Basic Information | |
---|---|
Family ID | F044808 |
Family Type | Metagenome |
Number of Sequences | 154 |
Average Sequence Length | 44 residues |
Representative Sequence | MPSYDRALWALRTWLDSWPGIGHVAVGMHRQGYDLQLTQYDE |
Number of Associated Samples | 106 |
Number of Associated Scaffolds | 154 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 38.51 % |
% of genes near scaffold ends (potentially truncated) | 74.03 % |
% of genes from short scaffolds (< 2000 bps) | 87.01 % |
Associated GOLD sequencing projects | 98 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.32 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (92.208 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (24.026 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.416 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.740 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.43% β-sheet: 0.00% Coil/Unstructured: 48.57% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 154 Family Scaffolds |
---|---|---|
PF04392 | ABC_sub_bind | 40.91 |
PF00383 | dCMP_cyt_deam_1 | 2.60 |
PF02371 | Transposase_20 | 1.95 |
PF00583 | Acetyltransf_1 | 1.30 |
PF00589 | Phage_integrase | 1.30 |
PF01914 | MarC | 1.30 |
PF01068 | DNA_ligase_A_M | 1.30 |
PF13419 | HAD_2 | 1.30 |
PF13432 | TPR_16 | 0.65 |
PF13379 | NMT1_2 | 0.65 |
PF03576 | Peptidase_S58 | 0.65 |
PF01738 | DLH | 0.65 |
PF01575 | MaoC_dehydratas | 0.65 |
PF13180 | PDZ_2 | 0.65 |
PF08483 | Obsolete Pfam Family | 0.65 |
PF02727 | Cu_amine_oxidN2 | 0.65 |
PF06537 | DHOR | 0.65 |
PF12746 | GNAT_acetyltran | 0.65 |
PF07076 | DUF1344 | 0.65 |
PF02563 | Poly_export | 0.65 |
PF00239 | Resolvase | 0.65 |
PF14337 | Abi_alpha | 0.65 |
PF13673 | Acetyltransf_10 | 0.65 |
PF01654 | Cyt_bd_oxida_I | 0.65 |
PF10282 | Lactonase | 0.65 |
PF09594 | GT87 | 0.65 |
PF09851 | SHOCT | 0.65 |
PF01548 | DEDD_Tnp_IS110 | 0.65 |
PF13676 | TIR_2 | 0.65 |
PF01244 | Peptidase_M19 | 0.65 |
PF07040 | DUF1326 | 0.65 |
PF05494 | MlaC | 0.65 |
PF03200 | Glyco_hydro_63 | 0.65 |
COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 40.91 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.60 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 1.30 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.30 |
COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 1.30 |
COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 1.30 |
COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 0.65 |
COG1596 | Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp fold | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.65 |
COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.65 |
COG2854 | Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.65 |
COG3733 | Cu2+-containing amine oxidase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.65 |
COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.21 % |
Unclassified | root | N/A | 7.79 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664022|INPgaii200_c0723655 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300000443|F12B_10153236 | All Organisms → cellular organisms → Bacteria | 1922 | Open in IMG/M |
3300000787|JGI11643J11755_11663807 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
3300000955|JGI1027J12803_100118802 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300000956|JGI10216J12902_110847921 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300001431|F14TB_100083495 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
3300001431|F14TB_102258733 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
3300002558|JGI25385J37094_10179311 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300002908|JGI25382J43887_10097919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1554 | Open in IMG/M |
3300002912|JGI25386J43895_10156108 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 570 | Open in IMG/M |
3300004633|Ga0066395_10053841 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
3300005167|Ga0066672_10124017 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
3300005174|Ga0066680_10759029 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300005178|Ga0066688_10892584 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300005180|Ga0066685_10887505 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 597 | Open in IMG/M |
3300005332|Ga0066388_102962254 | Not Available | 868 | Open in IMG/M |
3300005332|Ga0066388_104430666 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300005445|Ga0070708_100716323 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 941 | Open in IMG/M |
3300005447|Ga0066689_10988487 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300005451|Ga0066681_10742977 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 595 | Open in IMG/M |
3300005468|Ga0070707_100439872 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
3300005468|Ga0070707_100451156 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300005468|Ga0070707_100525845 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1145 | Open in IMG/M |
3300005526|Ga0073909_10320781 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300005540|Ga0066697_10676007 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300005558|Ga0066698_11024829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 524 | Open in IMG/M |
3300005561|Ga0066699_10267869 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
3300005713|Ga0066905_100134342 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
3300005764|Ga0066903_100228627 | All Organisms → cellular organisms → Bacteria | 2833 | Open in IMG/M |
3300005764|Ga0066903_100881113 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
3300005764|Ga0066903_101331749 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
3300005764|Ga0066903_103463107 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300005764|Ga0066903_108321871 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 530 | Open in IMG/M |
3300006058|Ga0075432_10367004 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300006796|Ga0066665_10183723 | Not Available | 1611 | Open in IMG/M |
3300006796|Ga0066665_11561491 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300006797|Ga0066659_11165454 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300006844|Ga0075428_100675968 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1100 | Open in IMG/M |
3300006844|Ga0075428_102245656 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300006852|Ga0075433_11403517 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300006854|Ga0075425_100831458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1057 | Open in IMG/M |
3300006854|Ga0075425_101920561 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300006854|Ga0075425_102665026 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300006904|Ga0075424_101781005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 651 | Open in IMG/M |
3300007076|Ga0075435_100402413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1177 | Open in IMG/M |
3300007076|Ga0075435_100404955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1174 | Open in IMG/M |
3300009012|Ga0066710_100311422 | All Organisms → cellular organisms → Bacteria | 2311 | Open in IMG/M |
3300009100|Ga0075418_10099194 | All Organisms → cellular organisms → Bacteria | 3094 | Open in IMG/M |
3300009100|Ga0075418_11571259 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300009137|Ga0066709_100468659 | All Organisms → cellular organisms → Bacteria | 1766 | Open in IMG/M |
3300009147|Ga0114129_11226120 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300009147|Ga0114129_11490564 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 832 | Open in IMG/M |
3300009156|Ga0111538_12356199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
3300009162|Ga0075423_11191204 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300010043|Ga0126380_10271317 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
3300010043|Ga0126380_10392693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. LWB | 1027 | Open in IMG/M |
3300010043|Ga0126380_11531262 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300010043|Ga0126380_11558629 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300010046|Ga0126384_11889233 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300010046|Ga0126384_12316942 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300010047|Ga0126382_10819220 | Not Available | 796 | Open in IMG/M |
3300010048|Ga0126373_11400171 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300010336|Ga0134071_10150891 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1130 | Open in IMG/M |
3300010359|Ga0126376_10292812 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
3300010360|Ga0126372_10065285 | All Organisms → cellular organisms → Bacteria | 2556 | Open in IMG/M |
3300010360|Ga0126372_10259914 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
3300010360|Ga0126372_10384688 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1274 | Open in IMG/M |
3300010360|Ga0126372_10882833 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300010360|Ga0126372_11945607 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300010361|Ga0126378_11478075 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 770 | Open in IMG/M |
3300010362|Ga0126377_10246753 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
3300010362|Ga0126377_10423247 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
3300010362|Ga0126377_10463270 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1292 | Open in IMG/M |
3300010362|Ga0126377_10542496 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
3300010362|Ga0126377_11084164 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300010362|Ga0126377_11877138 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300010366|Ga0126379_11774181 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300010366|Ga0126379_13741761 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300010376|Ga0126381_102847007 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300010398|Ga0126383_10332430 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
3300010398|Ga0126383_10779520 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
3300010398|Ga0126383_11117335 | Not Available | 878 | Open in IMG/M |
3300010398|Ga0126383_11488384 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 767 | Open in IMG/M |
3300010868|Ga0124844_1131867 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300012199|Ga0137383_11222641 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300012210|Ga0137378_10030542 | All Organisms → cellular organisms → Bacteria | 4774 | Open in IMG/M |
3300012210|Ga0137378_10804923 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 852 | Open in IMG/M |
3300012211|Ga0137377_10233177 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1768 | Open in IMG/M |
3300012211|Ga0137377_11305004 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300012351|Ga0137386_10274273 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1213 | Open in IMG/M |
3300012357|Ga0137384_11056272 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300012948|Ga0126375_10466670 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300012948|Ga0126375_11092322 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300012948|Ga0126375_11397637 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 593 | Open in IMG/M |
3300012971|Ga0126369_10164179 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2104 | Open in IMG/M |
3300012971|Ga0126369_10614988 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1158 | Open in IMG/M |
3300013306|Ga0163162_10648250 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1180 | Open in IMG/M |
3300015371|Ga0132258_10383119 | All Organisms → cellular organisms → Bacteria | 3488 | Open in IMG/M |
3300015371|Ga0132258_10770274 | All Organisms → cellular organisms → Bacteria | 2425 | Open in IMG/M |
3300015371|Ga0132258_12610303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1262 | Open in IMG/M |
3300015372|Ga0132256_100492795 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
3300015373|Ga0132257_100564681 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
3300015373|Ga0132257_102274389 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 702 | Open in IMG/M |
3300016319|Ga0182033_10242860 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
3300016319|Ga0182033_11766390 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300016387|Ga0182040_10944685 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300018082|Ga0184639_10107053 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
3300021560|Ga0126371_10600508 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
3300021560|Ga0126371_11105249 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 932 | Open in IMG/M |
3300025922|Ga0207646_10198475 | All Organisms → cellular organisms → Bacteria | 1812 | Open in IMG/M |
3300025938|Ga0207704_10541530 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300026297|Ga0209237_1060643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 1836 | Open in IMG/M |
3300026301|Ga0209238_1157156 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300026313|Ga0209761_1089974 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
3300026317|Ga0209154_1068173 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
3300026328|Ga0209802_1008743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6129 | Open in IMG/M |
3300026332|Ga0209803_1036361 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2278 | Open in IMG/M |
3300026333|Ga0209158_1199272 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300026532|Ga0209160_1176134 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300027561|Ga0209887_1035516 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1123 | Open in IMG/M |
3300027874|Ga0209465_10430108 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300027880|Ga0209481_10384777 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
3300027909|Ga0209382_10193601 | All Organisms → cellular organisms → Bacteria | 2334 | Open in IMG/M |
3300027909|Ga0209382_11393731 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300028878|Ga0307278_10017480 | All Organisms → cellular organisms → Bacteria | 3325 | Open in IMG/M |
3300031226|Ga0307497_10027468 | All Organisms → cellular organisms → Bacteria | 1825 | Open in IMG/M |
3300031543|Ga0318516_10510958 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300031544|Ga0318534_10773388 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300031545|Ga0318541_10802395 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300031562|Ga0310886_10830686 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 583 | Open in IMG/M |
3300031680|Ga0318574_10578383 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300031720|Ga0307469_10146134 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1761 | Open in IMG/M |
3300031751|Ga0318494_10303469 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300031764|Ga0318535_10498369 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300031770|Ga0318521_10949175 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300031795|Ga0318557_10377296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 652 | Open in IMG/M |
3300031796|Ga0318576_10113717 | Not Available | 1244 | Open in IMG/M |
3300031820|Ga0307473_10622719 | Not Available | 748 | Open in IMG/M |
3300031896|Ga0318551_10596449 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300031910|Ga0306923_10127131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2898 | Open in IMG/M |
3300031912|Ga0306921_10228105 | All Organisms → cellular organisms → Bacteria | 2182 | Open in IMG/M |
3300031941|Ga0310912_10211518 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1485 | Open in IMG/M |
3300031954|Ga0306926_11282002 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 856 | Open in IMG/M |
3300032054|Ga0318570_10423082 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300032059|Ga0318533_10490266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 901 | Open in IMG/M |
3300032180|Ga0307471_100998104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1004 | Open in IMG/M |
3300032180|Ga0307471_101320317 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300032261|Ga0306920_103487541 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 24.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.64% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.44% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.14% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.19% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.55% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.25% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.25% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.25% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.30% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.30% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.65% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.65% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.65% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPgaii200_07236551 | 2228664022 | Soil | MPPCYRDLWALRIWLDSWSGIGHLAVWMHRQGFDLQ |
F12B_101532361 | 3300000443 | Soil | MPAYDRALHALRTWLDSWSGIGHVVVGMAHQGFDLQLIRYDERGWR |
F14TC_1004014161 | 3300000559 | Soil | VFHALLRPRAPRGALRSWLDTWPGIGHVAVGLHRQGYDLQLTQYDER |
JGI11643J11755_116638071 | 3300000787 | Soil | MPSYDRALHALRTWLDSWAGIGHVAVGMHCQGYDLQLTQYGERGW |
JGI1027J12803_1001188021 | 3300000955 | Soil | MPSHDRALSALRTLLDSWIGVGHVAIGMHRQGFDLQLTQYDERGW |
JGI10216J12902_1108479213 | 3300000956 | Soil | MPSYDRALWALRTWLDSWSGIGHVTVGMTRQGYASS* |
F14TB_1000834951 | 3300001431 | Soil | MPAYDRALHALRTWLDSWSGIGHVVVGMAHQGFDL |
F14TB_1022587332 | 3300001431 | Soil | MPPYDRALWALRTWLDSWFGIAHVAVDMHRQGFDLQLTQYDER |
JGI25385J37094_101793111 | 3300002558 | Grasslands Soil | MLSYDRALHALRTWLDCWSGIGHVAVGMARQGYDLQLTRYDD |
JGI25382J43887_100979193 | 3300002908 | Grasslands Soil | MPSYDRALWALRTWLDSWAGIGHVAVGMHRQGYDLQLTQYDERG |
JGI25386J43895_101561081 | 3300002912 | Grasslands Soil | MPSYDRALWALRTWLDSWAGIGHVAVGMHRQGYDLQLTQYDERGGDDFRYAG |
Ga0066395_100538412 | 3300004633 | Tropical Forest Soil | MPSYDRALWALRKWLDSWPGIGHIAVGMHRQGFDLQLTQYDDSGWRASEQV* |
Ga0066672_101240173 | 3300005167 | Soil | MVGCAGCSMPSYDRALHALRSWSDSWSGIGHVAVGMARQGCDLQLTRYDEK |
Ga0066680_107590291 | 3300005174 | Soil | MPSYDRARHALRSWLDSLVWDGHVTVGMARQDYDLQLTRYDEKGWRATF* |
Ga0066688_108925842 | 3300005178 | Soil | MTDQRGRLLVAALGFAGCSMPSYDRALHALGTVGMARQGYDLQLTRYDEKGW |
Ga0066685_108875052 | 3300005180 | Soil | SMPSYDRALHALRTWLDSWSGIGHVTVGMARRGYDLQLTRYDEKG* |
Ga0066388_1029622542 | 3300005332 | Tropical Forest Soil | MPSYNRALWTLRPPSSASWPGIDPVAVGMHRQGYDLQLTQYDD |
Ga0066388_1044306663 | 3300005332 | Tropical Forest Soil | MPSYDPALRLLRSWLDTWPGIGRVAVGMHRQGLNLQLTQYDQRGWGSMTGAVKR* |
Ga0070708_1007163232 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSYDRALWALRTWLDSWAGIGHVAVGMHRQGYDLQLTQYDERGGDDFRYAGRSVSRFTAIVQ* |
Ga0066689_109884871 | 3300005447 | Soil | MPSYDRALHALRSWSDSWSGIGHVAVGMARQGCDLQLTRYD |
Ga0066681_107429771 | 3300005451 | Soil | MPSYDRALHALRIWLDSWSGIGHVAVRMARQGYDLQLTRYDTTRR |
Ga0070707_1004398721 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSYDRALHALRSWLDCWSGIGHVAVGMARQGYDLQLTRYD |
Ga0070707_1004511563 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSYDRALHALRSWLDSWEGIGHVAVGMHRQGFDLQLTPYDDRGWRA |
Ga0070707_1005258452 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSYDRALHALRTWLDSWSGRADSWSGIGHVTVGMARQGY |
Ga0073909_103207811 | 3300005526 | Surface Soil | MPSYDRALWALRTWLDSWAGIGHVAVGMHRQGYDLQLTQYND |
Ga0066697_106760071 | 3300005540 | Soil | HALRTWLDSWAGIGHVAVGMDRQGYDLQLTQYDD* |
Ga0066698_110248292 | 3300005558 | Soil | MSSYDRSLHALRSWLDSWAGIGHVAVGMHRQGYDLQLTQYD |
Ga0066699_102678692 | 3300005561 | Soil | MVGCAGCSMPSYDRALHALRSWSDSWSGIGHVAVGMARQGYDLQLTRYDEK |
Ga0066905_1001343426 | 3300005713 | Tropical Forest Soil | YDRALWALRIWLDSWSGSGHVAVGMLRQGFDQLTQYDERG* |
Ga0066903_1002286275 | 3300005764 | Tropical Forest Soil | MLSYNRALHALRSWLDSWSGVGHVAVGMHRQGYDLQLTQYDDRG* |
Ga0066903_1008811131 | 3300005764 | Tropical Forest Soil | MPSNDRALWALLTWLDSWPGIGHVAVGMHRQSFDLQLTQYDERGWRAMFL |
Ga0066903_1013317491 | 3300005764 | Tropical Forest Soil | LSDDRAPHALRTWLDSGPGIGHVAVGMPPKGYDLQLTQYDDRGWRARF* |
Ga0066903_1034631072 | 3300005764 | Tropical Forest Soil | LVSRSRRPSYNRALWALRTRLDSWSGIGRVAFAMAHHGFDL |
Ga0066903_1083218711 | 3300005764 | Tropical Forest Soil | VGFAGCSMPSYDRALWALRTWLDSWPGIRHVAVGMHRQGFDLQLTHSRARDRQMGR* |
Ga0075432_103670042 | 3300006058 | Populus Rhizosphere | MSSYDRALWALRTWLDSWAGIGRIAVGMASQGYKLQLTQYDDRDWHAQLGANY* |
Ga0066665_101837231 | 3300006796 | Soil | LGFAGCSLPSYDRELHALRTWMDSWSGIGHIAVGMHRQGFDLQLTQYDERGWRATF |
Ga0066665_115614911 | 3300006796 | Soil | MPSYDRALWALRTWLDSWAGIGHVAVGMHRQGYDCN* |
Ga0066659_111654543 | 3300006797 | Soil | LPPVLHALHRWLDSWLGIGLVPVGTARECYDLQLTRYDEQGW* |
Ga0075428_1006759681 | 3300006844 | Populus Rhizosphere | DRALWALRTWLDSWAGIGRIAVGMASQGYKLQLTQYDDRDWHAQLGANY* |
Ga0075428_1022456562 | 3300006844 | Populus Rhizosphere | MSSYDRALHALRTWLDSWAGIGHVVVGMHRQGYDLQVTQHHDRSG |
Ga0075433_114035171 | 3300006852 | Populus Rhizosphere | MPSYDRSLHALRTWLDSWAGIGRIAAGMHRQGFDLQLTQYD |
Ga0075425_1008314581 | 3300006854 | Populus Rhizosphere | MPSYDRALHAHRTWLDSWSGTGHVAVGMHRQGFDLQLTQYDERGWRA |
Ga0075425_1019205611 | 3300006854 | Populus Rhizosphere | MAPLGFAGCALPSYDCALWALRTWLDSWPGVGHVAVGMHRQGYDLQLTQY |
Ga0075425_1026650261 | 3300006854 | Populus Rhizosphere | MPSYDRALWALRTWLDSWPGVGRVAVGMHRQGFDLQLTQYDDRGW |
Ga0075424_1017810052 | 3300006904 | Populus Rhizosphere | YDRALWALRTWLDSWPGIGHVAVGMHRQSYDLQLTQYDHRG* |
Ga0075435_1004024132 | 3300007076 | Populus Rhizosphere | MLSYDSALWTLRTWLDSWSGVGYVAVGMHRQGYDLQLTQYDDR |
Ga0075435_1004049552 | 3300007076 | Populus Rhizosphere | MPSYDRTLWALRTWLDRWSGIGHVTVGMHRQGYDPQLTQY |
Ga0066710_1003114222 | 3300009012 | Grasslands Soil | MPSYDRALWALRTWLDSWAGIGHVAVGMHRQGYDLQLTQYDERGGDDFRYAGRSVSRFTAIVQ |
Ga0075418_100991945 | 3300009100 | Populus Rhizosphere | MPSYDRTLWALRKWLDSWPGIGHVAAGMHRQGFDLQLTVCHGVLAE* |
Ga0075418_115712591 | 3300009100 | Populus Rhizosphere | MTALWALRKWLDSWSSVDHVAVGMHRQGFDLQLTQ |
Ga0066709_1004686594 | 3300009137 | Grasslands Soil | MPSYDRVLHALRLYLDSWAGIGRLAVGMARQGYDLQLTRYDERG |
Ga0114129_112261202 | 3300009147 | Populus Rhizosphere | MPSYDRVLHALRTWLDSWSGIGHVAVGMHRQGFDLH* |
Ga0114129_114905644 | 3300009147 | Populus Rhizosphere | GFARCSMPSYDRTLWALRKWLDSWPGIGHVAAGMHRQGFDLQLTVCHGVLAE* |
Ga0111538_123561991 | 3300009156 | Populus Rhizosphere | MPSYDRALWALRTWLDSWSGIGHVAVGMHRQVFDLQLTQYDDRG* |
Ga0075423_111912042 | 3300009162 | Populus Rhizosphere | MAALGFAGCSMPSYDRALWALRSWLDSWSGIGHVAVGMHRFGLQLDQ |
Ga0126380_102713171 | 3300010043 | Tropical Forest Soil | MPSYDRALWALRSWLDSRSGIGHVAVGMHRQGFDLQLTQYDERG |
Ga0126380_103926932 | 3300010043 | Tropical Forest Soil | CSAPSYDRALWAVRIWLDSWPGIGHVAVGMHRQGYDLQLTQYDESVLRAMTC* |
Ga0126380_115312622 | 3300010043 | Tropical Forest Soil | DRALWALRRWLDSWSGVGHVAVGMHRQGFDLQLTQYDERG* |
Ga0126380_115586293 | 3300010043 | Tropical Forest Soil | MPSRHPALHALRSYLDSWAGIGRIAAGMHRQGYDLQLTQYDERG* |
Ga0126380_117453282 | 3300010043 | Tropical Forest Soil | MPSYDRALWALRSWLDSWPGIGYVAVGMHRQGYDLQLTQYDERGRARDFLHDRDG |
Ga0126384_118892332 | 3300010046 | Tropical Forest Soil | LCGRPEGKPRYDHLLWALRSRLDAWAGTGRVAASMAHQGFDLQLARYDERGWRAT |
Ga0126384_123169421 | 3300010046 | Tropical Forest Soil | MTRALWALRTYLDSWAGIGRVAAGMHRQGYDLQLTQYDERG* |
Ga0126382_108192201 | 3300010047 | Tropical Forest Soil | RSYDCALWALRSYLDSWAGIGRVAVGDASPGYDLQLTQRR* |
Ga0126373_114001712 | 3300010048 | Tropical Forest Soil | MAAIGFAGCSMLSYDRALHALRSWLDSWPGTGHVAVGIHRQGLDLQLTQYDERGW |
Ga0134071_101508911 | 3300010336 | Grasslands Soil | RALHALRTWLDSWAWIGHVTVGMARQGYDLQLTRYDERG* |
Ga0126376_102928122 | 3300010359 | Tropical Forest Soil | MPSYDRALRALRTRLDSWSGVGHVAAGIHRQGFDLQFTQYDKHSWRATI* |
Ga0126376_109813852 | 3300010359 | Tropical Forest Soil | MTRAPWALRTYLDSWAGIGRVPAGMHRQGYDLQLTQYDERG* |
Ga0126372_100652851 | 3300010360 | Tropical Forest Soil | MLSYDRALWALRTWLDAWPGIGHVAVGMHRQGFDL* |
Ga0126372_102599143 | 3300010360 | Tropical Forest Soil | MPSYYRALWALRAWLDSWPGIGHVAAGTHRQGFDLQLTQYDEHGWRA |
Ga0126372_103846882 | 3300010360 | Tropical Forest Soil | MPSYDRALWALRTWLDSSSGVGHVAVGMHRQGFDLQLTQYDGRGGRAYLQL |
Ga0126372_108828332 | 3300010360 | Tropical Forest Soil | MPSYDRALWALRTWLDSWPGIGHVAVGMAHQGYDLQLTRYDERG* |
Ga0126372_119456072 | 3300010360 | Tropical Forest Soil | MLSYDRVLHALRTWLDSWPGIGHVAVGMHRQGYDLQLT |
Ga0126378_114780751 | 3300010361 | Tropical Forest Soil | MPSYDRALWALRTWLDSWPGIGHVAVGMHRQGYDLQLTQYDE |
Ga0126377_102467532 | 3300010362 | Tropical Forest Soil | MPSHDRALSALRTWLDSWFGIGHVVVGMARQGYDLEPTR* |
Ga0126377_104232472 | 3300010362 | Tropical Forest Soil | MPSYDHALHALHSWLDSWSGIGHIAVGMHWQGFDLQLTYYD |
Ga0126377_104632704 | 3300010362 | Tropical Forest Soil | VGFPRPSYDRSLWALRTWLDSWAGIGRVAVGMAHQGFDLQLTRYDERG* |
Ga0126377_105424962 | 3300010362 | Tropical Forest Soil | MLSYDHALWALRRWLDSWSGVGHVAVGMHRQGFDLQLTRYDERGWRA |
Ga0126377_110841642 | 3300010362 | Tropical Forest Soil | MPAYDRALWALRTWLGSWPGVGHVAVGMHRQGFDLQL |
Ga0126377_118771381 | 3300010362 | Tropical Forest Soil | MPSYDRALWALRTWLDSWTGIGRIAVGMHRQGYDLQLT |
Ga0126379_117741812 | 3300010366 | Tropical Forest Soil | RPVGYAGCSMPSYDRALHALRTWLDSWSGIGRVAVGMPRHGYDLHSVR* |
Ga0126379_137417611 | 3300010366 | Tropical Forest Soil | MPSYDRALWALRSYVDSWDGIGRVAVGMHRQRMTYS* |
Ga0126381_1028470072 | 3300010376 | Tropical Forest Soil | MPSYDRVLWALRTWLDSWPGIGHVTVGMHHQGFDLQLTQYD |
Ga0126383_103324304 | 3300010398 | Tropical Forest Soil | LPSYDRALWALRTWLDSWLGVGRIAVGMHRQGFDLQLTQYDD |
Ga0126383_107795201 | 3300010398 | Tropical Forest Soil | MLSYDRALWALRTWLDSWSGIGHIAVGMHRQGFDLQLTQYDDRG |
Ga0126383_111173351 | 3300010398 | Tropical Forest Soil | LPSSDRALWALRTWLDSWSGVGHVAVGMHRQGFDLQLTQYDDRGW |
Ga0126383_114883841 | 3300010398 | Tropical Forest Soil | RALWALRTWLDSWPGIGHVAVGMHHQGFDLQLTLCHSVLAE* |
Ga0124844_11318672 | 3300010868 | Tropical Forest Soil | KRSLWALRTWLDSWPGVGHVAAGMHRQGFELQFTQYDERSWRATI* |
Ga0137383_112226412 | 3300012199 | Vadose Zone Soil | MSSYDRALWALRTWLDSWPGIGHVAVGMHRQRCYDLQLTQYDERGWRASARPCSS* |
Ga0137378_100305428 | 3300012210 | Vadose Zone Soil | MSSYDRALWALRTWLDSWPGIGHAAVGMHRQRCYDLQLTQYDERGWRASARPCSS* |
Ga0137378_108049232 | 3300012210 | Vadose Zone Soil | MSSYDRALHALRSWLDSWSGIGHVAVGMARQGYDLQL |
Ga0137377_102331772 | 3300012211 | Vadose Zone Soil | MPSYDCALHALRTWLDSWSGIGHVAVGMARQGYDLQVTR* |
Ga0137377_113050041 | 3300012211 | Vadose Zone Soil | MLSYDRALHALRTWLDCWSGIGHVVVGMARQGYDLQLTRYDEK |
Ga0137386_102742731 | 3300012351 | Vadose Zone Soil | MPSYDRALHALRTWLDSWSGIGRVAVGMAHQGYDLQLTRYDE |
Ga0137384_110562721 | 3300012357 | Vadose Zone Soil | MPSYDRALHALRTWIDSWTGIGHVTVGMHRQGYDLQLTQYDE |
Ga0126375_104666702 | 3300012948 | Tropical Forest Soil | VLHALRALWALRTWLDSWPGVGHVAVGMHRQGFDLQLTQYDERGWRASEQV* |
Ga0126375_110923222 | 3300012948 | Tropical Forest Soil | MLSHDRALYAMRSWLDSRPGIGHVAVGMQRQASICN* |
Ga0126375_113976372 | 3300012948 | Tropical Forest Soil | LPSYDRALWALRTWLDSWPGIGHIAVGMHRQGFDLQLTQYDDSGWRASEQV* |
Ga0126369_101641792 | 3300012971 | Tropical Forest Soil | MLSYDRALHALRSGLDPWSGISHVAVGRHRQDFDLQLTQYDARGWRAQLGDKS* |
Ga0126369_106149881 | 3300012971 | Tropical Forest Soil | MPSYDRALWALRTWLDSWTGIGHVAVGMHRQGYGLQ |
Ga0163162_106482502 | 3300013306 | Switchgrass Rhizosphere | MPSYDRALWALRTWLDSWSGVGHVAVGMHRQGYDLQLTQYDE |
Ga0132258_103831191 | 3300015371 | Arabidopsis Rhizosphere | MLSYEPALRTLRTWLDSWPGVGHVAVGMHRQSYDL* |
Ga0132258_107702743 | 3300015371 | Arabidopsis Rhizosphere | MTSYDRALWALRTWVDSWTGIGHVAVGMHRQDTTYS* |
Ga0132258_126103032 | 3300015371 | Arabidopsis Rhizosphere | MPSYDRALWALRTWLSWSGIGHVVVGMRRQGFDLQLT |
Ga0132256_1004927952 | 3300015372 | Arabidopsis Rhizosphere | MPSYDRALWALRTWLDSWPGIGSVAVGMHRQGYDLQLTQY |
Ga0132257_1005646811 | 3300015373 | Arabidopsis Rhizosphere | MPSYDRALWALRTWLDSWPGIGRVAVSMHRQGFDLQLTQYDD |
Ga0132257_1022743892 | 3300015373 | Arabidopsis Rhizosphere | MPSYDRALWALRTWLDSWPRIGHVSVGMHRQGFDLQLTQYDDRG* |
Ga0182033_102428601 | 3300016319 | Soil | MPSYDRALWALRTWLDSWTGIGHVAVGMHRQGFDLPLTQYDD |
Ga0182033_117663902 | 3300016319 | Soil | MPSYDRALWALRSWLDSWSGIGHVAVGMHRQGFDLQLTQYDERG |
Ga0182040_109446851 | 3300016387 | Soil | MPSYDRALWALRTLLDSWSGIGHVAVGMYRQGFDLQLTQYDER |
Ga0134112_105155881 | 3300017656 | Grasslands Soil | LQTWLDSWEGIGQVAVGMHRQGYDLQLTQYDESWLACDLLHDGDGALAH |
Ga0184639_101070534 | 3300018082 | Groundwater Sediment | VRLLSYDRALWALRFWLDSWSGIGHVAVGMAREGYDLQLTRYD |
Ga0126371_106005083 | 3300021560 | Tropical Forest Soil | MLSCDRALWALRIWLDSWSGVGRVAVGMHRQGFDL |
Ga0126371_111052492 | 3300021560 | Tropical Forest Soil | MPSSDRALHALRTWPDSWPAIGHVAVGMHRQGFDLQLT |
Ga0207646_101984752 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SYDRALQALCTWLDSWSGIGHVTVGMARQGFDLQLTRYDEKG |
Ga0207704_105415303 | 3300025938 | Miscanthus Rhizosphere | MPSYDRALWALRTWLDSWAGIGHVAVGMHRQGYDLQLTQYDDK |
Ga0209237_10606433 | 3300026297 | Grasslands Soil | MPSYDRALWALRTWLDSWAGIGHVAVGMHRQGYDLQLTQYDERGGDDFRYAGRSVS |
Ga0209238_11571562 | 3300026301 | Grasslands Soil | MPSYDRALHALRTWLDSWSGIGHVAVGMARQDATTLDGH |
Ga0209761_10899745 | 3300026313 | Grasslands Soil | VGFTGYSMRSYDRSSTPSRTWLDSWSGIGHVTVGMARQGYDL |
Ga0209154_10681731 | 3300026317 | Soil | MPSYDRALHALRSWSDSWSGIGHVAVGMARQGCDLQLTRYDEKLAGHVL |
Ga0209802_10087435 | 3300026328 | Soil | MPSYDRALWALRTWLDSWSGIGHVAVGMHRQGFDLQLTQYDDRG |
Ga0209803_10363611 | 3300026332 | Soil | MPSYDRALHALRSWLDSWSGIGHVTVGMARQGYDLQLTRYD |
Ga0209158_11992721 | 3300026333 | Soil | MPSYDRALHALRSWLDSWSGIGHVTVGMARQGYDLQL |
Ga0209160_11761342 | 3300026532 | Soil | MVGCAGCSMPSYDRALHALRSWSDSWSGIGHVAVGMARQGCD |
Ga0209887_10355162 | 3300027561 | Groundwater Sand | VIDHRALSALRFWLDSWSGIGVIAAGMARQARALQLTRYD |
Ga0209465_104301081 | 3300027874 | Tropical Forest Soil | MAAVGFAGCSMLSYDRALWALRSWLDSWPGVGHLVAGMHRQGFDVQLTQY |
Ga0209481_103847773 | 3300027880 | Populus Rhizosphere | LPSHERALHALRTWLDSWSGIGHVAVGMYRQGFDLQLTRQ |
Ga0209382_101936012 | 3300027909 | Populus Rhizosphere | MPSYDRTLWALRKWLDSWPGIGHVAAGMHRQGFDLQLTVCHGVLAE |
Ga0209382_107530271 | 3300027909 | Populus Rhizosphere | VTLRAAPRHPALAAAHGCLDSWRGIGDVVVGMHRQGYDVQLTQYDARG |
Ga0209382_113937311 | 3300027909 | Populus Rhizosphere | MPSYDRALWALRWWLDLWAGIGHVEVGMHRQGYDLQLTQYDERGW |
Ga0307278_100174802 | 3300028878 | Soil | MLSYDRALWALRFWLDSWPGIGAIATGMARQGYEIQLTRYDEKG |
Ga0307497_100274682 | 3300031226 | Soil | MAALGFAGCSMLSYDRALHALRTWLDSWEGIGHVAVGMHRQGYDLQLTQYDD |
Ga0318516_105109582 | 3300031543 | Soil | MPSYDRALWALRTWLDSWSGIGRIAVGMARQGYDLQLTR |
Ga0318534_107733881 | 3300031544 | Soil | MLSYDRALWALRTWLDSWAGIGHVAVGMHRQGYDLQLTQYDDRGKRD |
Ga0318541_108023951 | 3300031545 | Soil | MIGRWALRTWLDSWPGVGHVAVGMHRQGYDLQLPQYDDS |
Ga0310886_108306861 | 3300031562 | Soil | MPSYDRALWALCTWLDSWSGIGRVAVGMHRQGFDLQLTQ |
Ga0318574_105783832 | 3300031680 | Soil | MLSYGRAPWALRAWLDSWPGVGHVAVGMHRHGYDLQLTQYDERAWCTSEQ |
Ga0307469_101461342 | 3300031720 | Hardwood Forest Soil | MPSYDRALHALRTWLDSWAGIGHVAVGMHRQGYDLQLTQYDD |
Ga0307469_102631301 | 3300031720 | Hardwood Forest Soil | MIVSLWALRFRLESLEGIGRVMVGMARQGFDLELTRYE |
Ga0318494_103034691 | 3300031751 | Soil | MLSYDRALWALRTWLDSWAGIGHVAVGMHRQGYDLQLTQYDDRGKRDLLH |
Ga0318535_104983691 | 3300031764 | Soil | MAALGFAGCSMLSYDRALHALRAWLDSWAGIGRVAVGMHRQGFDLQLTQY |
Ga0318521_109491752 | 3300031770 | Soil | MLSYDRALWALRTWLDSWAGIGHVAVGMHRQGYDLQLT |
Ga0318557_103772961 | 3300031795 | Soil | MPSNDRALHALRSWLDSWSGVGRVAVGMHRQGFDLQLTQYDDQGW |
Ga0318576_101137171 | 3300031796 | Soil | MLSYDRALWALRTWLDSWAGIGHVAVGMHRQGYDLQ |
Ga0307473_106227191 | 3300031820 | Hardwood Forest Soil | MPSYDRALWALRTWLDSWSGIGHVAVGMARQSYDLQLTRYDEKGWRATF |
Ga0318551_105964491 | 3300031896 | Soil | MIGRWALRTWLDSWPGVGHVAVGMHRQGYDLQLPQYDD |
Ga0306923_101271312 | 3300031910 | Soil | MLSYGRAPWALRAWLDSWPGVGHVAVGMHRHGYDLQLTQYDERAWCTSEQV |
Ga0306921_102281051 | 3300031912 | Soil | MPTSDRALHALRFWLDSWPGIGHVAVGMHRQGFDLQLTQYDERGWRASFY |
Ga0310912_102115182 | 3300031941 | Soil | MAAVGFAGCSMPSNHRALWALRKWLDSWPGFGHVAVGMHSQDFDLQLTQYDDRG |
Ga0306926_112820021 | 3300031954 | Soil | SMLSCDRALHALRSWLNSWSGVGHVAVGMHRQGHDLQLTQYDERAVAGDVLS |
Ga0318570_104230821 | 3300032054 | Soil | MPSYDRALWALRTWLDSWPGIGHVAVGMHRQGFDLQLTQYDERGWRATF |
Ga0318533_104902661 | 3300032059 | Soil | MPSYDRALWALRTWLDSWTGIGHVAVGMHRQGFDL |
Ga0307471_1009981042 | 3300032180 | Hardwood Forest Soil | MPSNRALWALRAWLDSWSGIGHIAVGMHRQGFDLQLTQYDERGWRATF |
Ga0307471_1013203173 | 3300032180 | Hardwood Forest Soil | MLSYDRALHALRAWLDSWTGIGHVAAGMHRQGYDLQLTQYGGR |
Ga0306920_1034875411 | 3300032261 | Soil | MFPSSDLWALRSWLDSWPGIGHVAAGMHRQGFDLQLTQ |
⦗Top⦘ |