NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045268

Metagenome / Metatranscriptome Family F045268

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045268
Family Type Metagenome / Metatranscriptome
Number of Sequences 153
Average Sequence Length 40 residues
Representative Sequence THVKVTHSGLADLPIARKDYSGGWPGVVEMLKKFVEK
Number of Associated Samples 133
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.61 %
% of genes near scaffold ends (potentially truncated) 86.93 %
% of genes from short scaffolds (< 2000 bps) 90.85 %
Associated GOLD sequencing projects 126
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.850 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.765 % of family members)
Environment Ontology (ENVO) Unclassified
(22.876 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.980 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.77%    β-sheet: 0.00%    Coil/Unstructured: 69.23%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 153 Family Scaffolds
PF08327AHSA1 64.71
PF01174SNO 7.84
PF00919UPF0004 5.88
PF07238PilZ 3.27
PF04055Radical_SAM 1.31
PF02604PhdYeFM_antitox 0.65
PF01734Patatin 0.65
PF01242PTPS 0.65
PF11645PDDEXK_5 0.65
PF00383dCMP_cyt_deam_1 0.65
PF01938TRAM 0.65
PF04168Alpha-E 0.65
PF00392GntR 0.65
PF02463SMC_N 0.65
PF13744HTH_37 0.65
PF01850PIN 0.65
PF13414TPR_11 0.65
PF05988DUF899 0.65
PF00677Lum_binding 0.65
PF01613Flavin_Reduct 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 153 Family Scaffolds
COG0118Imidazoleglycerol phosphate synthase glutamine amidotransferase subunit HisHAmino acid transport and metabolism [E] 7.84
COG0311Pyridoxal 5'-phosphate synthase subunit PdxT (glutamine amidotransferase)Coenzyme transport and metabolism [H] 7.84
COG0621tRNA A37 methylthiotransferase MiaBTranslation, ribosomal structure and biogenesis [J] 5.88
COG0307Riboflavin synthase alpha chainCoenzyme transport and metabolism [H] 0.65
COG07206-pyruvoyl-tetrahydropterin synthaseCoenzyme transport and metabolism [H] 0.65
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.65
COG1853FMN reductase RutF, DIM6/NTAB familyEnergy production and conversion [C] 0.65
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.65
COG2307Uncharacterized conserved protein, Alpha-E superfamilyFunction unknown [S] 0.65
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.65
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.65
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.65
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.65

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.85 %
UnclassifiedrootN/A9.15 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_100941843All Organisms → cellular organisms → Bacteria → Acidobacteria1018Open in IMG/M
3300002245|JGIcombinedJ26739_100438051All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300002245|JGIcombinedJ26739_101011003All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300004152|Ga0062386_100350112All Organisms → cellular organisms → Bacteria1183Open in IMG/M
3300004152|Ga0062386_100737473All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300005166|Ga0066674_10531983All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300005184|Ga0066671_10780224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales612Open in IMG/M
3300005436|Ga0070713_100188779All Organisms → cellular organisms → Bacteria → Proteobacteria1856Open in IMG/M
3300005444|Ga0070694_101940275All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300005541|Ga0070733_10699101All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300005542|Ga0070732_10766789All Organisms → cellular organisms → Bacteria → Acidobacteria588Open in IMG/M
3300005542|Ga0070732_11039390Not Available501Open in IMG/M
3300005555|Ga0066692_10657016Not Available653Open in IMG/M
3300005586|Ga0066691_10953310All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300005843|Ga0068860_100319096All Organisms → cellular organisms → Bacteria1525Open in IMG/M
3300005995|Ga0066790_10137726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1046Open in IMG/M
3300006028|Ga0070717_10186209All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1812Open in IMG/M
3300006031|Ga0066651_10181003Not Available1112Open in IMG/M
3300006031|Ga0066651_10230776All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae981Open in IMG/M
3300006032|Ga0066696_10283534Not Available1074Open in IMG/M
3300006059|Ga0075017_100720201All Organisms → cellular organisms → Bacteria → Acidobacteria768Open in IMG/M
3300006102|Ga0075015_100629734All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300006162|Ga0075030_101048088All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300006174|Ga0075014_100807043All Organisms → cellular organisms → Bacteria → Proteobacteria555Open in IMG/M
3300006354|Ga0075021_10086938All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1844Open in IMG/M
3300006354|Ga0075021_10760069All Organisms → cellular organisms → Bacteria → Proteobacteria625Open in IMG/M
3300009029|Ga0066793_10865365All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300009090|Ga0099827_10519259All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1024Open in IMG/M
3300009520|Ga0116214_1120469All Organisms → cellular organisms → Bacteria → Acidobacteria969Open in IMG/M
3300009520|Ga0116214_1259304All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus661Open in IMG/M
3300009635|Ga0116117_1029101Not Available1373Open in IMG/M
3300009700|Ga0116217_10524994All Organisms → cellular organisms → Bacteria → Acidobacteria742Open in IMG/M
3300009824|Ga0116219_10518639All Organisms → cellular organisms → Bacteria → Acidobacteria658Open in IMG/M
3300009826|Ga0123355_11541575All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300009839|Ga0116223_10045244All Organisms → cellular organisms → Bacteria2901Open in IMG/M
3300010043|Ga0126380_11023300All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300010048|Ga0126373_11210367All Organisms → cellular organisms → Bacteria → Acidobacteria821Open in IMG/M
3300010048|Ga0126373_12735931Not Available550Open in IMG/M
3300010323|Ga0134086_10010815All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2810Open in IMG/M
3300010361|Ga0126378_11444185All Organisms → cellular organisms → Bacteria → Acidobacteria779Open in IMG/M
3300010366|Ga0126379_11896170All Organisms → cellular organisms → Bacteria → Acidobacteria699Open in IMG/M
3300010375|Ga0105239_10585440All Organisms → cellular organisms → Bacteria1272Open in IMG/M
3300010376|Ga0126381_104698546All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300011119|Ga0105246_12343102All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300012201|Ga0137365_10760635All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium708Open in IMG/M
3300012205|Ga0137362_11277836All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300012209|Ga0137379_11175168Not Available674Open in IMG/M
3300012359|Ga0137385_11256254All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium603Open in IMG/M
3300012363|Ga0137390_10208202All Organisms → cellular organisms → Bacteria1943Open in IMG/M
3300012917|Ga0137395_10553700All Organisms → cellular organisms → Bacteria → Acidobacteria830Open in IMG/M
3300012944|Ga0137410_11684459All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300013307|Ga0157372_13057201All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300014150|Ga0134081_10087776All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae967Open in IMG/M
3300014153|Ga0181527_1291576All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium646Open in IMG/M
3300014638|Ga0181536_10284827All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. Ant17775Open in IMG/M
3300015241|Ga0137418_10560005All Organisms → cellular organisms → Bacteria → Acidobacteria903Open in IMG/M
3300017822|Ga0187802_10346351All Organisms → cellular organisms → Bacteria → Acidobacteria583Open in IMG/M
3300017823|Ga0187818_10340407Not Available661Open in IMG/M
3300017930|Ga0187825_10107733All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300017932|Ga0187814_10362133All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300017934|Ga0187803_10414789All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300017936|Ga0187821_10278156All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300017938|Ga0187854_10196422All Organisms → cellular organisms → Bacteria → Acidobacteria894Open in IMG/M
3300017948|Ga0187847_10504784All Organisms → cellular organisms → Bacteria → Acidobacteria671Open in IMG/M
3300017955|Ga0187817_10991916All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300017972|Ga0187781_11062095All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium593Open in IMG/M
3300017975|Ga0187782_10568741All Organisms → cellular organisms → Bacteria → Acidobacteria870Open in IMG/M
3300017975|Ga0187782_11241880All Organisms → cellular organisms → Bacteria → Acidobacteria584Open in IMG/M
3300017975|Ga0187782_11417938All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300017995|Ga0187816_10519308All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300018042|Ga0187871_10089394All Organisms → cellular organisms → Bacteria → Proteobacteria1786Open in IMG/M
3300018062|Ga0187784_11157222All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium614Open in IMG/M
3300018090|Ga0187770_10972589All Organisms → cellular organisms → Bacteria → Acidobacteria682Open in IMG/M
3300019887|Ga0193729_1056121All Organisms → cellular organisms → Bacteria1588Open in IMG/M
3300020021|Ga0193726_1009448All Organisms → cellular organisms → Bacteria → Acidobacteria5334Open in IMG/M
3300020199|Ga0179592_10177895All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300020581|Ga0210399_10015394All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6034Open in IMG/M
3300021171|Ga0210405_11165211All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300021171|Ga0210405_11214730All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300021171|Ga0210405_11356142All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300021178|Ga0210408_11025142All Organisms → cellular organisms → Bacteria → Acidobacteria638Open in IMG/M
3300021404|Ga0210389_11003418All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300021405|Ga0210387_10521238All Organisms → cellular organisms → Bacteria → Acidobacteria1057Open in IMG/M
3300021406|Ga0210386_11358985All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300021407|Ga0210383_10284287All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1422Open in IMG/M
3300021407|Ga0210383_10785485All Organisms → cellular organisms → Bacteria → Acidobacteria816Open in IMG/M
3300021420|Ga0210394_10422060All Organisms → cellular organisms → Bacteria → Acidobacteria1174Open in IMG/M
3300021420|Ga0210394_11443421All Organisms → cellular organisms → Bacteria → Acidobacteria584Open in IMG/M
3300021433|Ga0210391_10244876All Organisms → cellular organisms → Bacteria → Acidobacteria1408Open in IMG/M
3300021559|Ga0210409_10736785All Organisms → cellular organisms → Bacteria → Acidobacteria857Open in IMG/M
3300022557|Ga0212123_10103418All Organisms → cellular organisms → Bacteria → Acidobacteria2318Open in IMG/M
3300023090|Ga0224558_1053913All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1619Open in IMG/M
3300024251|Ga0247679_1072491All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300025507|Ga0208188_1126740All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300025911|Ga0207654_11098951All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300025927|Ga0207687_11305195All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300025949|Ga0207667_11250745All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300026088|Ga0207641_11427893All Organisms → cellular organisms → Bacteria → Acidobacteria693Open in IMG/M
3300026095|Ga0207676_10548889All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300026277|Ga0209350_1034241Not Available1507Open in IMG/M
3300026314|Ga0209268_1071641Not Available1038Open in IMG/M
3300026318|Ga0209471_1028283All Organisms → cellular organisms → Bacteria2763Open in IMG/M
3300026324|Ga0209470_1048166All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2068Open in IMG/M
3300026326|Ga0209801_1129224Not Available1079Open in IMG/M
3300026330|Ga0209473_1204463Not Available744Open in IMG/M
3300027625|Ga0208044_1194550All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300027641|Ga0208827_1175170All Organisms → cellular organisms → Bacteria → Acidobacteria583Open in IMG/M
3300027652|Ga0209007_1162762All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300027729|Ga0209248_10167036All Organisms → cellular organisms → Bacteria → Acidobacteria654Open in IMG/M
3300027738|Ga0208989_10004903All Organisms → cellular organisms → Bacteria4487Open in IMG/M
3300027812|Ga0209656_10044374All Organisms → cellular organisms → Bacteria → Acidobacteria2552Open in IMG/M
3300027824|Ga0209040_10476505All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300027853|Ga0209274_10479583All Organisms → cellular organisms → Bacteria → Acidobacteria644Open in IMG/M
3300027854|Ga0209517_10511002All Organisms → cellular organisms → Bacteria → Acidobacteria653Open in IMG/M
3300027879|Ga0209169_10357180All Organisms → cellular organisms → Bacteria → Acidobacteria768Open in IMG/M
3300027882|Ga0209590_10362310All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium935Open in IMG/M
3300027894|Ga0209068_10051722All Organisms → cellular organisms → Bacteria → Acidobacteria2086Open in IMG/M
3300027894|Ga0209068_10358812All Organisms → cellular organisms → Bacteria → Acidobacteria826Open in IMG/M
3300027911|Ga0209698_10190529All Organisms → cellular organisms → Bacteria → Acidobacteria1663Open in IMG/M
3300028381|Ga0268264_11312511All Organisms → cellular organisms → Bacteria → Acidobacteria734Open in IMG/M
3300028747|Ga0302219_10417052All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300028882|Ga0302154_10194261All Organisms → cellular organisms → Bacteria → Proteobacteria1035Open in IMG/M
3300028882|Ga0302154_10414261All Organisms → cellular organisms → Bacteria → Acidobacteria648Open in IMG/M
3300029636|Ga0222749_10467771All Organisms → cellular organisms → Bacteria → Acidobacteria678Open in IMG/M
3300029636|Ga0222749_10526626All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300029907|Ga0311329_10312879All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1135Open in IMG/M
3300029990|Ga0311336_11280754Not Available641Open in IMG/M
3300030007|Ga0311338_11699701All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300030707|Ga0310038_10153850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum1140Open in IMG/M
3300030940|Ga0265740_1015349All Organisms → cellular organisms → Bacteria → Acidobacteria744Open in IMG/M
3300031128|Ga0170823_15884708All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300031231|Ga0170824_116182386All Organisms → cellular organisms → Bacteria → Acidobacteria852Open in IMG/M
3300031474|Ga0170818_100794133All Organisms → cellular organisms → Bacteria → Acidobacteria746Open in IMG/M
3300031715|Ga0307476_10264749All Organisms → cellular organisms → Bacteria → Proteobacteria1257Open in IMG/M
3300031720|Ga0307469_12299811All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300031753|Ga0307477_10396816All Organisms → cellular organisms → Bacteria → Proteobacteria945Open in IMG/M
3300031781|Ga0318547_10364548All Organisms → cellular organisms → Bacteria → Acidobacteria884Open in IMG/M
3300031954|Ga0306926_11347735All Organisms → cellular organisms → Bacteria → Acidobacteria831Open in IMG/M
3300032001|Ga0306922_11594412All Organisms → cellular organisms → Bacteria → Acidobacteria649Open in IMG/M
3300032180|Ga0307471_102908091Not Available608Open in IMG/M
3300032783|Ga0335079_10036137All Organisms → cellular organisms → Bacteria → Acidobacteria5672Open in IMG/M
3300032783|Ga0335079_10120307All Organisms → cellular organisms → Bacteria → Acidobacteria2964Open in IMG/M
3300032783|Ga0335079_11003515All Organisms → cellular organisms → Bacteria → Acidobacteria851Open in IMG/M
3300032805|Ga0335078_11434298All Organisms → cellular organisms → Bacteria → Acidobacteria777Open in IMG/M
3300032828|Ga0335080_10104146All Organisms → cellular organisms → Bacteria3149Open in IMG/M
3300032828|Ga0335080_11235673All Organisms → cellular organisms → Bacteria → Acidobacteria749Open in IMG/M
3300032954|Ga0335083_10685843All Organisms → cellular organisms → Bacteria → Acidobacteria833Open in IMG/M
3300032955|Ga0335076_10045453All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4371Open in IMG/M
3300032955|Ga0335076_10406426All Organisms → cellular organisms → Bacteria1246Open in IMG/M
3300033402|Ga0326728_10239059All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1751Open in IMG/M
3300033412|Ga0310810_11216913All Organisms → cellular organisms → Bacteria → Acidobacteria607Open in IMG/M
3300033433|Ga0326726_10688210All Organisms → cellular organisms → Bacteria → Acidobacteria986Open in IMG/M
3300033475|Ga0310811_11051298All Organisms → cellular organisms → Bacteria → Acidobacteria701Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.50%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.19%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds5.88%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.88%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.23%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.92%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.92%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.27%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.61%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.96%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.96%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.96%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.96%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.31%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.31%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.31%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.31%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.31%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.31%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.31%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.65%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.65%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.65%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.65%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.65%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026314Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300027625Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027652Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300030940Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10094184323300000955SoilGSGTHVRVTHSGLTNLPVARKDYTGGWPEVVEMLKKFVEVKH*
JGIcombinedJ26739_10043805113300002245Forest SoilKSTGTLVKVTHSGLTQLPIARRDYTGGWPGVLEMLKKFAEDKNS*
JGIcombinedJ26739_10101100313300002245Forest SoilTEDGTHVKVIHSGLAEEPLARKGYSGGWPGVVELLKKFVEK*
Ga0062386_10035011233300004152Bog Forest SoilLSPQRGGTHVKVTHSGLASLPVARKDYSSGWPGVVEQLKKFVEG*
Ga0062386_10073747323300004152Bog Forest SoilTASGTHVKVTHSGLSSEPAARKDYSGGWPGVVESLKNFVETGKAAV*
Ga0066674_1053198313300005166SoilWELNRTQSGTVVKVTHSGLAQEDVARKDYTGGWTGVLELLRRHVEK*
Ga0066671_1078022413300005184SoilAQEQGTHVKVTHSGLSNLPIARKDYSGGWPGVVEMLKKFIEQ*
Ga0070713_10018877923300005436Corn, Switchgrass And Miscanthus RhizosphereLEPFGDKTRLKITHSGLTADLETRKDYIGGWPGVVQYLKNFVER*
Ga0070694_10194027523300005444Corn, Switchgrass And Miscanthus RhizosphereKTGTRVKVTHSGLANEPIVRKDYAGGWPGVLEKLRKHCE*
Ga0070733_1069910123300005541Surface SoilLTSVPGGTHVRVTHSGLTALPIARKDYAGGWPGVVEQLKKFVEAGM*
Ga0070732_1076678913300005542Surface SoilTKGGTHVKVTHSGLASLPIARKDYAGGWPEVVEQLKKFLEK*
Ga0070732_1103939023300005542Surface SoilLSAESGGTHVKVTHSGLANEAVARKDYSSGWTGVMQYLKKFVEK*
Ga0066692_1065701623300005555SoilVKVTHSGLSEQPIARKDYSGDWPGVLELLQKYCEQK*
Ga0066691_1095331023300005586SoilVKVTHSGLSEQPIARKDYRGDWPGVLELLQKYCEQK*
Ga0068860_10031909633300005843Switchgrass RhizosphereRVKVTHSGLANEPIVRKDYAGGWPGVLEKLRKHCE*
Ga0066790_1013772613300005995SoilTKTGTRVKVTHSGLSEENAARKDYSNGWPGVMEMLKKFVEK*
Ga0070717_1018620913300006028Corn, Switchgrass And Miscanthus RhizosphereGGTRVKVTHSGLATLPVAGKDYSGGWVGVVEQLKNFVERK*
Ga0066651_1018100323300006031SoilVKVTHSGLSEQPIARKDYSGGWPGVLDLLQKYCEQK*
Ga0066651_1023077613300006031SoilVKVTHSGLSEQPIARKDYSGGWPGVLELLQKYCEQK*
Ga0066696_1028353423300006032SoilVKVTHSDLSEQPIARKDYSGGWPGVLELLQKYCEQK*
Ga0075017_10072020113300006059WatershedsLVRVTHSGLTDLPVSRKDYSGGWPGVVEQLKKFIEG*
Ga0075015_10062973423300006102WatershedsANGTHVKVTHSGLADEPAARKDYSGGWVGVVKALKQFVEQGSTEH*
Ga0075030_10104808823300006162WatershedsLTPSEGGTMVRVTHSGLADLAVAREDYSGGWPGVLNYLKNFSER*
Ga0075014_10080704313300006174WatershedsTHVKVTHSGLSSEPESRKAYAGGWPGVLESLKSFTEGAKA*
Ga0075021_1008693823300006354WatershedsVKVTHSGLAQEAVCRKDYSGGWPGVMELLKKFVEQ*
Ga0075021_1076006913300006354WatershedsLTPVANGTRVKVTHSGLVQDPVSRKDYSGGWPGVVEKLKEFVEHTFLADRKD*
Ga0066793_1086536513300009029Prmafrost SoilTPKAGGTLVKVTHSGLTHLPIARKDYTGGWPGVVEMLKKFVES*
Ga0099827_1051925913300009090Vadose Zone SoilVKVTHSGLSDQPIARKDYSVGWPGVLDLLQKYCEQK*
Ga0116214_112046933300009520Peatlands SoilQVKVHPSRLAQEAVARKDYRGGWAGVVELLKKFVENK*
Ga0116214_125930423300009520Peatlands SoilHSGLAQEPEARKDYSGGWPGVVGKLKQFAETGKA*
Ga0116117_102910113300009635PeatlandKVIHSGLAQESVAREGYSGGWPGVLERLKHFTEK*
Ga0116217_1052499413300009700Peatlands SoilSGGTHVKVTHSGLATMPVARKDYSGGWPGVVEMLKTFVEKK*
Ga0116219_1051863913300009824Peatlands SoilTKDGTHVKVTHSGLAQEAVARKDYSGGWPGVVESLKKFVEK*
Ga0123355_1154157523300009826Termite GutTPNSEGTHVRVTHSGLGTLPIARQDYSQGWPGVVVMLKEFVEK*
Ga0116223_1004524453300009839Peatlands SoilPAGAGTHVKVTHSGLVSEPAARKDYSGGWPGALDSLKKFVENKVEQ*
Ga0126380_1102330023300010043Tropical Forest SoilLAASKGGTLVRVTHSGLADLPVARKDYSGGWPGVLRDLKKFVEK*
Ga0126373_1121036713300010048Tropical Forest SoilKGGTLLRITHSGLAELTISRKDYAGGWPGVVAQLKAFIEDGLGV*
Ga0126373_1273593113300010048Tropical Forest SoilASRGGTLVRVTHSGLADLPVARKDYSSGWPGVVEQLKKFVEK*
Ga0134086_1001081513300010323Grasslands SoilHVKVTHSGLSEQPIARKDYSGDWPGVLELLQKYCEQK*
Ga0126378_1144418513300010361Tropical Forest SoilGTHVKVTHSGLADLPAARKDYSGGWTGVVEKLKQFVEV*
Ga0126379_1189617013300010366Tropical Forest SoilANGTHVRVTHSGLSSLPVARKDYTGGWPGVVEQLKKFVEK*
Ga0105239_1058544013300010375Corn RhizosphereGTRVKVTHSGLSNQPVVRDAYRGGWPGVISNLKKFVEE*
Ga0126381_10469854623300010376Tropical Forest SoilTHVKVTHSGLADLPIARKDYSGGWPGVVEMLKKFVEK*
Ga0105246_1234310213300011119Miscanthus RhizosphereTVTHSGLAQEDVARKDYQGGWPGVVEQLKAYIEK*
Ga0137365_1076063513300012201Vadose Zone SoilHVKVTHSGLSDQPIARKDYSVGWPGVLDLLQKYCEQK*
Ga0137362_1127783633300012205Vadose Zone SoilKSTRVKVTHSGLAEEPTARKDYSGGWPGVVEYLKNFVEK*
Ga0137379_1117516813300012209Vadose Zone SoilVKVTHSGLSEQPIPRKDYSGGWPGVLELLQKYCEHK*
Ga0137385_1125625423300012359Vadose Zone SoilKVTHSGLSEQPIARKDYSGGWPGVLELLQKYCEHK*
Ga0137390_1020820213300012363Vadose Zone SoilVKVTHSGLAEENVARKDYSGGWPGVLENLKTFAEK*
Ga0137395_1055370013300012917Vadose Zone SoilTGNPVKVTHSGLADQPIARKDYAGGWPGLLELLRKYCE*
Ga0137410_1168445923300012944Vadose Zone SoilGGTLVKVTHSGLAQEDVARKDYAGGWPGVMEQLKTYIEK*
Ga0157372_1305720113300013307Corn RhizosphereGTRVKVTHSGLAKEAIVRKDYAGGWPGVLDKLRKHCE*
Ga0134081_1008777613300014150Grasslands SoilVKVTHSGLSEQPIARKDYSGGWPGVLELLQKYCEHK*
Ga0181527_129157613300014153BogTHVKVTHSGLANLPIARKDYSSGWVGVLEMLKKFTEKGSG*
Ga0181536_1028482713300014638BogLTPTASGTHVKVTHSGLAQEPEARKDYSGGWIGVVEKLRQFAETERCK*
Ga0137418_1056000533300015241Vadose Zone SoilRVTHSGLADLPVSRKDYSGGWPGVVEAIKKLVEGAQTT*
Ga0187802_1034635113300017822Freshwater SedimentPKSSGTHVKITHSGLATLPVARKDYSSGWPGVVEMLKKFVEN
Ga0187818_1034040713300017823Freshwater SedimentGTKLKVTHSGLAQESVARKDYSGGWVGVLQTLKKFVENK
Ga0187825_1010773313300017930Freshwater SedimentLKVTHSGLADLPVSRKDYADGWPGVLRSLKQFVETDPNSK
Ga0187814_1036213313300017932Freshwater SedimentTASGTHVKVTHSGLAQEATAREDYRGGWPGVVEQLKRFAEQRSAE
Ga0187803_1041478923300017934Freshwater SedimentTPAGAGTHVKVTHSGLAQEAVAREDYRGGWPGVVEKLKGFVEK
Ga0187821_1027815613300017936Freshwater SedimentRWELAASKGGTLVRVTQSGLSDLPVSRKDYSGGWPGVVEQLKKFIEG
Ga0187854_1019642213300017938PeatlandHVKVTHSGLAKEAAARKDYSGGWLGVLENLKKFTES
Ga0187847_1050478413300017948PeatlandPTATGTHVKVTHSGLATMPAARKDYSGGWTGVVAMLKKFVEN
Ga0187817_1099191613300017955Freshwater SedimentVKVTHTGLANLPVARKDYSGGWTGVVEKLKQFVEV
Ga0187781_1106209513300017972Tropical PeatlandKAGGTHVKVTHSGLASLPIARKDYTGGWPGVVDMLKKFAEK
Ga0187782_1056874113300017975Tropical PeatlandGSTHLKVTHSGLAKLPVARKDYSGGWPGVVAQLKNFVETQ
Ga0187782_1124188023300017975Tropical PeatlandVKVTHSGLASLPVARKDYTGGWPGVLAMLKKFAEKQ
Ga0187782_1141793813300017975Tropical PeatlandNGTHVKVTHNGLAQEPAAREDYRGGWVGVVEKLKKIAEKGRE
Ga0187816_1051930823300017995Freshwater SedimentELTPEAGGTQVKVTHSGLGNLPIARKDYSGGWVGVLDMLKKHAEARS
Ga0187871_1008939413300018042PeatlandVKVTHSGLATLPIARKDYSGGWTSVVEMLKKFIER
Ga0187784_1115722213300018062Tropical PeatlandRVKVTHSGLAQENLARKDYSGGWPGVLEQLKQFVEGK
Ga0187770_1097258913300018090Tropical PeatlandVTHSGLAGEPDAAKDYAGGWPGVLAELKKHFEVSG
Ga0193729_105612123300019887SoilVKVTHSGLAQEPVARQDYSGGWPGVVEYLKNFVEK
Ga0193726_100944813300020021SoilAGVTHVRVIHGGLAEQSVARKDYSGGWIGVLANLKKFAEW
Ga0179592_1017789513300020199Vadose Zone SoilLLRVTHSGLGDLPASRKDYSGGWPGVVEQIKKFIEG
Ga0210399_1001539473300020581SoilGGTLLRVTHSGLTGLPASRKDYAGGWPGVLEALKKFIERNSEV
Ga0210405_1116521113300021171SoilLATTKNGTHVKVTHSGLAQEAAARKDYNGGWPGVVEALKKFVEK
Ga0210405_1121473013300021171SoilSATRTGTRVKVTHSGLANEPIVRKNYAGGWPGVLEKLRSHCE
Ga0210405_1135614223300021171SoilKAGGTHVKVTHSGLATLPIARKDYSGGWVGVVEQLKNFVEKK
Ga0210408_1102514213300021178SoilCVTGTRVKVTHSGLANEPIVRKNYAGGWPGVLEKLRNHCA
Ga0210389_1100341813300021404SoilKSTGTLVKVTHSGLTQLPIARSDYTGGWPGVLEMLKKFAEDKNS
Ga0210387_1052123813300021405SoilGKNTHVKITHSGLAKLPAARKDYSGGWTGVMQSLKQFVETR
Ga0210386_1135898523300021406SoilPTPTGTHIKVTHSGLATEEVCRNDYANGWPGVLSSLKTFVEKSKS
Ga0210383_1028428733300021407SoilTHVKVTHSGLAQESAARKDYSGGWPGVVQQLKKFVEK
Ga0210383_1078548513300021407SoilTPTKTGTQVKVKHSGLAQEEAARKDYSGGWPGVLEMLKNFAER
Ga0210394_1042206033300021420SoilHVKVTHSGLAQEAVARKDYSGGWPGVVEMLKKFVETK
Ga0210394_1144342113300021420SoilGTRVKVTHSGLANEPIVRKNYAGGWPGVLEKLRNHCE
Ga0210391_1024487633300021433SoilLGGTHVKVTFSGLKNLPIARKDYSGGWPGVLKMLKEFAEQ
Ga0210409_1073678513300021559SoilSKGGTLVRVTHSGLAELPVARKDYASGWPGILDQLKKFVED
Ga0212123_1010341843300022557Iron-Sulfur Acid SpringTPKSTGTLVKVTHSGLTQLPIARRDYTGGWPGVLEMLKKFAEDKNS
Ga0224558_105391323300023090SoilLTPTASGTHVKVTHSGLAQEPEARKDYSGGWIGVVEKLKQFVETGKG
Ga0247679_107249113300024251SoilELTPTKSGTHVKVTHSGLTAEPVAFKDYAGGWPGVLQEIKIFAES
Ga0208188_112674013300025507PeatlandTASGTHVKVTHSCLAQEPAARADYSGGWPGVVEKLKLFAEKGTATLNPL
Ga0207654_1109895123300025911Corn RhizosphereRVTVTHSGLRNQPKARADYSGGWPGVVHELKSYVET
Ga0207687_1130519513300025927Miscanthus RhizosphereGTRVTVTHSGLRNQPKARADYSGGWPGVVHELKSYVET
Ga0207667_1125074513300025949Corn RhizosphereIPGGTRVKVTHSGLSNQPVVRDAYRGGWPGVISNLKKFVEE
Ga0207641_1142789323300026088Switchgrass RhizosphereLSATKTGTRVKVTHSGLANEPIVRKDYAGGWPGVLEKLRKHCE
Ga0207676_1054888913300026095Switchgrass RhizosphereTRVKVTHSGLSNQPVVRDAYRGGWPGVISNLKKFVEE
Ga0209350_103424133300026277Grasslands SoilVKVTHSGLSEQPIARKDYSGGWPGVLELLQKYCEQK
Ga0209268_107164133300026314SoilVKVTHSGLSDQPIARKDYSGGWPGVLDLLQKYCEQK
Ga0209471_102828343300026318SoilVKVTHSGLSEQPIARKDYSGGWPGVLELLQKYYEQK
Ga0209470_104816633300026324SoilVKVTHSGLSEQPIARKDYSGGWPGVLELLQKYCEHK
Ga0209801_112922433300026326SoilVKVTHSGRSEQPIARKDYSGGWPGVLELLQKYCEQK
Ga0209473_120446313300026330SoilVKVTHSGLSEQPIARKDYSGDWPGVLELLQKYCEQK
Ga0208044_119455023300027625Peatlands SoilGSGTKVKVTHSGLTKLPIARKDYSGGWPGVVQSLKKFVEKN
Ga0208827_117517023300027641Peatlands SoilGTHVKVTHSGLAQEAVARKDYSGGWPGVVESLKKFVEK
Ga0209007_116276223300027652Forest SoilTEDGTHVKVIHSGLAEEPLARKGYSGGWPGVVELLKKFVEK
Ga0209248_1016703623300027729Bog Forest SoilPTNDGTHVKVTHSGLAQEPVARKDYSGGWPGVVKLLKQFVEK
Ga0208989_1000490373300027738Forest SoilVKMTHIGLADLPIARKDYSGGWPGLIEQLKAHIEK
Ga0209656_1004437413300027812Bog Forest SoilVTHSGLSSEPVARKDYSGGWPGVVESLKNFVETGKAAV
Ga0209040_1047650513300027824Bog Forest SoilLSPQRGGTHVKVTHSGLASLPVARKDYSSGWPGVVEQLKKFVEG
Ga0209274_1047958313300027853SoilEGGTRVKVTHSGLAQESAARKDYSGGWPGVVELLKKFVEK
Ga0209517_1051100213300027854Peatlands SoilTHSGLVSEPAARKDYSGGWPGALDSLKKFVENKVEQ
Ga0209169_1035718013300027879SoilSSTAAGTRVKVTHSGLATLPVARKDYSGGWTGVLDMLKQFTEKL
Ga0209590_1036231013300027882Vadose Zone SoilSSRAAGTGTHVKVTHSGLSDQPIARKDYSVGWPGVLDLLQKYCEQK
Ga0209068_1005172213300027894WatershedsPIAGTRVKVTHSGLADQPVARKDYVGGWPGLLILLRKYCE
Ga0209068_1035881213300027894WatershedsVKVTHSGLAQEAVCRKDYSGGWPGVMELLKKFVEQ
Ga0209698_1019052943300027911WatershedsGTHVRVTHSGLSNLPVARKDYSGGWPGVVEMLKKFVEGRA
Ga0268264_1131251123300028381Switchgrass RhizosphereSATSNGTRVKVTHSGLANEPIVRKDYAGGWPGVLEKLRKHCE
Ga0302219_1041705223300028747PalsaPSGSGTHVRVTHSGLASEPAARSDYAGGWPGVLEEIKIFAEK
Ga0302154_1019426113300028882BogATASGTRVTVTHSGLAEEPESRKDYSGGWVGVMENLKKFVEDNLKDNF
Ga0302154_1041426113300028882BogAAGTNVKVTHSGLAQENVARKDYSGGWPGVLEMLKQFAEK
Ga0222749_1046777123300029636SoilTGTRVKVTHSGLANEPIVRKNYAGGWPGVLEKLRNHCE
Ga0222749_1052662613300029636SoilVTHSGLTQLPIARRDYTGGWPGVLEMLKKFAEDRNS
Ga0311329_1031287913300029907BogTRVKVIHSGLELEDAARKDYSSGWPGVMELLKKFVEA
Ga0311336_1128075413300029990FenGTRVKVTHSGLATENVAREDYSGGWVGVLDMLKKHFQS
Ga0311338_1169970113300030007PalsaVKVTHRGLAREDVARKDYSGGWLGVLEMLRKFVET
Ga0310038_1015385013300030707Peatlands SoilTKVKVTHSGLTKLPIARKDYSGGWPGVVQSLKKFVEKN
Ga0265740_101534923300030940SoilTHVKVTHSGLAQEAVARKDYSGGWPGVVEMLKKFVETK
Ga0170823_1588470813300031128Forest SoilGTRVKVTHSGLSEENVARKDYSNGWPGVMEMLKKFVEK
Ga0170824_11618238623300031231Forest SoilVKVTHSGLSQENAARKDYSNGWPGVVEMLKKFVER
Ga0170818_10079413313300031474Forest SoilHVRVTHSGLGNLPVARKDYTGGWPEVVEMLKKFVEGRD
Ga0307476_1026474933300031715Hardwood Forest SoilHVRVTHSGLGSLPVARKDYAGGWPGVVEHLKKFIEQ
Ga0307469_1229981113300031720Hardwood Forest SoilQVKVKHSGLRNIPVARKDYSGGWIGVLDGLKAFVEK
Ga0307477_1039681633300031753Hardwood Forest SoilAASQGGTLVRVTHSGLTDLPVSRKDYSGGWPGVIEQLKKFVEQ
Ga0318547_1036454813300031781SoilKVTHSGLATEEVSRNDYANGWPGVLSCLQTFVEKSTS
Ga0306926_1134773523300031954SoilVKVTHSGLGDEEAARKDYGSGWPGAVKMLKSFVEANRGR
Ga0306922_1159441223300032001SoilTHIKVTHSGLATEEVSRNDYANGWPGVLSCLQTFVEKSTS
Ga0307471_10290809113300032180Hardwood Forest SoilAFKVTHSGLAQENVARKDYAGGWPGMLDQLKAFTEKG
Ga0335079_1003613713300032783SoilGTGTRVKVTHSGLASEGLARQDYIGGWPGVLDMLKKFTEK
Ga0335079_1012030713300032783SoilNGTHVKVTHSGLTNLPIARKDYSGGWPGVVEMLKKFAENN
Ga0335079_1100351523300032783SoilLTPKGSGTHVKVTHSGLTNLPIARKDYGGGWTGVVEMLKKFVEQ
Ga0335078_1143429823300032805SoilGGTHVKVTHSGLANESVARKDYSGGWVGVLDSLKKFVES
Ga0335080_1010414643300032828SoilGTHVKVTHSGLTNLPIARKDYSGGWPGVVEMLKKFAENN
Ga0335080_1123567323300032828SoilPTVAGTHVKVTHSGLAQEPVARKDYSGGWVGVLESLQKFSEETSIR
Ga0335083_1068584323300032954SoilEQGGTHVKVTHSGLASLPVARKDYSGGWLGVVEQLKKFVEQ
Ga0335076_1004545393300032955SoilSPRGTTVKVTHSGLTRLPVSRKDYSGGWPGVVESLKKFVEQLSR
Ga0335076_1040642613300032955SoilSAGGTQVKVTHSGLTHEPAACKDYSNGWPGVLSGLKAFIEK
Ga0326728_1023905923300033402Peat SoilTHSGLANLPIARKDYSGGWVGVLDMLKKHAESSGQ
Ga0310810_1121691323300033412SoilRVKVTHSGLSNQPVVRDAYRGGWPGVISNLKKFVEE
Ga0326726_1068821023300033433Peat SoilVKVTHSGLAGEQVAREDYRSGWPGVVEKLKQFAETGKA
Ga0310811_1105129813300033475SoilRVKVTHSGLANEPIVRKDYAGGWPGVLEKLRKHCE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.