NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045103

Metagenome / Metatranscriptome Family F045103

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045103
Family Type Metagenome / Metatranscriptome
Number of Sequences 153
Average Sequence Length 164 residues
Representative Sequence MMTRKFSLSKGEIITLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Number of Associated Samples 130
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 49.34 %
% of genes near scaffold ends (potentially truncated) 38.56 %
% of genes from short scaffolds (< 2000 bps) 68.63 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (44.444 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(16.994 % of family members)
Environment Ontology (ENVO) Unclassified
(60.784 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(76.471 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 68.86%    β-sheet: 0.00%    Coil/Unstructured: 31.14%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 153 Family Scaffolds
PF03354TerL_ATPase 46.41
PF04860Phage_portal 15.69
PF05119Terminase_4 3.92
PF04586Peptidase_S78 3.27
PF05521Phage_H_T_join 1.96
PF08281Sigma70_r4_2 1.31
PF05135Phage_connect_1 1.31
PF05065Phage_capsid 1.31
PF11367DUF3168 1.31
PF05869Dam 0.65
PF08299Bac_DnaA_C 0.65
PF06199Phage_tail_2 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 153 Family Scaffolds
COG4626Phage terminase-like protein, large subunit, contains N-terminal HTH domainMobilome: prophages, transposons [X] 46.41
COG3747Phage terminase, small subunitMobilome: prophages, transposons [X] 3.92
COG3740Phage head maturation proteaseMobilome: prophages, transposons [X] 3.27
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 1.31
COG0593Chromosomal replication initiation ATPase DnaAReplication, recombination and repair [L] 0.65

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms55.56 %
UnclassifiedrootN/A44.44 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10017878All Organisms → Viruses → Predicted Viral4237Open in IMG/M
3300000928|OpTDRAFT_10187008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1359Open in IMG/M
3300003620|JGI26273J51734_10039248Not Available1596Open in IMG/M
3300004097|Ga0055584_102012570Not Available592Open in IMG/M
3300004448|Ga0065861_1031406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes7375Open in IMG/M
3300004457|Ga0066224_1098504All Organisms → Viruses → Predicted Viral3122Open in IMG/M
3300005588|Ga0070728_10693798Not Available522Open in IMG/M
3300005590|Ga0070727_10585451Not Available625Open in IMG/M
3300005601|Ga0070722_10560554Not Available517Open in IMG/M
3300005609|Ga0070724_10060729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales1643Open in IMG/M
3300005612|Ga0070723_10034729Not Available1923Open in IMG/M
3300005837|Ga0078893_14658164All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300005920|Ga0070725_10206302Not Available855Open in IMG/M
3300005941|Ga0070743_10007012All Organisms → Viruses → Predicted Viral4023Open in IMG/M
3300005942|Ga0070742_10142497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales666Open in IMG/M
3300006029|Ga0075466_1072602All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300006029|Ga0075466_1075817All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300006467|Ga0099972_11581002Not Available1841Open in IMG/M
3300006467|Ga0099972_12173218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes920Open in IMG/M
3300006752|Ga0098048_1115656All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300006789|Ga0098054_1147747All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300006789|Ga0098054_1192533Not Available745Open in IMG/M
3300006793|Ga0098055_1331408Not Available567Open in IMG/M
3300006803|Ga0075467_10526035Not Available607Open in IMG/M
3300006810|Ga0070754_10020746All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium3841Open in IMG/M
3300006920|Ga0070748_1053218All Organisms → Viruses → Predicted Viral1604Open in IMG/M
3300006920|Ga0070748_1146137All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300006924|Ga0098051_1102920All Organisms → cellular organisms → Bacteria → Proteobacteria766Open in IMG/M
3300006925|Ga0098050_1122122Not Available661Open in IMG/M
3300006925|Ga0098050_1195760Not Available502Open in IMG/M
3300006990|Ga0098046_1123567Not Available565Open in IMG/M
3300007229|Ga0075468_10106673All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300007229|Ga0075468_10146767Not Available716Open in IMG/M
3300007229|Ga0075468_10220703Not Available546Open in IMG/M
3300007229|Ga0075468_10220704Not Available546Open in IMG/M
3300007231|Ga0075469_10002576All Organisms → cellular organisms → Bacteria8025Open in IMG/M
3300007276|Ga0070747_1201733Not Available701Open in IMG/M
3300007276|Ga0070747_1309241Not Available542Open in IMG/M
3300007276|Ga0070747_1337179Not Available516Open in IMG/M
3300007345|Ga0070752_1063283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1657Open in IMG/M
3300007540|Ga0099847_1001246All Organisms → cellular organisms → Bacteria8827Open in IMG/M
3300007552|Ga0102818_1004638All Organisms → Viruses → Predicted Viral2840Open in IMG/M
3300007554|Ga0102820_1010871All Organisms → Viruses → Predicted Viral2293Open in IMG/M
3300007557|Ga0102821_1098266Not Available746Open in IMG/M
3300007655|Ga0102825_1000648All Organisms → cellular organisms → Bacteria8104Open in IMG/M
3300008050|Ga0098052_1102070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1168Open in IMG/M
3300008999|Ga0102816_1008242All Organisms → Viruses → Predicted Viral2972Open in IMG/M
3300009024|Ga0102811_1054337Not Available1509Open in IMG/M
3300009054|Ga0102826_1002893All Organisms → Viruses → Predicted Viral4472Open in IMG/M
3300009079|Ga0102814_10743222Not Available540Open in IMG/M
3300009086|Ga0102812_10487390Not Available673Open in IMG/M
3300009135|Ga0118736_10249221Not Available573Open in IMG/M
3300009142|Ga0102885_1098514Not Available704Open in IMG/M
3300009428|Ga0114915_1039813All Organisms → Viruses → Predicted Viral1563Open in IMG/M
3300009436|Ga0115008_10051116All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Fulvivirgaceae → Xanthovirga → Xanthovirga aplysinae3200Open in IMG/M
3300009436|Ga0115008_10072884All Organisms → Viruses → Predicted Viral2601Open in IMG/M
3300009507|Ga0115572_10059459All Organisms → Viruses → Predicted Viral2387Open in IMG/M
3300010392|Ga0118731_109596116Not Available666Open in IMG/M
3300010430|Ga0118733_107651242Not Available560Open in IMG/M
3300011118|Ga0114922_10359734Not Available1210Open in IMG/M
3300011261|Ga0151661_1074681Not Available1311Open in IMG/M
3300017710|Ga0181403_1022411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1338Open in IMG/M
3300017719|Ga0181390_1025746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1882Open in IMG/M
3300017730|Ga0181417_1000153Not Available22031Open in IMG/M
3300017735|Ga0181431_1009364All Organisms → Viruses → Predicted Viral2363Open in IMG/M
3300017741|Ga0181421_1177542Not Available548Open in IMG/M
3300017742|Ga0181399_1029528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lactobacillus1493Open in IMG/M
3300017743|Ga0181402_1006567All Organisms → Viruses → Predicted Viral3659Open in IMG/M
3300017744|Ga0181397_1009256All Organisms → Viruses → Predicted Viral3067Open in IMG/M
3300017751|Ga0187219_1215874Not Available525Open in IMG/M
3300017755|Ga0181411_1053405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales1241Open in IMG/M
3300017763|Ga0181410_1000188Not Available27108Open in IMG/M
3300017770|Ga0187217_1016563Not Available2663Open in IMG/M
3300017772|Ga0181430_1239790Not Available512Open in IMG/M
3300017772|Ga0181430_1240008Not Available512Open in IMG/M
3300017776|Ga0181394_1167394Not Available678Open in IMG/M
3300017779|Ga0181395_1017176All Organisms → cellular organisms → Bacteria → Proteobacteria2495Open in IMG/M
3300017779|Ga0181395_1155071All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300017783|Ga0181379_1023629Not Available2473Open in IMG/M
3300018980|Ga0192961_10079073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes983Open in IMG/M
3300020166|Ga0206128_1013338All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Fulvivirgaceae → Xanthovirga → Xanthovirga aplysinae5062Open in IMG/M
3300020185|Ga0206131_10038019All Organisms → Viruses → Predicted Viral3460Open in IMG/M
3300020187|Ga0206130_10008774All Organisms → cellular organisms → Bacteria10756Open in IMG/M
3300020396|Ga0211687_10134319All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300021085|Ga0206677_10062498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1877Open in IMG/M
3300021087|Ga0206683_10012348All Organisms → cellular organisms → Bacteria5260Open in IMG/M
3300021185|Ga0206682_10007520All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium8185Open in IMG/M
3300021957|Ga0222717_10236758Not Available1066Open in IMG/M
3300022053|Ga0212030_1026886All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300022061|Ga0212023_1002147All Organisms → Viruses → Predicted Viral2066Open in IMG/M
3300022072|Ga0196889_1000856All Organisms → cellular organisms → Bacteria8508Open in IMG/M
3300022072|Ga0196889_1014339All Organisms → Viruses → Predicted Viral1703Open in IMG/M
3300022178|Ga0196887_1051129All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300022178|Ga0196887_1070905All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300022201|Ga0224503_10076969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1032Open in IMG/M
3300022202|Ga0224498_10103564Not Available823Open in IMG/M
3300022218|Ga0224502_10070532All Organisms → Viruses → Predicted Viral1318Open in IMG/M
3300022220|Ga0224513_10051391Not Available1534Open in IMG/M
(restricted) 3300023276|Ga0233410_10132074Not Available785Open in IMG/M
(restricted) 3300024059|Ga0255040_10032188Not Available1865Open in IMG/M
(restricted) 3300024062|Ga0255039_10032291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1916Open in IMG/M
(restricted) 3300024340|Ga0255042_10164177Not Available671Open in IMG/M
3300024343|Ga0244777_10339925All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300024346|Ga0244775_10052325All Organisms → Viruses → Predicted Viral3551Open in IMG/M
(restricted) 3300024528|Ga0255045_10436716Not Available539Open in IMG/M
3300025070|Ga0208667_1006086All Organisms → Viruses → Predicted Viral3160Open in IMG/M
3300025070|Ga0208667_1022923Not Available1191Open in IMG/M
3300025084|Ga0208298_1006358All Organisms → cellular organisms → Bacteria3221Open in IMG/M
3300025084|Ga0208298_1041771All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300025085|Ga0208792_1023511Not Available1265Open in IMG/M
3300025103|Ga0208013_1079903All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300025108|Ga0208793_1066524All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300025108|Ga0208793_1123844Not Available704Open in IMG/M
3300025133|Ga0208299_1145607Not Available750Open in IMG/M
3300025276|Ga0208814_1000328Not Available31933Open in IMG/M
3300025276|Ga0208814_1003190All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes6796Open in IMG/M
3300025652|Ga0208134_1116376Not Available716Open in IMG/M
3300025652|Ga0208134_1124252Not Available681Open in IMG/M
3300025652|Ga0208134_1145591Not Available602Open in IMG/M
3300025849|Ga0209603_1075387All Organisms → cellular organisms → Bacteria1616Open in IMG/M
3300025853|Ga0208645_1066192All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1638Open in IMG/M
3300025870|Ga0209666_1035726All Organisms → Viruses → Predicted Viral2795Open in IMG/M
3300025874|Ga0209533_1018004All Organisms → cellular organisms → Bacteria5114Open in IMG/M
3300027159|Ga0208020_1002720All Organisms → Viruses → Predicted Viral3414Open in IMG/M
3300027189|Ga0208675_1007698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1376Open in IMG/M
3300027191|Ga0208021_1005722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales1942Open in IMG/M
3300027192|Ga0208673_1077098Not Available518Open in IMG/M
3300027308|Ga0208796_1043152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1030Open in IMG/M
3300027413|Ga0208950_1015996All Organisms → Viruses → Predicted Viral2298Open in IMG/M
3300027525|Ga0208437_1011025All Organisms → cellular organisms → Bacteria2366Open in IMG/M
3300027751|Ga0208304_10026293All Organisms → Viruses → Predicted Viral2337Open in IMG/M
3300027790|Ga0209273_10085326Not Available1410Open in IMG/M
3300027820|Ga0209578_10410017Not Available617Open in IMG/M
3300027833|Ga0209092_10004213All Organisms → cellular organisms → Bacteria12137Open in IMG/M
3300027845|Ga0209271_10000783All Organisms → cellular organisms → Bacteria11078Open in IMG/M
3300027967|Ga0209272_10301189Not Available547Open in IMG/M
3300027978|Ga0209165_10001415All Organisms → cellular organisms → Bacteria7974Open in IMG/M
(restricted) 3300027996|Ga0233413_10168727All Organisms → cellular organisms → Bacteria911Open in IMG/M
(restricted) 3300028045|Ga0233414_10004666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes5243Open in IMG/M
(restricted) 3300028045|Ga0233414_10202150Not Available892Open in IMG/M
3300028599|Ga0265309_10001848All Organisms → cellular organisms → Bacteria9423Open in IMG/M
3300031519|Ga0307488_10146091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1662Open in IMG/M
3300031569|Ga0307489_10573448Not Available776Open in IMG/M
3300031773|Ga0315332_10000111Not Available28264Open in IMG/M
3300031851|Ga0315320_10163155Not Available1665Open in IMG/M
3300032088|Ga0315321_10545859Not Available695Open in IMG/M
3300032254|Ga0316208_1083680Not Available833Open in IMG/M
3300032255|Ga0316209_1130339Not Available638Open in IMG/M
3300032274|Ga0316203_1099050All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300032277|Ga0316202_10114482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1249Open in IMG/M
3300032277|Ga0316202_10361649Not Available677Open in IMG/M
3300032373|Ga0316204_10960254Not Available605Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous16.99%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater15.03%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine13.73%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine11.76%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment7.84%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat3.92%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater3.92%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.61%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment2.61%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean1.96%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine1.96%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.96%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.96%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.96%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.31%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.31%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.31%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.31%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.31%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.65%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.65%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.65%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.65%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.65%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.65%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment0.65%
Marine SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment0.65%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300003620Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNAEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300005588Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1EnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005601Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1EnvironmentalOpen in IMG/M
3300005609Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1EnvironmentalOpen in IMG/M
3300005612Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2EnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300005920Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006467Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935EnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007557Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715EnvironmentalOpen in IMG/M
3300007655Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579EnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009135Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 382 cmbsfEnvironmentalOpen in IMG/M
3300009142Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300011261Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020187Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1EnvironmentalOpen in IMG/M
3300020396Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122)EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021087Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022061Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022201Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21EnvironmentalOpen in IMG/M
3300022202Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21EnvironmentalOpen in IMG/M
3300022218Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13EnvironmentalOpen in IMG/M
3300022220Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21EnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024340 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024528 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025133Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025870Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025874Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes)EnvironmentalOpen in IMG/M
3300027159Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)EnvironmentalOpen in IMG/M
3300027189Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579 (SPAdes)EnvironmentalOpen in IMG/M
3300027191Estuarine microbial communities from the Columbia River estuary - metaG S.737 (SPAdes)EnvironmentalOpen in IMG/M
3300027192Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes)EnvironmentalOpen in IMG/M
3300027308Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 (SPAdes)EnvironmentalOpen in IMG/M
3300027413Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027525Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes)EnvironmentalOpen in IMG/M
3300027751Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes)EnvironmentalOpen in IMG/M
3300027790Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027820Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027845Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027967Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027978Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300028599Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031773Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M
3300032254Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyriteEnvironmentalOpen in IMG/M
3300032255Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month chalcopyriteEnvironmentalOpen in IMG/M
3300032274Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1001787893300000101MarineMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
OpTDRAFT_1018700823300000928Freshwater And MarineMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDLLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
JGI26273J51734_1003924813300003620MarineMTRRYSLSKGEIIKLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
Ga0055584_10201257013300004097Pelagic MarineMTTRKFSLSKGEIITLHQSSVRAICSSVLSNNKDYHLLDDLVQDINVILLSQMSETIESLHETNQLEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN*
Ga0065861_103140683300004448MarineMTTRKFSLSKGEIITLHQSSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN*
Ga0066224_109850423300004457MarineMTTRKFSLSKGEIITLHQSSVRAICSSVLSNNKDFHLLDDLVQDINVILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLQSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN*
Ga0070728_1069379823300005588Marine SedimentMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLKSDDYDSLPDRLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCS
Ga0070727_1058545123300005590Marine SedimentMMTRRFSLSKGEIITLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLQSDDYDSLPDRLWQEIFKLDSQKAKDIVYLRFEYGLKIQE
Ga0070722_1056055423300005601Marine SedimentMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLKSDDYDSLPDRLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGC
Ga0070724_1006072923300005609Marine SedimentMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
Ga0070723_1003472913300005612Marine SedimentVEQVMMTRRFSLSKGEIITLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
Ga0078893_1465816413300005837Marine Surface WaterMTTRKCSLSKGEIITLHQSSVRAICSSVLSNNKDYHLLDDLVQDINVILLSQMSETIESLHETNQLEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSTRYIHKVLARSLKKIKNNSKN*
Ga0070725_1020630223300005920Marine SedimentVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLKSDDYDSLPDRLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
Ga0070743_1000701233300005941EstuarineVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
Ga0070742_1014249723300005942EstuarineMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKIPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNLKN*
Ga0075466_107260213300006029AqueousMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLQSDDYDSLPDLLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
Ga0075466_107581723300006029AqueousMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIMYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN*
Ga0099972_1158100213300006467MarineKTKIVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKIPLKSDDYDSLPDRLWEEVFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN*
Ga0099972_1217321823300006467MarineVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLKSDDYDSLPDRLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
Ga0098048_111565623300006752MarineVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINVILLSQMSETIESLHETNQLEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDNYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKI
Ga0098054_114774713300006789MarineVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINVILLSQMSETIESLHETNQLEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDNYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKN
Ga0098054_119253323300006789MarineVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLSNNKDYHLLDDLVQDINVILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKN
Ga0098055_133140813300006793MarineVMTTRKFSLSKGEIITLHQGSVRAICSSVLSNNKDYHLLDDLVQDINVILLSQMSETIESLHETNQLEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLADRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSTRYIHKVLARSLKKIKNNSKN*
Ga0075467_1052603513300006803AqueousMMTRRYSLSKGEIITLHQSSVRAICSSVLANNQDYHLLDDLVQDINVILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIMYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN*
Ga0070754_1002074633300006810AqueousVEQVMTTRKFSLSKGEIITLHQSSVRAICSSVLSNNKDYHLLDDLVQDINVILLSQMSETIESLHETNQLEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEELFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSTRYIHKVLARSLKKIKNNSKN*
Ga0070748_105321823300006920AqueousVEQVMMTRRYSLSKGEIITLHQSSVRAICSSVLANNQDYHLLDDLVQDINVILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLK
Ga0070748_114613713300006920AqueousVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIMYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNN
Ga0098051_110292013300006924MarineMTTRKFSLSKGEIITLHQGSVRAICSSVLSNNKDNHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNAKN*
Ga0098050_112212223300006925MarineMTTRKFSLSKGEIITLHQDSVRAICSSVLSNNKDNHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIH
Ga0098050_119576023300006925MarineMTTRKFSLSKGEIITLHQGSVRAICSSVLSNNKDYHLLDDLVQDINVILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDNYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKI
Ga0098046_112356713300006990MarineMTTRKFSLSKGEIITLHQDSVRAICSSVLSNNKDNHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKN
Ga0075468_1010667313300007229AqueousMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINVILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNS
Ga0075468_1014676723300007229AqueousMTRRYSLSKGEIITLHQSSVRAICSSVLANNQDYHLLDDLVQDINVILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIMYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNS
Ga0075468_1022070313300007229AqueousKTKIVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLQSDDYDSLPDLLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
Ga0075468_1022070413300007229AqueousKTKIVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKIPLKSDDYDSLPDLLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
Ga0075469_1000257653300007231AqueousMTRRYSLSKGEIIKLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLQSDDYDSLPDLLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
Ga0070747_120173323300007276AqueousMTRRYSLSKGEIITLHQSSVRAICSSVLANNQDYHLLDDLVQDINVILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLK
Ga0070747_130924113300007276AqueousVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKIPLKSDDYDSLPDLLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
Ga0070747_133717913300007276AqueousIVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIMYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSK
Ga0070752_106328323300007345AqueousMTTRKFSLSKGEIITLHQGSVRAICSSVLSNNKDYHLLDDLVQDINVILLSQMSETIESLHETNQLEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEELFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSTRYIHKVLARSLKKIKNNSKN*
Ga0099847_100124623300007540AqueousMTRRYSLSKGEIITLHQSSVRAICSSVLANNQDYHLLDDLVQDINVILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN*
Ga0102818_100463833300007552EstuarineMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKIPLKSDDYDSLPDLLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
Ga0102820_101087123300007554EstuarineMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHESNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
Ga0102821_109826613300007557EstuarineMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNN
Ga0102825_100064853300007655EstuarineMTRRYSLSKGEIIKLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKIPLKSDDYDSLPDLLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
Ga0098052_110207023300008050MarineMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINVILLSQMSETIESLHETNQLEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN*
Ga0102816_100824223300008999EstuarineMTRRYSLSKGEIIKLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKIPLKSDDYDSLPDLLWQEIFKLDSQKAKYIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
Ga0102811_105433713300009024EstuarineMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNLKN*
Ga0102826_100289343300009054EstuarineMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQISETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDLLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
Ga0102814_1074322213300009079EstuarineSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKIPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNLKN*
Ga0102812_1048739013300009086EstuarineVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNLKN*
Ga0118736_1024922113300009135Marine SedimentVMMTRRYSLSKGEIITLHQSSVRAICSSVLANNQDYHLLDDLVQDINVILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN*
Ga0102885_109851413300009142EstuarineMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQISETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEI
Ga0114915_103981323300009428Deep OceanMIAKRFSLSKEEIITSNQGSIRAICSSVLSNNNDIHLLDDLIQDINLILLTQMDETIESLHETNQFEYFVARVVTNQVISTSSPFHNTYRLREPKNHLKSDNYDILPDLLWYNLSNLKHKGMRDVMYLRFEYGLKIQEISLIKGYSPSYIHRLIGLSYKLIKNSSKI*
Ga0115008_1005111623300009436MarineMMTRRFSLSKGEIITLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLQSDDYDSLPDLLWQEVFKLDSQKSKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNLKN*
Ga0115008_1007288433300009436MarineMIAKRFSLSKEEIITSNQGSIRAICSSVLSNNNDIHLLDDLIQDINLILLTQMDETIESLHETNQFEYFVARVVTNQVISTSSPFHNTYRLREPKNHLKRDDYDILPDLLWYNLSNLKHKGMRDVMYLRFEYGLKIQEIALIKGYSPSYIHRLIGLSYKLIKNSSKI*
Ga0115572_1005945923300009507Pelagic MarineMMTRRFSLSKGEIITLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLQSDDYDSLPDRLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
Ga0118731_10959611623300010392MarineICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLQSDDYDSLPDRLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
Ga0118733_10765124213300010430Marine SedimentDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLKSDDYDSLPDRLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
Ga0114922_1035973413300011118Deep SubsurfaceGEIITLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLQSDDYDSLPDRLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN*
Ga0151661_107468113300011261MarineVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEHFVARVVVNKVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKRCSISYIHKVLERSLKKIKNNSKN*
Ga0181403_102241123300017710SeawaterVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLSNNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0181390_102574623300017719SeawaterVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0181417_1000153293300017730SeawaterMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIMYLRFEYGLKIQEIAKIKGCSTRYIHKVLARSLKKIKNNSKN
Ga0181431_100936423300017735SeawaterVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLSNNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSTRYIHKVLARSLKKIKNNSKN
Ga0181421_117754213300017741SeawaterMMTRRFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCST
Ga0181399_102952823300017742SeawaterVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0181402_100656723300017743SeawaterVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDLLPDRLWEEVFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0181397_100925633300017744SeawaterVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSTRYIHKVLARSLKKIKNNSKN
Ga0181405_112407423300017750SeawaterVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFE
Ga0187219_121587423300017751SeawaterMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDLLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCS
Ga0181411_105340523300017755SeawaterVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0181410_1000188363300017763SeawaterMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSTRYIHKVLARSLKKIKNNSKN
Ga0187217_101656333300017770SeawaterVEQVMTTRKFSLSKGEIITLHQDSVRAICSSVLSNNKDNHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0181430_123979013300017772SeawaterVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIMYLRFEYGLKIQEIAKIKGCSTRYIHKVLARSLKKIKNNSK
Ga0181430_124000813300017772SeawaterVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSTRYIHKVLARSLKKIKNNSK
Ga0181394_116739413300017776SeawaterMTTRKFSLSKGEIITLYQDSVRAICSSVLSNNKDNHLLDDLVQDINLILLSQMSETIESLHETNQIQYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKNDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0181395_101717633300017779SeawaterVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQ
Ga0181395_115507123300017779SeawaterMTTRKFSLSKGEIITLYQDSVRAICSSVLSNNKDNHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQ
Ga0181379_102362923300017783SeawaterVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPIKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0192961_1007907323300018980MarineVEQVMMTRKFSLSKGEIITLHQGSVRAICSSVLANNQDYHLLDDLVQDINVILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0206128_101333823300020166SeawaterVEQVMMTRKFSLSKGEIITLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0206131_1003801943300020185SeawaterVEQVMMTRRFSLSKGEIITLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0206130_10008774113300020187SeawaterMMTRKFSLSKGEIITLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0211687_1013431923300020396MarineMIAKRFSLSKEEIITSNQGSIRAICSSVLSNNNDIHLLDDLIQDINLILLTQMDETIESLHETNQFEYFVARVVTNQVISTSSPFHNTYRLREPKNHLKRDDYDILPDLLWYNLSNLKHKGMRDVMYLRFEYGLKIQEIALIKGYSPSYIHRLIGLSYKLIKNSSKI
Ga0206677_1006249823300021085SeawaterMTTRKFSLSKGEIITLHQGSVRAICSSVLSNNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEQVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0206683_1001234853300021087SeawaterVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLSNNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEQVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0206682_10007520133300021185SeawaterMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNLKN
Ga0222717_1023675813300021957Estuarine WaterVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSTRYIHKVLARSLKKIKNNSKN
Ga0212030_102688613300022053AqueousVEQVMMTRRYSLSKGEIITLHQSSVRAICSSVLANNQDYHLLDDLVQDINVILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGL
Ga0212023_100214723300022061AqueousVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLQSDDYDSLPDLLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0196889_1000856123300022072AqueousMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLQSDDYDSLPDLLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0196889_101433923300022072AqueousVEQVMMTRRYSLSKGEIITLHQSSVRAICSSVLANNQDYHLLDDLVQDINVILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0196887_105112913300022178AqueousMMTRRYSLSKGEIITLHQSSVRAICSSVLANNQDYHLLDDLVQDINVILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0196887_107090513300022178AqueousVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIMYLRFEYGLKIQEIAKIKGCSIRYIHK
Ga0224503_1007696923300022201SedimentVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQISETIESLHETNQLEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0224498_1010356413300022202SedimentIVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQISETIESLHETNQLEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0224502_1007053213300022218SedimentMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQISETIESLHETNQLEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKARDIVYLRFEYGLKIQEIAKIKGCS
Ga0224513_1005139123300022220SedimentMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKIPLKSDDYDSLPDILWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
(restricted) Ga0233410_1013207423300023276SeawaterVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKIPLKSDDYDSLPDLLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
(restricted) Ga0255040_1003218823300024059SeawaterVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDLLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
(restricted) Ga0255039_1003229123300024062SeawaterMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPFKSDDYDSLPDLLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
(restricted) Ga0255042_1016417713300024340SeawaterMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDLLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0244777_1033992523300024343EstuarineMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQISETIESLHETNQLEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNLKN
Ga0244775_1005232533300024346EstuarineVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNLKN
(restricted) Ga0255045_1043671613300024528SeawaterMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDLLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSI
Ga0208667_100608623300025070MarineVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINVILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0208667_102292323300025070MarineKIVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLSNNKDNHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNAKN
Ga0208298_100635823300025084MarineMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINVILLSQMSETIESLHETNQLEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDNYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0208298_104177123300025084MarineMTTRKFSLSKGEIITLHQDSVRAICSSVLSNNKDNHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNAKN
Ga0208792_102351113300025085MarineMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINVILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0208013_107990313300025103MarineVEQVMTTRKFSLSKGEIITLHQDSVRAICSSVLSNNKDNHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVL
Ga0208793_106652423300025108MarineVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINVILLSQMSETIESLHETNQLEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDNYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNN
Ga0208793_112384413300025108MarineMTTRKFSLSKGEIITLHQDSVRAICSSVLSNNKDNHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSL
Ga0208299_114560723300025133MarineLHQGSVRAICSSVLANNKDYHLLDDLVQDINVILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0208814_1000328423300025276Deep OceanMIAKRFSLSKEEIITSNQGSIRAICSSVLSNNNDIHLLDDLIQDINLILLTQMDETIESLHETNQFEYFVARVVTNQVISTSSPFHNTYRLREPKNHLKSDNYDILPDLLWYNLSNLKHKGMRDVMYLRFEYGLKIQEISLIKGYSPSYIHRLIGLSYKLIKNSSKI
Ga0208814_100319083300025276Deep OceanVEQVMMTRRFSLSKGEIITLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLKIDDYDSLPDRLWQEVFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0208134_111637623300025652AqueousVEQVMMTRRYSLSKGEIITLHQSSVRAICSSVLANNQDYHLLDDLVQDINVILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLAR
Ga0208134_112425223300025652AqueousRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTSLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0208134_114559113300025652AqueousVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIMYLRFEYG
Ga0209603_107538723300025849Pelagic MarineVEQVMMTRRFSLSKGEIITLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLQSDDYDSLPDLLWQEVFKLDSQKSKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNLKN
Ga0208645_106619223300025853AqueousVEQVMTTRKFSLSKGEIITLHQSSVRAICSSVLSNNKDYHLLDDLVQDINVILLSQMSETIESLHETNQLEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEELFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSTRYIHKVLARSLKK
Ga0209666_103572623300025870MarineVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0209533_101800443300025874Pelagic MarineMMTRKFSLSKGEIITLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLQSDDYDSLPDLLWQEVFKLDSQKSKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0208020_100272023300027159EstuarineVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKIPLKSDDYDSLPDLLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0208675_100769823300027189EstuarineMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKIPLKSDDYDSLPDLLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0208021_100572223300027191EstuarineVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQISETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDLLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0208673_107709823300027192EstuarineVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQISETIESLHETNQLEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLER
Ga0208796_104315223300027308EstuarineVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0208950_101599623300027413MarineVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDLLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0208437_101102533300027525EstuarineMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNLKN
Ga0208304_1002629333300027751EstuarineVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKIPLKSDDYDSLPDRLWEEVFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0209273_1008532613300027790Marine SedimentNNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0209578_1041001713300027820Marine SedimentTKIVEQVMMTRRFSLSKGEIITLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0209092_10004213133300027833MarineMMTRRFSLSKGEIITLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLQSDDYDSLPDLLWQEVFKLDSQKSKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNLKN
Ga0209271_10000783133300027845Marine SedimentMMTRRFSLSKGEIITLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0209272_1030118913300027967Marine SedimentTKIVEQVMMTRRFSLSKGEIITLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLQSDDYDSLPDRLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0209165_1000141593300027978Marine SedimentVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
(restricted) Ga0233413_1016872713300027996SeawaterMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
(restricted) Ga0233414_1000466623300028045SeawaterMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKIPLKSDDYDSLPDLLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
(restricted) Ga0233414_1020215023300028045SeawaterEEIITSNQGSIRAICSSVLYNNNDIHLLDDLIQDINLILLTQMDETIESLHETNQFEYFVARVVTNQVISTSSPFHNTYRLREPKNHLKSDDYDILPDLLWYNLSNLKHKGMRDVMYLRFEYGLKIQEIALIKGYSPSYIHRLIGLSYKLIKNSSKI
Ga0265309_1000184883300028599SedimentMMTRKFSLSKGEIITLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0307488_1014609123300031519Sackhole BrineMMTRRFSLSKGEIITLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLQSDDYDSLPDRLWQEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0307489_1057344813300031569Sackhole BrineMMTRRFSLSKGEIITLHQGSVRAICSSVLANNQDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKNTLQSDDYDSLPDRLWQEVFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0315332_10000111273300031773SeawaterMTTRKFSLSKGEIITLHQSSVRAICSSVLSNNQDYHLLDDLVQDINVILLSQMSETIESLHETNQLEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0315320_1016315513300031851SeawaterIVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSTRYIHKVLARSLKKIKNNSKN
Ga0315321_1054585913300032088SeawaterVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQE
Ga0316208_108368023300032254Microbial MatMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQISETIESLHETNQLEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDLLPDRLWEEVFKLESQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0316209_113033923300032255Microbial MatQGSVRAICSSVLANNQDYHLLDDLVQDINVILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0316203_109905023300032274Microbial MatVEQVMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKIPLKSDDYDSLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0316202_1011448223300032277Microbial MatMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEVFKLESQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN
Ga0316202_1036164913300032277Microbial MatMMTRRYSLSKGEIIKLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQISETIESLHETNQLEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDLLPDRLWEEVFKLDSQKARDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLERSLKKIKNNSKN
Ga0316204_1096025413300032373Microbial MatKIVEQVMTTRKFSLSKGEIITLHQGSVRAICSSVLANNKDYHLLDDLVQDINLILLSQMSETIESLHETNQIEYFVARVVVNQVLSTSSPFHTTYRLKQPKTPLKSDDYDSLPDRLWEEIFKLDSQKAKDIVYLRFEYGLKIQEIAKIKGCSIRYIHKVLARSLKKIKNNSKN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.