0306926_1044774433300031954SoilLNQLWPEQKKLEALWFWDFDKPKSGAPLQYGPTNKP
Ga0307479_1153765513300031962Hardwood Forest SoilFEGDTLDQVWPEQKKLGPLYFWNFDKPKVGEPLSYGKTVNP
Ga0306922_1055084113300032001SoilFEGDTLNQVWPEQKKLEPLWFWNNYDVPKAGEPLQYGKTTTP
Ga0315268_1034296513300032173SedimentLDQVWPEQKKLEPLWFWNFDQPKAGDSLHYGETKKP
Ga0307472_10144658413300032205Hardwood Forest SoilFEGDTLNQVWPEQKKLEPLWFWNNYDVPKAGEPLSYGKTVQP
Ga0306920_10153028813300032261SoilTLDQVWPEQKKLEPLWFWSDYDVPKSGEPLSYGKTTTP
Ga0335082_1079894823300032782SoilFEGDTLNQVWPEQKKLEPLWFWNNYDVPKSGDPLSYGKTVQP
Ga0335084_1109802423300033004SoilDTMNEIWPEEKKLEPLWFWNFDQPKSGEPLSYGKPTAP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.