NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045288

Metagenome / Metatranscriptome Family F045288

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045288
Family Type Metagenome / Metatranscriptome
Number of Sequences 153
Average Sequence Length 45 residues
Representative Sequence MIQIKDVTKLYPAKEAGNGAGKDNGAIHALDHISLHVTPGEW
Number of Associated Samples 139
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.69 %
% of genes near scaffold ends (potentially truncated) 95.42 %
% of genes from short scaffolds (< 2000 bps) 83.01 %
Associated GOLD sequencing projects 133
AlphaFold2 3D model prediction Yes
3D model pTM-score0.17

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.693 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(8.497 % of family members)
Environment Ontology (ENVO) Unclassified
(23.529 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.209 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.17
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 153 Family Scaffolds
PF02687FtsX 88.24
PF10080FtrD-like 3.92
PF12704MacB_PCD 2.61
PF00005ABC_tran 1.31
PF05649Peptidase_M13_N 0.65
PF01229Glyco_hydro_39 0.65
PF01177Asp_Glu_race 0.65
PF12680SnoaL_2 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 153 Family Scaffolds
COG3664Beta-xylosidaseCarbohydrate transport and metabolism [G] 0.65
COG3590Predicted metalloendopeptidasePosttranslational modification, protein turnover, chaperones [O] 0.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.69 %
UnclassifiedrootN/A1.31 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000579|AP72_2010_repI_A01DRAFT_1007242All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1908Open in IMG/M
3300000955|JGI1027J12803_101665088All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1454Open in IMG/M
3300001356|JGI12269J14319_10199560All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300001867|JGI12627J18819_10226045All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis754Open in IMG/M
3300004092|Ga0062389_100242107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1820Open in IMG/M
3300004153|Ga0063455_100385184All Organisms → cellular organisms → Bacteria → Acidobacteria818Open in IMG/M
3300004633|Ga0066395_10831767All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300005434|Ga0070709_10316399All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1144Open in IMG/M
3300005434|Ga0070709_11064353All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300005437|Ga0070710_10374647All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter948Open in IMG/M
3300005542|Ga0070732_10439269All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300005542|Ga0070732_10865066All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300005591|Ga0070761_11096278All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300005598|Ga0066706_10075459All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2374Open in IMG/M
3300005610|Ga0070763_10281122All Organisms → cellular organisms → Bacteria → Acidobacteria910Open in IMG/M
3300005712|Ga0070764_11046624All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300006028|Ga0070717_10115741All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2292Open in IMG/M
3300006086|Ga0075019_10468254All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300006174|Ga0075014_100128011All Organisms → cellular organisms → Bacteria → Acidobacteria1217Open in IMG/M
3300006796|Ga0066665_10088296All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2247Open in IMG/M
3300006804|Ga0079221_10908233All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300009029|Ga0066793_10732697All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300009090|Ga0099827_11865266All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300009174|Ga0105241_11552449All Organisms → cellular organisms → Bacteria → Acidobacteria639Open in IMG/M
3300009523|Ga0116221_1395696All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300009618|Ga0116127_1175589All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300009764|Ga0116134_1156216All Organisms → cellular organisms → Bacteria → Acidobacteria803Open in IMG/M
3300009839|Ga0116223_10044256All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2940Open in IMG/M
3300010366|Ga0126379_11127765All Organisms → cellular organisms → Bacteria → Acidobacteria890Open in IMG/M
3300010379|Ga0136449_100110575All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5580Open in IMG/M
3300010876|Ga0126361_11057340All Organisms → cellular organisms → Bacteria → Acidobacteria731Open in IMG/M
3300010877|Ga0126356_10735999All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300012357|Ga0137384_10074342All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2825Open in IMG/M
3300012362|Ga0137361_11740916All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300012683|Ga0137398_10633545All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300012922|Ga0137394_11298101All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300012925|Ga0137419_10805918All Organisms → cellular organisms → Bacteria → Acidobacteria768Open in IMG/M
3300012961|Ga0164302_11936721All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300012971|Ga0126369_10075513All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2971Open in IMG/M
3300012977|Ga0134087_10607232All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300012986|Ga0164304_11479342All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300012987|Ga0164307_11096789All Organisms → cellular organisms → Bacteria → Acidobacteria654Open in IMG/M
3300014498|Ga0182019_10125031All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1603Open in IMG/M
3300016422|Ga0182039_11337985All Organisms → cellular organisms → Bacteria → Acidobacteria649Open in IMG/M
3300016445|Ga0182038_11946206All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300017822|Ga0187802_10344835All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300017933|Ga0187801_10476350All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300017940|Ga0187853_10430538All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300017942|Ga0187808_10294514All Organisms → cellular organisms → Bacteria → Acidobacteria731Open in IMG/M
3300017946|Ga0187879_10545965All Organisms → cellular organisms → Bacteria → Acidobacteria643Open in IMG/M
3300017972|Ga0187781_10886671All Organisms → cellular organisms → Bacteria → Acidobacteria649Open in IMG/M
3300017972|Ga0187781_11316199All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300017974|Ga0187777_10830577All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300018006|Ga0187804_10220794All Organisms → cellular organisms → Bacteria → Acidobacteria813Open in IMG/M
3300018046|Ga0187851_10737069All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300018085|Ga0187772_10096972All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1894Open in IMG/M
3300018086|Ga0187769_10962604All Organisms → cellular organisms → Bacteria → Acidobacteria646Open in IMG/M
3300018088|Ga0187771_11524367All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300019787|Ga0182031_1366426All Organisms → cellular organisms → Bacteria → Acidobacteria2468Open in IMG/M
3300020170|Ga0179594_10403594All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300020580|Ga0210403_10046212All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3482Open in IMG/M
3300020580|Ga0210403_10706736All Organisms → cellular organisms → Bacteria → Acidobacteria807Open in IMG/M
3300020581|Ga0210399_10762591All Organisms → cellular organisms → Bacteria → Acidobacteria792Open in IMG/M
3300021170|Ga0210400_10284289All Organisms → cellular organisms → Bacteria → Acidobacteria1356Open in IMG/M
3300021171|Ga0210405_10703009All Organisms → cellular organisms → Bacteria → Acidobacteria781Open in IMG/M
3300021178|Ga0210408_10461456All Organisms → cellular organisms → Bacteria → Acidobacteria1011Open in IMG/M
3300021404|Ga0210389_10655165All Organisms → cellular organisms → Bacteria → Acidobacteria824Open in IMG/M
3300021433|Ga0210391_11356238All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300021474|Ga0210390_10442546All Organisms → cellular organisms → Bacteria → Acidobacteria1097Open in IMG/M
3300021474|Ga0210390_10833343All Organisms → cellular organisms → Bacteria → Acidobacteria762Open in IMG/M
3300021477|Ga0210398_10772325All Organisms → cellular organisms → Bacteria → Acidobacteria775Open in IMG/M
3300021560|Ga0126371_12893982All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300021860|Ga0213851_1629422All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2186Open in IMG/M
3300021861|Ga0213853_10095612All Organisms → cellular organisms → Bacteria → Acidobacteria761Open in IMG/M
3300021861|Ga0213853_10737859All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2168Open in IMG/M
3300022732|Ga0224569_102699All Organisms → cellular organisms → Bacteria → Acidobacteria1421Open in IMG/M
3300022734|Ga0224571_100329All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2489Open in IMG/M
3300024295|Ga0224556_1143480All Organisms → cellular organisms → Bacteria → Acidobacteria584Open in IMG/M
3300025412|Ga0208194_1001153All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5524Open in IMG/M
3300025911|Ga0207654_10990920All Organisms → cellular organisms → Bacteria → Acidobacteria611Open in IMG/M
3300026557|Ga0179587_10448848All Organisms → cellular organisms → Bacteria → Acidobacteria844Open in IMG/M
3300027066|Ga0208236_1014800All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300027537|Ga0209419_1077598All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300027545|Ga0209008_1006845All Organisms → cellular organisms → Bacteria → Acidobacteria2705Open in IMG/M
3300027583|Ga0209527_1004261All Organisms → cellular organisms → Bacteria2911Open in IMG/M
3300027667|Ga0209009_1123838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae657Open in IMG/M
3300027696|Ga0208696_1236086All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300027737|Ga0209038_10245702All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300027826|Ga0209060_10277809All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300027853|Ga0209274_10731994All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300027854|Ga0209517_10060816All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2758Open in IMG/M
3300027884|Ga0209275_10156556Not Available1211Open in IMG/M
3300027889|Ga0209380_10084131All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1828Open in IMG/M
3300027889|Ga0209380_10480669All Organisms → cellular organisms → Bacteria → Acidobacteria725Open in IMG/M
3300027895|Ga0209624_10054521All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2562Open in IMG/M
3300027898|Ga0209067_10447560All Organisms → cellular organisms → Bacteria → Acidobacteria728Open in IMG/M
3300027908|Ga0209006_10302477All Organisms → cellular organisms → Bacteria → Acidobacteria1364Open in IMG/M
3300028047|Ga0209526_10898269All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300028536|Ga0137415_11301020All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300028775|Ga0302231_10487409All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300028800|Ga0265338_10018431All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7470Open in IMG/M
3300028806|Ga0302221_10110034All Organisms → cellular organisms → Bacteria → Acidobacteria1220Open in IMG/M
3300028860|Ga0302199_1088734All Organisms → cellular organisms → Bacteria → Acidobacteria1012Open in IMG/M
3300028866|Ga0302278_10177053All Organisms → cellular organisms → Bacteria → Acidobacteria1082Open in IMG/M
3300028906|Ga0308309_10797937All Organisms → cellular organisms → Bacteria → Acidobacteria820Open in IMG/M
3300029882|Ga0311368_10686540All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300029907|Ga0311329_10235580All Organisms → cellular organisms → Bacteria → Acidobacteria1373Open in IMG/M
3300029917|Ga0311326_10318274All Organisms → cellular organisms → Bacteria → Acidobacteria786Open in IMG/M
3300029945|Ga0311330_10863221All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300029986|Ga0302188_10425530All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300029999|Ga0311339_11272402All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300030043|Ga0302306_10088515All Organisms → cellular organisms → Bacteria → Acidobacteria1203Open in IMG/M
3300030056|Ga0302181_10371554All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300030056|Ga0302181_10417178All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300030520|Ga0311372_11850464All Organisms → cellular organisms → Bacteria → Acidobacteria717Open in IMG/M
3300030580|Ga0311355_10224017All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1948Open in IMG/M
3300030617|Ga0311356_10519093All Organisms → cellular organisms → Bacteria → Acidobacteria1162Open in IMG/M
3300030659|Ga0316363_10028435All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2892Open in IMG/M
3300030741|Ga0265459_12974867All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300030741|Ga0265459_14230806All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300030759|Ga0265745_1009470All Organisms → cellular organisms → Bacteria → Acidobacteria711Open in IMG/M
3300030814|Ga0265741_103732All Organisms → cellular organisms → Bacteria → Acidobacteria960Open in IMG/M
3300030879|Ga0265765_1070534All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300031170|Ga0307498_10344875All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300031198|Ga0307500_10008753All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2070Open in IMG/M
3300031233|Ga0302307_10130884All Organisms → cellular organisms → Bacteria → Acidobacteria1306Open in IMG/M
3300031247|Ga0265340_10466362All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300031708|Ga0310686_105315339All Organisms → cellular organisms → Bacteria → Acidobacteria853Open in IMG/M
3300031708|Ga0310686_116558759All Organisms → cellular organisms → Bacteria → Acidobacteria597Open in IMG/M
3300031715|Ga0307476_10379415All Organisms → cellular organisms → Bacteria → Acidobacteria1043Open in IMG/M
3300031715|Ga0307476_10735761All Organisms → cellular organisms → Bacteria → Acidobacteria730Open in IMG/M
3300031719|Ga0306917_11244532All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300031754|Ga0307475_10247784Not Available1427Open in IMG/M
3300031754|Ga0307475_10823843All Organisms → cellular organisms → Bacteria → Acidobacteria736Open in IMG/M
3300031754|Ga0307475_11527633All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300031823|Ga0307478_10246267All Organisms → cellular organisms → Bacteria → Acidobacteria1451Open in IMG/M
3300031837|Ga0302315_10506577All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300031954|Ga0306926_10066510All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4352Open in IMG/M
3300031962|Ga0307479_11991593All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis530Open in IMG/M
3300032076|Ga0306924_10205528All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2261Open in IMG/M
3300032160|Ga0311301_10069944All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7432Open in IMG/M
3300032174|Ga0307470_10611618All Organisms → cellular organisms → Bacteria → Acidobacteria816Open in IMG/M
3300032515|Ga0348332_14370164All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300032770|Ga0335085_10135995All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3109Open in IMG/M
3300032805|Ga0335078_10066531All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5282Open in IMG/M
3300032805|Ga0335078_10387776All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1839Open in IMG/M
3300032828|Ga0335080_11054403All Organisms → cellular organisms → Bacteria → Acidobacteria825Open in IMG/M
3300032892|Ga0335081_10179589All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2967Open in IMG/M
3300032893|Ga0335069_12001759All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300033004|Ga0335084_12110656All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300033412|Ga0310810_10998440All Organisms → cellular organisms → Bacteria → Acidobacteria716Open in IMG/M
3300033547|Ga0316212_1023516All Organisms → cellular organisms → Bacteria → Acidobacteria863Open in IMG/M
3300033807|Ga0314866_026429All Organisms → cellular organisms → Bacteria → Acidobacteria876Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.50%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa7.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.19%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.88%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.88%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.23%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.23%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.23%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.58%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.92%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.27%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.61%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.61%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds1.96%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.96%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.96%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.96%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.96%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.31%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.31%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.31%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.31%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.31%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.65%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.65%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.65%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.65%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.65%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.65%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.65%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.65%
RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Roots0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000579Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010877Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022732Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1Host-AssociatedOpen in IMG/M
3300022734Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3Host-AssociatedOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027066Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF005 (SPAdes)EnvironmentalOpen in IMG/M
3300027537Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027583Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028860Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3EnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029986Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030759Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030814Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030879Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031837Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033547Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1Host-AssociatedOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AP72_2010_repI_A01DRAFT_100724233300000579Forest SoilMIQIKDVTKLYPAKQVGNGSGKEAGNGAIHALDHISLHVTPGEWL
JGI1027J12803_10166508813300000955SoilMIQIKDVTKLYPAKEAGNGAGKDNANGAIHALDHISLHVAAGEWLSIMGP
JGI12269J14319_1019956023300001356Peatlands SoilMIQIKNVTKLYPAKAAGNENANAKGDQNGAGVIRALDHISLLVAQGEWLSIMGPS
JGI12627J18819_1022604523300001867Forest SoilMIQIKDVTKLYPAKEAGNGSAKDAGNGAIHALDHISLHVTPGEWLSIM
Ga0062389_10024210713300004092Bog Forest SoilMIEIKNVTKLYPAKAAGNENANGNGGRDGAIHALDDISLHVAQGEWLSIMGP
Ga0063455_10038518413300004153SoilMIQIKDVTKLYPAKAAGNGSGKDNGAGSIHALDHISLHVAAGEWLS
Ga0066395_1083176723300004633Tropical Forest SoilMIQIKDVTKLYPAKEAGNGTGKDAVNGTANIHALDHISLH
Ga0070709_1031639913300005434Corn, Switchgrass And Miscanthus RhizosphereMIHIKDVTKLYPAKEAGNGLGKDNGNGAIHALDHISLHVTPGEWLSIM
Ga0070709_1106435313300005434Corn, Switchgrass And Miscanthus RhizosphereMIQIKDVTKLYPAKESGDRENSSIHALDHISLHVTAGEWLSIMGPSGS
Ga0070710_1037464713300005437Corn, Switchgrass And Miscanthus RhizosphereMIQIKNVTKLYPAKEAGNGSGKDNGAIHALDHISLHVTPGEWLSIMGPSGS
Ga0070732_1043926913300005542Surface SoilMIQIKNVTKLYPAKESGKGVGKEEGSIHALDHISLHVQLGEWLS
Ga0070732_1086506613300005542Surface SoilMIQIKNVTKLYPAKESGDGAGKDSANGAIHALDHISLH
Ga0070761_1109627823300005591SoilMIQINNVTKLYPAKEAGNGSGNPKDGPGKDASIHALDHISLHVAAGEWLSIMGPSGSG
Ga0066706_1007545933300005598SoilMIEIKDVTKLYPAKEAGNGSASAAGNGKESGSIHALDHISLHV
Ga0070763_1028112223300005610SoilMIQINDVTKLYPTKEAAVLSGGKDNASIHALDHISL
Ga0070764_1104662413300005712SoilMIQIKDVTKLYPAKAAGDENANPKGEQNGAIHALDHISLNVARGEWLSIMGPS
Ga0070717_1011574113300006028Corn, Switchgrass And Miscanthus RhizosphereMIQIKDVTKLYPAKEAGNESANGDGKIDGKASGKERESGAIHALDHISLHVGAGEW
Ga0075019_1046825413300006086WatershedsMIEIKDVTKLYPAKEAGNGTGKDNGAGSIHALDHISLHVAQGE
Ga0075014_10012801123300006174WatershedsMIQIKDVIKLYPAKEAGNGAGGSGSDNGSIHALDHISLHVAQGEWLSIM
Ga0066665_1008829613300006796SoilMIQIKNVTKLYPAKAAEIGSGNGNATSSSGVIRALDDISLRVVPGEW
Ga0079221_1090823313300006804Agricultural SoilMIQIKDVTKLYPAKEAGNGSGKDNGDGAIHALDHISLHVTPGEWLSIM
Ga0066793_1073269733300009029Prmafrost SoilMIQIKDVTKLYPAKEAGNGNGSGKDNGSGSIHALDHISLHVTQGEWLSIMGPSGSG
Ga0099827_1186526613300009090Vadose Zone SoilMIQIKNVTKLYPAKASGETANGKGDQSGAIHALDHISLHVA
Ga0105241_1155244913300009174Corn RhizosphereMIQIKDVTKLYPAKEAGNGAGKDSSSIHALDHISLHVAAGEWLSIMGPSGS
Ga0116221_139569613300009523Peatlands SoilMIQIKDVTKLYPAKEAGNGNGSGKDNGSSSIHALDHISLHVAPGEWLSIMGPSG
Ga0116127_117558913300009618PeatlandMIEIKDVTKLYPAKAAGNENGNGKENQNGAIHALDHISLHVAQGEWLSIMGP
Ga0116134_115621613300009764PeatlandMIQIKDVTKLYPAKAAGNEKGSGNGGRNSKDKENGAIHALDHISLHVSQ
Ga0116223_1004425613300009839Peatlands SoilMIQIKNVTKLYPAKEAGNGSGNGGGKENGSIHALDHIALQVTPGEWLSIMG
Ga0126379_1112776523300010366Tropical Forest SoilMIQIKDVSKRYPAKKARSGMGKDSGNGAIHGLDHIS
Ga0136449_10011057573300010379Peatlands SoilMIEIKDVTKLYPAKAAGNENGNGKENQNGAIHALDHISLHVAQGEWLSIMGPSG
Ga0126361_1105734023300010876Boreal Forest SoilMIQINDVTKLYPSQGAGQDGASGNESKGDAIHALDHISLQV
Ga0126356_1073599923300010877Boreal Forest SoilMIQIKDVTKLYPAKAAGNENGNESQSSAIHALDHISLHVAQD
Ga0137384_1007434243300012357Vadose Zone SoilMIQIKDVTKLYPAKEAGNGSGKDASSGSIHALDHISL
Ga0137361_1174091613300012362Vadose Zone SoilMIEIRDVTKLYPAKEAGDGSASAAGNGRDSGSIHALDHISLHVAAGE
Ga0137398_1063354523300012683Vadose Zone SoilMIQIKDVTKLYPAKAAGNENGKESQSSAIHALDHISLHVAQGEWLSIMGPSGSGK*
Ga0137394_1129810123300012922Vadose Zone SoilMIEIKDVTKLYPAKESGNGSVSAADNGRESSSIHALDHISLHVAAG*
Ga0137419_1080591833300012925Vadose Zone SoilMIEIKDVTKLYPAKESGDAGASVAGNGKESGSIHALDHIS
Ga0164302_1193672123300012961SoilMIQIKNVTKLYPAKEAGNGSGKDDGSIHALDHINLHV
Ga0126369_1007551313300012971Tropical Forest SoilMIQIKDVIKLYPAKEAGSGMGKDSGNGAIHALDHISLHVAKGEWLS
Ga0134087_1060723213300012977Grasslands SoilMIQIKDVTKLYPAKEAGNGTGKDNAAIHALDHISLHVAA
Ga0164304_1147934213300012986SoilMIQIKDVTKLYPAKEAGNGAGKDNGAIHALDHISLHVTPGEW
Ga0164307_1109678913300012987SoilMIQIKDVTKLYPAKEAGNGGARDPGAIHALDHISLHVASG
Ga0182019_1012503143300014498FenMIQIKDVIRLYPAKESNNGSGKDKDKDSSIHALDHISLHVAQGEWLSIMGPS
Ga0182039_1133798513300016422SoilMIQIKNVTKLYPAKESGNGAKDNNGNGAIHALDHINLHVVPGEW
Ga0182038_1194620613300016445SoilMIQIKDVTKLYPAKEAGSAKENGSSAIHALDHISLHVTPGE
Ga0187802_1034483513300017822Freshwater SedimentMIQIKDVTKLYPAKEAANGGNGSAKESASIHALDHISLHVTKGEWLSIMGPS
Ga0187801_1047635013300017933Freshwater SedimentMIQIKDVTKLYPAKEAGNGSGKENGLIHALDHISLHVEAGEWLSIMGPSG
Ga0187853_1043053813300017940PeatlandMIQIKDVTKLYPAKAAGNENGNGKENQNGAIHALDHISLHV
Ga0187808_1029451423300017942Freshwater SedimentMIQIKDVTKLYPAKAAGNENGSGKENGNGAIHALDHISL
Ga0187879_1054596513300017946PeatlandMIQIKDVTKLYPAKEAGNGKGSGKDDASGFISALD
Ga0187781_1088667113300017972Tropical PeatlandMIQIKNVTKLYPAKEEGNGNGAGRGNGAIHALDHISLHVTKGEW
Ga0187781_1131619913300017972Tropical PeatlandVTKLYPANEAAGAEAAGKVKESSAIHALDHISLHVTPGEWLSIMGPSGSG
Ga0187777_1083057723300017974Tropical PeatlandMIQINNVTKLYPAKEAGDASGKDNGAIHALDHISLHVVSGEWLSIMG
Ga0187804_1022079413300018006Freshwater SedimentMIQIKDVTKLYPAKEAGNGSGKENGSIHALDHISLQVEAGEWLSIMGPSGS
Ga0187851_1073706913300018046PeatlandMIQINDVTKLYPAKEAGNGSGKDNGASSIHALDHISLH
Ga0187772_1009697233300018085Tropical PeatlandMIQIKDVTKLYPAKAAGNESANGNGGGNGKDNGAIR
Ga0187769_1096260413300018086Tropical PeatlandMIQIKNVTKLYPAKEVGNGNGSGKDNGMIHALDHISLHVT
Ga0187771_1152436713300018088Tropical PeatlandMIEIKNVTKLYPAKEAGNGNGSGKDNGSIHALDHIS
Ga0182031_136642613300019787BogMIQIKNVTKLYPAKAAGNEKDNAKGNQNSAIHALDHISLHVAQGEWLSIMGPSGRVNRRW
Ga0179594_1040359423300020170Vadose Zone SoilMIEITNVAKLYPAKELGNERGNGAGKESGSIHALDHISLHVAPG
Ga0210403_1004621213300020580SoilMIQIKDVTKLYPAKESAAAGGGKDNASIHALDHISLHVAAGE
Ga0210403_1070673613300020580SoilMIQIKDVTKLYPAKQSGDGPAKDVASSIHALDHISLHV
Ga0210399_1076259113300020581SoilMIRIKDVTKLYSAKGAGNEDSNVKESQSGAIHALDRISLDVA
Ga0210400_1028428913300021170SoilMIQIKNVTKLYPAKEAGGVNGAAGSSSIHALEQISLHVAAGEWLSIMG
Ga0210405_1070300913300021171SoilMIQIKDVTKLYPAKEAGTGKGSGKDERSAKDEDSGFIRALDHISLHVTQGEWLSIMGPSGSGK
Ga0210408_1046145613300021178SoilMIQIKDVTKIYPAKETGNGSGKDNIHALDHISLHVAQGEWLSIM
Ga0210389_1065516523300021404SoilMIQIKGVTKLYPAKAAGDENANPKGEQNGVIHALDHISLNVARGEWLSIMGPS
Ga0210391_1135623813300021433SoilMIQIKDVTKLYPAKEAGDGKDGGSGFISALDHISLHVTQGEWLSIMGPSGS
Ga0210390_1044254623300021474SoilMIQIKNVTKLYPAKAAGNGTGKDNGASSIHALDHISLHVRPGE
Ga0210390_1083334313300021474SoilMIQIKDVTKLYPAQESGNGTGKDNSASSIHALDHISLHVAQGEWLSIM
Ga0210398_1077232513300021477SoilMIQIKDVTKLYPAKAAGNEAANGGRNGKESGAIHALDHISLHVS
Ga0126371_1289398223300021560Tropical Forest SoilMIQIKDVTKLYPAKEAADGGSQPGSGKDNGVIHALDHISLHVTVGEWLSI
Ga0213851_162942213300021860WatershedsMIQIKDVIKLYPAKEAGSGAGGSGSDNGSIHALDHISLHVAQGEWLSIMGPSGS
Ga0213853_1009561213300021861WatershedsMIEIKDVTKLYPAKESGNGSGTNKDNGSIHALDHISLHV
Ga0213853_1073785913300021861WatershedsMIQIKDVTKLYPAKEAGSGNGSGKDNSSIHALDHISLHVTAGEWLS
Ga0224569_10269923300022732RhizosphereMIQINNVTKLYPSQGAGQENASGKESPKGAIHALDHISLHVAQGEWLSIMGPSGSG
Ga0224571_10032933300022734RhizosphereMIQINNVTKLYPSQGAGQENASGKESPKGAIHALDHISLHVAQG
Ga0224556_114348023300024295SoilMIQIKNVTKLYPAKAAGNENENGKGNQNGAINALD
Ga0208194_100115313300025412PeatlandMIQIKDVTKLYPAKAAGNPTSPGQNGAIHALDHISLHVAQGEWLSIMGPSGS
Ga0207654_1099092023300025911Corn RhizosphereMIQIKDVTKLYPAKEAGNGTGKDNAAIHALDHISLHVAAGEWLSIM
Ga0179587_1044884813300026557Vadose Zone SoilMIQIKDVTKLYPAKAAGNENSKESQSSAIHALDHISLHVAQGEWLSIMGP
Ga0208236_101480023300027066Forest SoilMIEIKNATKLYPAKESRAAKDLAASIHALDHISLNVAP
Ga0209419_107759823300027537Forest SoilMIQIKDVTKLYPAKEAGNGAGKDASSSSIHALDHISLHVTQGEW
Ga0209008_100684543300027545Forest SoilMIEIKDVTKLYPSQGAGQESANGKEHQSAAIHALDHISLRVLAGEWLS
Ga0209527_100426163300027583Forest SoilMIQIKNVTKLYPAKAADIGSGNGNASSSSGVIRALDDISLHVEPGEWLSIMGPSGS
Ga0209009_112383823300027667Forest SoilMIQIKDVTKLYPAKEAGNGTGKDSSVHALDHISLH
Ga0208696_123608623300027696Peatlands SoilMIQIKNVTKLYPAKESGNGNGAGKDNGSIHALDHISLHVTQGEWLSIMGP
Ga0209038_1024570213300027737Bog Forest SoilMIQIKDVTKLYPAKAAGNEKGNDSSIHALDHISLHVAKGEWLSIMGPSG
Ga0209060_1027780913300027826Surface SoilMIQIKDVTKLYPAKESGNGTGKDSGAIHALDHISLH
Ga0209274_1073199423300027853SoilMIQINNVTKLYPAKEAGNGSGNPKDGPGKDASIHALDHISLHVAAGEWLSIMGPSGSGK
Ga0209517_1006081643300027854Peatlands SoilMIQIKNVTKLYPAKEAGNGNGSGKDNGAIHALDHISLHVTKGEWLSIMGP
Ga0209275_1015655613300027884SoilMIQIKDVTKLYPAKEAGDGKDGGSGFISALDHISLHVTQ
Ga0209380_1008413133300027889SoilMIEIKNVTKLYPAQAAGNEPAKGEQSGTIHALDDISLH
Ga0209380_1048066923300027889SoilMIQIKNVTKLYPAKAAGNGTGKDNGASSIHALDHISLH
Ga0209624_1005452133300027895Forest SoilMIQIKDVTKLYPSQGAGQESANGKENQSPAIHALDHISL
Ga0209067_1044756023300027898WatershedsMIQIKDVTKLYPAKESGNGTGKDNSASSIHALDHISLN
Ga0209006_1030247713300027908Forest SoilMIQIKDVTKLYPAKESGNGPGKDKDKDGASIHALDHISLHV
Ga0209526_1089826923300028047Forest SoilMIQIKDVTKLYPAKESGNENAGGKEKESGAIHALDHISLDVAPGEWLSIMG
Ga0137415_1130102013300028536Vadose Zone SoilMIQIKDVTKLYPAKESGKESAKGGGKENAKESGAIHALDH
Ga0302231_1048740923300028775PalsaMIQINNVTKLYPSQGAGQESANGKESQNDAIHALDRISLHVAQGEWLSIMGPSGSGK
Ga0265338_1001843123300028800RhizosphereMIQIKDVTKLYPAKETGNGSGKDNIHALDHISLHVTQGEWLSIMGP
Ga0302221_1011003423300028806PalsaMIQIKNVTKLYPSKAAGNETAAGKENQNSSIHALDH
Ga0302199_108873423300028860BogMIQIKDVTKLYPAKGAGKEPAGENPGKENGSIHALDHISLHVAKGE
Ga0302278_1017705313300028866BogMIQIKDVTKLYPAKAAGNGNGKAEQNSSIHALDHISLHVAQGEWLSIMGPSGSG
Ga0308309_1079793723300028906SoilMIQIKDVTKLYPAKESGPAGGSGEDNGSGFIHALDHI
Ga0311368_1068654013300029882PalsaMIEIKNVTKLYPAKAAGNEGANGAGNQSGAIHALD
Ga0311329_1023558033300029907BogMIQIKNVTKLYPAKAAGNEKDNGKGNQNSAIHALDHISLHVAQG
Ga0311326_1031827413300029917BogMIQIKNVSKLYPAKAAGNENASGKESQNGAIHALDHISLHVAQGEWLSIMGPSGSG
Ga0311330_1086322123300029945BogMIQIKNVTKLYPAKAAGNEKDNGKGNQNSAIHALDHISLHVAQGEWL
Ga0302188_1042553023300029986BogMIQIKDVTKLYPAKGAGKEPAGENPGKENGSIHALDHISLHVAKGEWLSIMGP
Ga0311339_1127240213300029999PalsaMIQIKNVSKLYPAKAAGNENASGKESQNGAIHALDHISLHVAQGEWLSIMG
Ga0302306_1008851523300030043PalsaMIQIKDVTKLYPAKETGNGSGKDATSIHALDDISLHVAAGEWLSIMGPSGS
Ga0302181_1037155413300030056PalsaMIQINNVTKLYPSQGAGQESANGKESQNDAIHALDRISLH
Ga0302181_1041717813300030056PalsaMIQIKNVTKLYPAKAAGNENASGKENQNGAIHALDHISLHVAQ
Ga0311372_1185046423300030520PalsaMIQIKNVTKLYPAKAAGNENASGKENQNGAIHALDHISLHVAQGEWLSIMGPSGSG
Ga0311355_1022401733300030580PalsaMIQINNVTKLYPSQGAGQESANGKESQNDAIHALDRISLHVAQGEWLSIMGPSG
Ga0311356_1051909313300030617PalsaMIEIKNVTKLYPAKAAGNESATGPGNQNGAIHALDHISLHVAQGEWLSIMGPSGSG
Ga0316363_1002843543300030659Peatlands SoilMIQIKNVTKLYPAKEAGNGSGNGGGKENGSIHALDH
Ga0265459_1297486723300030741SoilVIRIEDVTKLYPAKAGGSENANAKENQSSAIHALDHISLHVAPGE
Ga0265459_1423080613300030741SoilMIEIKDATKLYPAKESRAARDSAASIHALDHISLDVAPGEWVSIMGPS
Ga0265745_100947013300030759SoilMIQIKGVTKLYPAKAAGDENANGKGEQNGVIHALDHISLN
Ga0265741_10373213300030814SoilMIQINDVTKLYPAKEAAIASGGKDNASIHALDHITLHV
Ga0265765_107053413300030879SoilMIQIKDVTKLYPAKAAGNESANGKGEQNGAIHALDHISLDVARGEWLSIMGP
Ga0307498_1034487513300031170SoilMIQIKDVTKLYPAKEVGNGSGKDNASIHALDHISL
Ga0307500_1000875313300031198SoilMIQIKGVTKLYPAKEAGNGTGKDNGSGSIHALDHISLHVAQGEWLSI
Ga0302307_1013088423300031233PalsaMIQINDVTKLYPAKETASTGAKDNASIHALDHISLHVAAGEWLSIMGPS
Ga0265340_1046636213300031247RhizosphereMIQIKDVTKLYPAKETGNGSGKDNIHALDHISLHVTQGEWLSI
Ga0310686_10531533913300031708SoilMIEIKNVTKLYPAKAAGNEHAKGMGAQSGAIHALDDISLQVAQG
Ga0310686_11655875913300031708SoilMIQIKEVTKLYPAKAGENENASGKEGQNGAIHALDHISLHVAQGEW
Ga0307476_1037941523300031715Hardwood Forest SoilMIQIKDVTKLYPAKAAGDENANGKGEQNGAIHALDHISLRVAQGEWLSIMGP
Ga0307476_1073576113300031715Hardwood Forest SoilMIQIKDVTKLYPAKAAGNENGKDSQSGAIHALDHISL
Ga0306917_1124453213300031719SoilMIQIKNVTKLYPAKESGNGAKDNNGNGAIHALDHINLHVV
Ga0307475_1024778433300031754Hardwood Forest SoilMIQIKDVTKLYPAKESGNGTGKDNGAGSIHALDHISLH
Ga0307475_1082384313300031754Hardwood Forest SoilMIQIKDVTKLYPAREAGNERGDGKESQNAVIHALD
Ga0307475_1152763323300031754Hardwood Forest SoilMIQIKDVTKLYPAKEVENASGNGAGKDSGSIHALDHISLHVAP
Ga0307478_1024626723300031823Hardwood Forest SoilMIEIKDITKLYPAKEAGDRADGSGRDSGSIHALDHISLHVALGEWLSIMGPSGSG
Ga0302315_1050657723300031837PalsaMIQIKNVSKLYPAKAAGNENASGKENQNGAIHALDHISLHVAQG
Ga0306926_1006651033300031954SoilMIQIKDVTKLYPAKEAGDGSAKDAGNGAIHALDHISLHVTPGEWL
Ga0307479_1199159323300031962Hardwood Forest SoilMIQIKNVTKLYPAKAAEIASGNGNAASSSGVIRALDDISLHVVPGEWLSIMGPSGSGK
Ga0306924_1020552813300032076SoilMIQIKDVTKLYPAKEAGDGSAKDAGNGAIHALDHISLHVTPGEW
Ga0311301_1006994473300032160Peatlands SoilMIQIKNVTKLYPAKAAENDSANGNGSQNGAIHALDHISLHVAQG
Ga0307470_1061161823300032174Hardwood Forest SoilMIQIKDVTKLYPAKAAGNENGKESQSSAIHALDHIS
Ga0348332_1437016413300032515Plant LitterMIRIKDVTKLYPAKGAGNENSNVKESQSGAIHALDHISLDVAP
Ga0335085_1013599543300032770SoilMIQIKNVTKLYPAKEAGYGSGKDNGNGAIHALDHINLHVTPGEWLS
Ga0335078_1006653163300032805SoilMIQIKNVTKLYPAKEAGNGAGKENNGAIHALDHISLHVTAGEWLS
Ga0335078_1038777623300032805SoilMIQIKNVTKLYPAKESGNGSGKDNGAIHALDHISLHVTPGEWLSIMGPPAQGNRRWSI
Ga0335080_1105440323300032828SoilMIQIKNVTKLYPAKEAGNGTGKDNGNGAIHALDHINLH
Ga0335081_1017958913300032892SoilMIQIKNVTKLYPAKEAGNGTGKDNGNGAIHALDHISLHVTAGEWLSIMGPSGS
Ga0335069_1200175913300032893SoilMIQIKNVTKLYPAKASGNGAGKDNGSIHALDHISLHVT
Ga0335084_1211065623300033004SoilMIQIKDVTKLYPAKASGNGSGKDNGGGSIHALDHISLHVTAGE
Ga0310810_1099844023300033412SoilMIQIKDVTKLYPAKEIDGPGKESGAIHALDHISLHVAPGEWLSIMGPSGS
Ga0316212_102351623300033547RootsMIQIKDVTKRYPAQETGNGKDGGSGFISALDHISL
Ga0314866_026429_756_8753300033807PeatlandMIQIKNVTKLYPAKEAGNGTGKDNGAIHALDHISLHVTKG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.