NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F044726

Metagenome / Metatranscriptome Family F044726

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044726
Family Type Metagenome / Metatranscriptome
Number of Sequences 154
Average Sequence Length 59 residues
Representative Sequence MHKFHKEPYFMNHIYAQYFHPETLLERVRDVRFYRYPRTLFKGFKVPDWATADKRNGW
Number of Associated Samples 140
Number of Associated Scaffolds 154

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 29.87 %
% of genes near scaffold ends (potentially truncated) 57.79 %
% of genes from short scaffolds (< 2000 bps) 98.70 %
Associated GOLD sequencing projects 129
AlphaFold2 3D model prediction Yes
3D model pTM-score0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.403 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(16.234 % of family members)
Environment Ontology (ENVO) Unclassified
(43.506 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(53.247 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.56%    β-sheet: 0.00%    Coil/Unstructured: 67.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000736|JGI12547J11936_1019224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1654Open in IMG/M
3300000882|FwDRAFT_10346165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea582Open in IMG/M
3300002161|JGI24766J26685_10067346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea783Open in IMG/M
3300002835|B570J40625_100340005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1494Open in IMG/M
3300004240|Ga0007787_10356784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata726Open in IMG/M
3300004242|Ga0066601_10271213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea659Open in IMG/M
3300004769|Ga0007748_10835423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata829Open in IMG/M
3300004788|Ga0007742_11133938All Organisms → Viruses → Predicted Viral1069Open in IMG/M
3300004795|Ga0007756_11622581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea892Open in IMG/M
3300005516|Ga0066831_10025823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1594Open in IMG/M
3300005662|Ga0078894_10304419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1445Open in IMG/M
3300006037|Ga0075465_10015097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1483Open in IMG/M
3300006124|Ga0007873_1074039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea561Open in IMG/M
3300006165|Ga0075443_10036186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1649Open in IMG/M
3300006424|Ga0075497_1461902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea974Open in IMG/M
3300006803|Ga0075467_10097013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1758Open in IMG/M
3300006805|Ga0075464_10078929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1866Open in IMG/M
3300006805|Ga0075464_10081774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1835Open in IMG/M
3300007230|Ga0075179_1669425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1450Open in IMG/M
3300007231|Ga0075469_10031010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1715Open in IMG/M
3300008055|Ga0108970_11458146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300008107|Ga0114340_1103394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1135Open in IMG/M
3300008262|Ga0114337_1251213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea676Open in IMG/M
3300008930|Ga0103733_1017076All Organisms → Viruses → Predicted Viral1075Open in IMG/M
3300008958|Ga0104259_1013845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata767Open in IMG/M
3300008998|Ga0103502_10093210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1065Open in IMG/M
3300009071|Ga0115566_10105168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1810Open in IMG/M
3300009077|Ga0115552_1070660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1553Open in IMG/M
3300009159|Ga0114978_10606871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata632Open in IMG/M
3300009172|Ga0114995_10573096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea617Open in IMG/M
3300009187|Ga0114972_10070172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2355Open in IMG/M
3300009193|Ga0115551_1239814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea804Open in IMG/M
3300009239|Ga0103858_10024864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1341Open in IMG/M
3300009422|Ga0114998_10137236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1184Open in IMG/M
3300009436|Ga0115008_10285895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1171Open in IMG/M
3300009436|Ga0115008_11431685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea533Open in IMG/M
3300009441|Ga0115007_10160856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1443Open in IMG/M
3300009466|Ga0126448_1019484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1636Open in IMG/M
3300009497|Ga0115569_10140950All Organisms → Viruses → Predicted Viral1165Open in IMG/M
3300009544|Ga0115006_11539403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea602Open in IMG/M
3300009593|Ga0115011_11008319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea705Open in IMG/M
3300009677|Ga0115104_10679630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea574Open in IMG/M
3300009677|Ga0115104_10995506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea954Open in IMG/M
3300009684|Ga0114958_10263174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea850Open in IMG/M
3300009785|Ga0115001_10207373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1266Open in IMG/M
3300009785|Ga0115001_10415605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea839Open in IMG/M
3300010404|Ga0129323_1090466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea805Open in IMG/M
3300012012|Ga0153799_1026100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1144Open in IMG/M
3300012731|Ga0157616_1284612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea640Open in IMG/M
3300012953|Ga0163179_11526570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea602Open in IMG/M
3300012953|Ga0163179_11800967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea559Open in IMG/M
3300013005|Ga0164292_10582184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia725Open in IMG/M
3300013310|Ga0157622_1186919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea608Open in IMG/M
3300013372|Ga0177922_10834150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1263Open in IMG/M
3300016748|Ga0182043_1028406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea805Open in IMG/M
3300017735|Ga0181431_1028527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1287Open in IMG/M
3300017745|Ga0181427_1121768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea636Open in IMG/M
3300017772|Ga0181430_1219419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata540Open in IMG/M
3300017788|Ga0169931_10182970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1818Open in IMG/M
3300017949|Ga0181584_10482755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii764Open in IMG/M
3300018048|Ga0181606_10152126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1391Open in IMG/M
3300018424|Ga0181591_11127586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata527Open in IMG/M
3300018690|Ga0192917_1014181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1114Open in IMG/M
3300018771|Ga0193314_1017756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1292Open in IMG/M
3300018846|Ga0193253_1025121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1401Open in IMG/M
3300018872|Ga0193162_1008917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia1650Open in IMG/M
3300018974|Ga0192873_10036974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia1734Open in IMG/M
3300018980|Ga0192961_10064085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1080Open in IMG/M
3300018989|Ga0193030_10052351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1104Open in IMG/M
3300019006|Ga0193154_10079455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1159Open in IMG/M
3300019051|Ga0192826_10243979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea662Open in IMG/M
3300019151|Ga0192888_10081401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1098Open in IMG/M
3300019153|Ga0192975_10107261All Organisms → Viruses → Predicted Viral1017Open in IMG/M
3300020048|Ga0207193_1276492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1235Open in IMG/M
3300020155|Ga0194050_1175929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata583Open in IMG/M
3300020166|Ga0206128_1143206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea973Open in IMG/M
3300020172|Ga0211729_10637181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1254Open in IMG/M
3300020202|Ga0196964_10059076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1630Open in IMG/M
3300020732|Ga0214201_1063234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea517Open in IMG/M
3300021108|Ga0214162_1009306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia1843Open in IMG/M
3300021342|Ga0206691_1672135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1043Open in IMG/M
3300021365|Ga0206123_10066220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1809Open in IMG/M
3300021908|Ga0063135_1048069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1404Open in IMG/M
3300021913|Ga0063104_1024707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1114Open in IMG/M
3300021913|Ga0063104_1028975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1055Open in IMG/M
3300021957|Ga0222717_10435971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea717Open in IMG/M
3300021959|Ga0222716_10464462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea720Open in IMG/M
3300021962|Ga0222713_10626094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea624Open in IMG/M
3300023081|Ga0255764_10284990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata765Open in IMG/M
3300024343|Ga0244777_10042407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2903Open in IMG/M
3300025138|Ga0209634_1168569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea872Open in IMG/M
3300025355|Ga0208254_1010714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea618Open in IMG/M
3300025375|Ga0208259_1034109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata723Open in IMG/M
3300025387|Ga0207959_1046967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea655Open in IMG/M
3300025451|Ga0208426_1043858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea689Open in IMG/M
3300025606|Ga0207954_1052962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1097Open in IMG/M
3300025626|Ga0209716_1160990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea572Open in IMG/M
3300025680|Ga0209306_1131187All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea723Open in IMG/M
3300025699|Ga0209715_1044369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1958Open in IMG/M
3300025699|Ga0209715_1120516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea931Open in IMG/M
3300025887|Ga0208544_10073231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1597Open in IMG/M
3300025887|Ga0208544_10265540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea681Open in IMG/M
3300025896|Ga0208916_10045420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1795Open in IMG/M
3300025896|Ga0208916_10073412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1426Open in IMG/M
3300026182|Ga0208275_1015299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1655Open in IMG/M
3300026458|Ga0247578_1107412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea550Open in IMG/M
3300027188|Ga0208921_1041441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea682Open in IMG/M
3300027192|Ga0208673_1073119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea535Open in IMG/M
3300027720|Ga0209617_10044283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1888Open in IMG/M
3300027771|Ga0209279_10028589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1653Open in IMG/M
3300027805|Ga0209229_10246889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea794Open in IMG/M
3300027810|Ga0209302_10092833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1533Open in IMG/M
3300027836|Ga0209230_10119805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1479Open in IMG/M
3300027974|Ga0209299_1227372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia673Open in IMG/M
3300028137|Ga0256412_1052976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1414Open in IMG/M
3300028279|Ga0228613_1064673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea863Open in IMG/M
3300028282|Ga0256413_1133430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea902Open in IMG/M
3300028290|Ga0247572_1070161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea851Open in IMG/M
3300028333|Ga0247595_1055776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea656Open in IMG/M
3300028333|Ga0247595_1066490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea601Open in IMG/M
3300029915|Ga0311358_10773495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea693Open in IMG/M
3300029917|Ga0311326_10553516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea557Open in IMG/M
3300030671|Ga0307403_10093425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1439Open in IMG/M
3300030702|Ga0307399_10230041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea865Open in IMG/M
3300030721|Ga0308133_1022542All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea872Open in IMG/M
3300030724|Ga0308138_1040657All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea657Open in IMG/M
3300031231|Ga0170824_121815055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1130Open in IMG/M
3300031524|Ga0302320_10913476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea948Open in IMG/M
3300031580|Ga0308132_1120101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea539Open in IMG/M
3300031621|Ga0302114_10062229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1805Open in IMG/M
3300031626|Ga0302121_10062623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1135Open in IMG/M
3300031710|Ga0307386_10099229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1271Open in IMG/M
3300031717|Ga0307396_10126239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1181Open in IMG/M
3300031784|Ga0315899_10263205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1716Open in IMG/M
3300031784|Ga0315899_10849384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea829Open in IMG/M
3300032050|Ga0315906_11205263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea548Open in IMG/M
3300032481|Ga0314668_10165889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1106Open in IMG/M
3300032518|Ga0314689_10150243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1170Open in IMG/M
3300032518|Ga0314689_10265897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea897Open in IMG/M
3300032519|Ga0314676_10235727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1049Open in IMG/M
3300032520|Ga0314667_10384185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea778Open in IMG/M
3300032540|Ga0314682_10541331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea639Open in IMG/M
3300032666|Ga0314678_10112742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1090Open in IMG/M
3300032754|Ga0314692_10185509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1100Open in IMG/M
3300032755|Ga0314709_10702742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea604Open in IMG/M
3300033984|Ga0334989_0077896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1832Open in IMG/M
3300033984|Ga0334989_0113543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1505Open in IMG/M
3300033984|Ga0334989_0377628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia734Open in IMG/M
3300034019|Ga0334998_0511494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia668Open in IMG/M
3300034064|Ga0335001_0451087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia686Open in IMG/M
3300034072|Ga0310127_201368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea739Open in IMG/M
3300034116|Ga0335068_0120991All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1446Open in IMG/M
3300034120|Ga0335056_0675729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea526Open in IMG/M
3300034280|Ga0334997_0583639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii691Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine16.23%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine10.39%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater7.79%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous7.79%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater5.84%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine5.19%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.55%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater3.25%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake3.25%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.25%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.60%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.95%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment1.95%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.95%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.95%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.95%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.95%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.95%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.95%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.95%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment1.30%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.30%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.30%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.65%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.65%
Freshwater And MarineEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine0.65%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.65%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.65%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.65%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.65%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.65%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.65%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.65%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000736Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011EnvironmentalOpen in IMG/M
3300000882Freshwater microbial communities from the Columbia RiverEnvironmentalOpen in IMG/M
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300004242Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11EnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004788Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004795Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006124Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH26May08EnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006424Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007230Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009239Microbial communities of water from Amazon river, Brazil - RCM11EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009684Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaGEnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010404Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012731Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013310Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300016748Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011502CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018690Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782228-ERR1712109)EnvironmentalOpen in IMG/M
3300018771Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001658 (ERX1789535-ERR1719438)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018872Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_E500000196 (ERX1789513-ERR1719216)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019006Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000394 (ERX1782339-ERR1711936)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020155Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L239-10mEnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020202Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10EnvironmentalOpen in IMG/M
3300020732Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 epilimnionEnvironmentalOpen in IMG/M
3300021108Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021908Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S11 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300023081Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaGEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025355Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025375Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22May08 (SPAdes)EnvironmentalOpen in IMG/M
3300025387Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025451Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025606Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027188Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes)EnvironmentalOpen in IMG/M
3300027192Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027836Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027974Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028279Seawater microbial communities from Monterey Bay, California, United States - 14DEnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028333Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 60R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030724Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_949_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034064Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054EnvironmentalOpen in IMG/M
3300034072Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-AEnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034280Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12547J11936_101922423300000736Freshwater And SedimentMFHIYAQYFHPETVLERVRDTSLHRRPRTIFKGFTVPDWATAEKRHGWAVDAYSR*
FwDRAFT_1034616523300000882Freshwater And MarineVYCNKFHKEPYIMYHMYAQYFHPSTLLERVRDVRFYRQPRTIFKGFKVPDWATSKEHAGWEFDAYSRQAW*
JGI24766J26685_1006734623300002161Freshwater And SedimentMNKFHKEPYIQHHIFAQYFHPDSLLERVREVRFYRQPRTLFKGFRVPDWATAEKNH
B570J40625_10034000533300002835FreshwaterMFHIYAQYFHPETLLERVRDTSFHRRPRTIFKGFTVPDWATAEKRHGWQVDAYSR*
Ga0007787_1035678413300004240Freshwater LakeMRVEDVYANKFHKEPYIMMHLYAQYFHPSTLLERVRDVRFYRNPRTMFKGFKVPDWATAKEQHGWEFDAYSR*
Ga0066601_1027121313300004242FreshwaterMNKFHKEPYIQFHIYGQYFHPETLLERVRDVNFYRRPRTLFKGFKVPDWATAEKRHGWELDAYSR
Ga0007748_1083542343300004769Freshwater LakeKFHKEPYIMMHVYAQYFHPTTMLERVRDVRFYRNPRTMFKGFRVPDWATSKEHAGWEFDAYSRQAW*
Ga0007742_1113393813300004788Freshwater LakePYIMFHMYAQYFHPSTVLERVRDVRFYRQPRTIFKGFKVPDWATSKEHAGWEFDAYSRQAW*
Ga0007756_1162258133300004795Freshwater LakeMMHVYAQYFHPTTMLERVRDVRFYRNPRTMFKGFRVPDWATSKEHAGWEFDAYSRQAW*
Ga0066831_1002582323300005516MarineMNHVYAQYFHPHTLLERVRDVSFIRRPRTLFKGFKVPEWATAEKEQGW*
Ga0078894_1030441933300005662Freshwater LakeMRIEDVYANKFHKEPYVMMHLYAQYFHPTTLLERVRDVRFYRNPRTIFKGFKVPDWATAKE*
Ga0075465_1001509733300006037AqueousMYHMYAQYFHPSTLLERVRDVRFYRQPRTIFKGFKVPDWATSKEHAGWEFDAYSRQAW*
Ga0007873_107403913300006124FreshwaterMYHIYSQYFHPNTLIERTRDVAFYRRPRTLFKGFTVPDWAKAENTCGWEADEYSRQAWD
Ga0075443_1003618623300006165MarineMHKFHKEPYIMHHIFAQYFHPESLLERVRDVSFYRRPRTLFKGFRVPDWATSEKRNGW*
Ga0075497_146190223300006424AqueousGIRIEDFYCQKFHKEPYVMNHIWAQHFHPENLLERVRDTSFYRRPRTLYKGFRVPDWATAEQRNGW*
Ga0075467_1009701333300006803AqueousMMHMYAQYFHPSTLLERVREVRAYRMPRVMFKGFRAPDWATAKE*
Ga0075464_1007892943300006805AqueousLIYYLGLRVEDVYCNKFHKEPYIMYHMYAQYFHPSTLLERVRDVRFYRQPRTIFKGFKVPDWATSKEHAGWEFDAYSRQAW*
Ga0075464_1008177453300006805AqueousMRVEDVYANKFHKEPYIMMHLYAQYFHPSTLLERVRDVRFYRNPRTMFKGFRVPDWATAKEQHGWEFDAYSR*
Ga0075179_166942533300007230Wastewater EffluentMNKFHKEPYIQFHIYAQYFHPDTLLERVRDVNFYRRPRTLFKGFKVPDWATAEKRHGWELDAYSR*
Ga0075469_1003101023300007231AqueousMNHIWAQHFHPENLIERVRDTSFYRKPRTLYKGFRVPDWATAEKRNGW*
Ga0108970_1145814613300008055EstuaryMRVGDVYNNKFHKEPYVMMHLYAQYFHPTTLLERVRDVRFYRQPRTMFKGFKVPDWATAKEAHGWEIDMYSRQA
Ga0114340_110339423300008107Freshwater, PlanktonMFHIYAQYFHPETLLERVRDTSFHRRPRTIFKGFTVPDWATAERRHGWQVDAYSR*
Ga0114337_125121313300008262Freshwater, PlanktonKFHKEPYFMFHIYAQYFHPETLLERVRDTSFHRRPRTIFKGFTVPDWATAEKRHGWQVDAYSR*
Ga0103733_101707613300008930Ice Edge, Mcmurdo Sound, AntarcticaHKFHKEPYIMHHIFAQYFHPESLLERVRDVSFYRRPRTLFKGFRVPDWATSEKRNGW*
Ga0104259_101384523300008958Ocean WaterMRVEDIYCNKFHKEPYVMHHLFAQHFHPSTLLERVRDVRFYRQPRTMFKGFTVPDWATAQQ*
Ga0103502_1009321013300008998MarineQYFHPHTLLERVRNVAFYRRPRTIYKGFTVPDWARAENSDGWEFDFYSQ*
Ga0115566_1010516823300009071Pelagic MarineMNHIYAQNFHPDTLLERVREVAFYRRPRTLFKGFKVPDWATAEQRHGW*
Ga0115552_107066013300009077Pelagic MarineMNHVYAQYFHPETLLERVRDVHFYRKTRTLYKGFKVPEWAQADKMNGW*
Ga0114978_1060687113300009159Freshwater LakeMRVEDVYCNKFHKEPYIMMHLYAQYFHPTTLLERVRDVRFYRNPRTMFKGFKVPDWATAKEKHGWEFDAYSR*
Ga0114995_1057309613300009172MarineMNKFHKEPYFMMHIYAQYFHPSTLLERVRDVRFHRNPRTLFKGFRVPDWATAENRNGW*
Ga0114972_1007017223300009187Freshwater LakeMFHMYAQYFHPSTLLERVRDVRFYRQPRTIFKGFKVPDWATSKEHAGWEFDAYSRQAW*
Ga0115551_123981413300009193Pelagic MarineFNVLGIRLEDFYHNKFHKEPYFMNHVYAQYFHPETLLERVRDVHFYRKTRTLYKGFKVPEWAQADKMNGW*
Ga0103858_1002486433300009239River WaterRIEDVYVNKFHKEPYFMHHIYAQYFHPETLLERVRDVRFYRNPRTIFKGFKVPDWATAKE
Ga0114998_1013723633300009422MarineGIRVEDFYCQKFHKEPYFMFHIYAQNFHPDSLLERIRDVNFYRRTRTLYKGFKVPEWATA
Ga0115008_1028589533300009436MarineILIIGIRVEDFYCQKFHKEPYFMFHIYAQNFHPDSLLERVRDVNFYRRTRTLYKGFKVPEWATA*
Ga0115008_1143168513300009436MarineTLFSNITGIRIEDFYMHKFHKEPYFMNHIYAQYFHPDTLLERVREVRFYRYPRTLFKGFRVPDWATADKRHGW*
Ga0115007_1016085613300009441MarineLKLIVGIRIEDFYLLKFHKEPYFMNHIYAQYFHPETMLERVRDVRFYRYPRTLFKGFKVPDWATADKRSGW*
Ga0126448_101948423300009466Meromictic PondMNHIYAQYFHPDTLLERVRDVAFYRRPRTLFKGFRVPDWATAEKTSGW*
Ga0115569_1014095013300009497Pelagic MarineKFHKEPYIMMHIYAQNFHPDTMLERVRDVSFYRRPRTLFKGFKVPDWATSEVRNGW*
Ga0115006_1153940313300009544MarinePYIMNHIWAQHFHPENLLERVRDTSFYRRPRTLYKGFRVPDWATAEKRNGW*
Ga0115011_1100831913300009593MarineMLKFHKEPYFMHHVYAQYFHPETLLERVRDVRFYRYPRTLFKGFKVPDWGTADKRSGW*
Ga0115104_1067963013300009677MarineGIRIEDFYCQKFHKEPYIMNHVWAQHFHPENLLERVRDVSFYRKPRTLYKGFRVPDWATAEKRNGW*
Ga0115104_1099550613300009677MarineYFHPDTLLERVRDVRFYRYPRTLFKGFKVPDWATYEKRNGW*
Ga0114958_1026317413300009684Freshwater LakeMFHIYAQYFHPETVLERVRDTSFHRRPRTIFKGFTVPDWATAEKRHGW*
Ga0115001_1020737313300009785MarineLFWLTIGLRIEDFYMQKFHKEPYFMFHIYAQYFHPSTLLERVRDVRFIRNPRTLFKGFKVPDWATSDNRNGW*
Ga0115001_1041560513300009785MarineMFSGIRIEDFYLHKFHKEPYFMNHVYAQYFHPETLLERVRDVRFYRYPRTLFKGFKVPDWGTADQRNGW*
Ga0129323_109046613300010404AqueousPYIMNHIYAQNFHPDTLLERVREVAFYRRPRTLFKGFKVPDWATAEQRHGW*
Ga0153799_102610033300012012FreshwaterLRVEDIYCNKFHKEPYIMFHMYAQYFHPSTLLERVRDVRFYRQPRTIFKGFKVPDWATSKEHAGWEFDAYSRQAW*
Ga0157616_128461213300012731FreshwaterHIYAQYFHPETLLERVRDTSFHRRPRTIFKGFTVPDWATAEKRHGWQVDAYSR*
Ga0163179_1152657023300012953SeawaterYAQYFHPETLLERVRDVRFYRYPRTLFKGFRVPDWAGPDKRGGW*
Ga0163179_1180096723300012953SeawaterMHKFHKEPYFMNHIYAQYFHPDTLLERVRDVRFYRYPRTLFKGFRVPDWATADKRSGW*
Ga0164292_1058218423300013005FreshwaterMRVEDVYNNKFHKEPYVMMHLYAQYFHPTTLLERVRDVRFYRQPRTMFKGFKVPDWATA
Ga0157622_118691923300013310FreshwaterHIYAQYFHPSSLLERVKDVQFYRRPRTMFKGFRVPDWATAEKTSGW*
Ga0177922_1083415033300013372FreshwaterLRVEDVYCNKFHKEPYIMFHMYAQYFHPSTVLERVRDVRFYRQPRTIFKGFKVPDWATSKEHAGWEFDAYSRQAW*
Ga0182043_102840613300016748Salt MarshHVYAQYFHPDTLLERVRDVAFYRRPRTLFKGFRVPDWATAEKRHGW
Ga0181431_102852713300017735SeawaterMHKFHKEPYFMNHLYAQYFHPETLLERVRDVRFYRYPRTLFKGFRVPDWAGPEKRGGW
Ga0181427_112176823300017745SeawaterMHKFHKEPYFMNHIYAQYFHPETLLERVRDVRFYRYPRTLFKGFKVPDWATADKRNGW
Ga0181430_121941923300017772SeawaterMRIEDVYCNKFHKEPYIMHHIYAQYFHPETLLERVRDVRFYRQPRTMFKGFKVPDWATSKEKHGWE
Ga0169931_1018297023300017788FreshwaterMRVEDVYANKFHKEPYIMMHLYAQYFHPSTLLERVRDVRFYRNPRTIFKGFRVPDWAQAKQQHGWEFDAYSR
Ga0181584_1048275523300017949Salt MarshMHHIYAQYFHPETLLERVRDVRFYRQPRTIFKGFKVPDWATSKEKHGWEVDYH
Ga0181606_1015212613300018048Salt MarshMNHVYAQYFHPDTLLERVRDVAFYRRPRTLFKGFRVPDWATAEKRHGW
Ga0181591_1112758613300018424Salt MarshMRIEDVYNNKFHKEPYIMKHIYAQNFHPETLLERVRDVSFYRRPRTLFKGFKVPDWATAEQRNGWEIDAYSRQAWDN
Ga0192917_101418113300018690MarineGKEPYVLMHMYSQYFHPHTLLERVRNVAFYRRPRTIYKGFTVPDWARAENSDGWEFDFYS
Ga0193314_101775633300018771MarineVKFHKEPYVLMHMYSQYFHPHTLLERVRNVAFYRRPRTIYKGFTVPDWARAENTDGGWEFDFYSQQAW
Ga0193253_102512123300018846MarineMWHTFAQYFHPESLMERVRNVQFYRKTRTLYKGFKVPEWAQADKRDGW
Ga0193162_100891733300018872MarineMHHVYAQYFHPETLLERVRDVSFYRRPRTIFKGFKVPDWAQNQN
Ga0192873_1003697433300018974MarineMHHVYAQYFHPDTLLERVRDVSFYRRPRTIFKGFKVPDWAQNQN
Ga0192961_1006408513300018980MarineYCQKFHKEPYFMNHVYAQYFHPDSMLERVRDVRFYRYPRTLFKGFRVPDWATADKRSGW
Ga0193030_1005235133300018989MarineANKFHKEPYILNHIYAQYFHPSTLLERVKDVAFYRRPRTIFKGFSVPDWATAEK
Ga0193154_1007945513300019006MarineTREGGFRIEDLYSVKFHKEPYVLMHMYSQYFHPHTLLERVRNVAFYRRPRTIYKGFTVPDWARAENSDGWEFDFYSQ
Ga0192826_1024397913300019051MarineDFYVQKFHKEPYFMHHVYAQYFHPETLLERVRDVNFYRRTRTLYKGFKVPEWAQADKMNG
Ga0192888_1008140113300019151MarineKEPYVLMHMYSQYFHPHTLLERVRNVAFYRRPRTIYKGFTVPDWARAENSDGWEFDFYSQ
Ga0192975_1010726113300019153MarineEIGIRIEDFYMHKFHKEPYIMHHIFAQYFHPESLLERVRDVSFYRRPRTLFKGFRVPDWATSEKRNGW
Ga0207193_127649213300020048Freshwater Lake SedimentMFHIYAQYFHPETVLERVRDTSFHRRPRTIFKGFTVPDWATAEKRHGW
Ga0194050_117592913300020155Anoxic Zone FreshwaterMRVEDVYCNKFHKEPYIMMHLYAQYFHPSTLLERVRDVRFYRNPRTMFKGFKVPDWATAKEQHGWEFDAYSRQAWA
Ga0206128_114320613300020166SeawaterMKFHKEPYFMNHVYAQNFHPSTLLERVRDVCFIRRPRTIFKGFKVPDWATADNMHGWQRDDYSKNAWE
Ga0211729_1063718123300020172FreshwaterMFHIYAQYFHPETLLERVRDTSFHRRPRTIFKGFTVPDWATAEKRHGWQVDAYSR
Ga0196964_1005907613300020202SoilMNKFHKEPYIQFHIYAQYFHPDTLLERVRDVRFFRQPRTLFKGFKVPDWARNDLRTGWDLDTYSR
Ga0214201_106323413300020732FreshwaterIGIRIEDMYFQKFHKEPYFMFHIYAQYFHPETLLERVRDTSFHRRPRTIFKGYTVPDWATAEKRHGW
Ga0214162_100930623300021108FreshwaterMRVEDVYANKFHKEPYIMMHLYAQYFHPSTLLERVRDVRFYRNPRTIFKGFKVPDWATAK
Ga0206691_167213533300021342SeawaterMNHIYAQYFHPHTLLERVRDVAFYRRPRTIFKGFKVPEWATAEKRHGWEFDGHSR
Ga0206123_1006622023300021365SeawaterMNHIYAQNFHPDTLLERVREVAFYRRPRTLFKGFKVPDWATAEQRHGW
Ga0063135_104806923300021908MarineMWHTFAQYFHPESLMERVRDVQFYRKTRTLYKGFKVPEWAQADKRNGW
Ga0063104_102470713300021913MarinePYIMNHIWAQHFHPENLLERVRDTSFYRRPRTLYKGFRVPDWATAEKRNGW
Ga0063104_102897513300021913MarineKEPYIMNHIWAQHFHPENLLERVRDTSFYRRPRTLYKGFRVPDWATAEKRNGW
Ga0222717_1043597113300021957Estuarine WaterYMHKFHKEPYFMHHLYAQYFHPETLLERVRDVRFYRYPRTLFKGFRVPDWATADKRSGW
Ga0222716_1046446223300021959Estuarine WaterMHHIYAQYFHPDTLLERIREVSFYRRPRTLFKGFRVPDWATAEKTHGWQQDAY
Ga0222713_1062609413300021962Estuarine WaterMFHVYAQNFHPDTLLERVRDVSFYRRPRTLFKGFKVPDWATSENRNGWQIDAYSR
Ga0255764_1028499023300023081Salt MarshMHHIYAQYFHPETLLERVRDVRFYRQPRTIFKGFKVPDWATSKEKHGWEVDYHS
Ga0244777_1004240733300024343EstuarineMYHMYAQYFHPSTLLERVRDVRFYRQPRTIFKGFKVPDWATSKEHAGWEFDAYSRQAW
Ga0209634_116856923300025138MarineMNHIYAQYFHPETLLERVRDVRFYRYPRTLFKGFRVPDWATADKRSGW
Ga0208254_101071423300025355FreshwaterMYFQKFHKEPYFMFHIYAQYFHPETLLERVRDTSFHRRPRTIFKGYTVPDWATAEKRHGW
Ga0208259_103410923300025375FreshwaterMRIEDVYANKFHKEPYVMMHLYAQYFHPTTLLERVRDVRFYRNPRTMFKGFKVPDWATAKEKHGWEFDAYSRQA
Ga0207959_104696713300025387FreshwaterVNKFHKEPYVMHHIYGQYFHPSTLLERVKDVQFYRRPRTLFKGFKVPDWATAEKTSGWDFDAYSRQ
Ga0208426_104385813300025451AqueousMMHLYAQHFHPHTLLERVRDVRFYRAPRTIFKGFRVP
Ga0207954_105296213300025606FreshwaterHKEPYFMFHIYAQYFHPETLLERVRDTSFHRRPRTIFKGYTVPDWATAEKRHGW
Ga0209716_116099023300025626Pelagic MarineHIYAQNFHPDSLLERVRDVNFYRRTRTLYKGFKVPEWATA
Ga0209306_113118723300025680Pelagic MarineKEPYFMNHVYAQYFHPETLLERVRDVHFYRKTRTLYKGFKVPEWAQADKMNGW
Ga0209715_104436923300025699Pelagic MarineMNHVYAQYFHPETLLERVRDVHFYRKTRTLYKGFKVPEWAQADKMNGW
Ga0209715_112051613300025699Pelagic MarineFHKEPYIMMHIYAQNFHPDTMLERVRDVSFYRRPRTLFKGFKVPDWATSEVRNGW
Ga0208544_1007323133300025887AqueousMMHMYAQYFHPSTLLERVREVRAYRMPRVMFKGFRAPDWATAKE
Ga0208544_1026554023300025887AqueousVQKFHKEPYIMNHVYAQYFHPSTLLERVRDVSFYKRPRVLFKGFRVPDWATASKMNGWECDAYSREAW
Ga0208916_1004542033300025896AqueousLIYYLGLRVEDVYCNKFHKEPYIMYHMYAQYFHPSTLLERVRDVRFYRQPRTIFKGFKVPDWATSKEHAGWEFDAYSRQAW
Ga0208916_1007341233300025896AqueousMRVEDVYANKFHKEPYIMMHLYAQYFHPSTLLERVRDVRFYRNPRTMFKGFRVPDWATAKEQHGWEFDAYSR
Ga0208275_101529933300026182MarineMNHVYAQYFHPHTLLERVRDVSFIRRPRTLFKGFKVPEWATAEKEQGW
Ga0247578_110741213300026458SeawaterREIGIRIEDFYMHKFHKEPYFMNHLYAQYFHPETLLERVRDVRFYRYPRTLFKGFRVPDWAGPEKRGGW
Ga0208921_104144123300027188EstuarineMHKFHKEPYIMNHVYAQYFHPETLLERVRDVSFYRRPRTIFKGFKVPDWATA
Ga0208673_107311913300027192EstuarineMHKFHKEPYIMNHVYAQYFHPETLLERVRDVSFYRRPRTIFKGFKVPDWATAGKMNGWEV
Ga0209617_1004428323300027720Freshwater And SedimentMFHIYAQYFHPETVLERVRDTSLHRRPRTIFKGFTVPDWATAEKRHGWAVDAYSR
Ga0209279_1002858923300027771MarineMHKFHKEPYIMHHIFAQYFHPESLLERVRDVSFYRRPRTLFKGFRVPDWATSEKRNGW
Ga0209229_1024688923300027805Freshwater And SedimentMNKFHKEPYIQHHIFAQYFHPDSLLERVREVRFYRQPRTLFKGFRVPDWATAEKNHGWE
Ga0209302_1009283333300027810MarineLKLIVGIRIEDFYLLKFHKEPYFMNHIYAQYFHPETMLERVRDVRFYRYPRTLFKGFKVPDWATADKRSGW
Ga0209230_1011980533300027836Freshwater And SedimentMFHMYAQYFHPSTVLERVRDVRFYRQPRTIFKGFKVPDWATSKEHAGWEFDAYSRQAW
Ga0209299_122737213300027974Freshwater LakeMRVEDVYCNKFHKEPYIMMHLYAQYFHPSTLLERVRDVRFYRNPRTMFKGFKVPDWATAKEQ
Ga0256412_105297623300028137SeawaterMWHTFAQYFHPESLMERVRDVQFYRKTRTLYKGFKVPEWA
Ga0228613_106467323300028279SeawaterMQKFHKEPYFMNHIYAQYFHPSTLLERVRDVRFIRNPRTLFKGFRVP
Ga0256413_113343013300028282SeawaterGIRIEDFYMHKFHKEPYIMHHIYAQYFHPETLLDRVRDVSFYRRPRTLFKGFKVPDWATSEKRNGW
Ga0247572_107016113300028290SeawaterREIGIRIEDFYMHKFHKEPYFMNHVYAQYFHPETMLERVRDVRFYRYPRTLFKGFKVPDWATSEKRGGW
Ga0247595_105577623300028333SeawaterHLYAQYFHPETLLERVRDVRFYRYPRTLFKGFRVPDWAGPEKRGGW
Ga0247595_106649013300028333SeawaterKEPYFMNHVYAQYFHPETMLERVRDVRFYRYPRTLFKGFKVPDWATSEKRGGW
Ga0311358_1077349513300029915BogMNKFHKEPYIQFHIYAQNFHPDTLLERVRDVHFYRRPRTLFKGFRVPDWATSTQQHGWELDSYSR
Ga0311326_1055351613300029917BogEDFYCNKFHKEPYIQHHIYAQYFHPDTLLERVRDVAFYRRPRTLFKGFKVPDWATAEKRHGWELDAYSR
Ga0307403_1009342533300030671MarineMNHIWAQHFHPENLLERVRDTSFYRRPRTLYKGFRVPDWATAEKRNGW
Ga0307399_1023004123300030702MarineMNHVYAQYFHPENLLERVRDVSFYRRPRTLFKGFKVPDWATAENMNGW
Ga0308133_102254213300030721MarineKEPYFMNHIYAQYFHPETLLERVRDVRFYRYPRTLFKGFKVPDWATSDKRNGW
Ga0308138_104065723300030724MarineFMFHIYAQNFHPDSLLERIRDVNFYRRTRTLYKGFKVPEWATA
Ga0170824_12181505513300031231Forest SoilHVEKAREAGLRVEDMYCNKFYKEPYIQFHIYAQYFHPETLLERCRNIHFYRRPRTLFKGFKVPDWATS
Ga0302320_1091347623300031524BogHKEPYIQHHIYAQYFHPDTLLERVRDVAFYRRPRTLFKGFKVPDWATAEKRHGWELDAYS
Ga0308132_112010113300031580MarineHIWAQHFHPENLLERVRDTSFYRRPRTLYKGFRVPDWATAEKRNGW
Ga0302114_1006222913300031621MarineMHKFHKEPYIMNHVFAQNFHPETILERVRDVCFYRRPRTLFKGFKVPDWATAEQRNGW
Ga0302121_1006262313300031626MarineDFYHNKFHKEPYFMNHVYAQYFHPETLLERVRDVHFYRKTRTLYKGFKVPEWAQADKMNG
Ga0307386_1009922923300031710MarineMMHLYAQHFHPSTLLERVRDVRMYRQPRTLFKGFTVPDWATAEQKHGWEYDQYSRNAWDNAMH
Ga0307396_1012623913300031717MarineKEPYIMHHIYAQYFHPDTLLERVRDVRFYRQPRTIFKGFKVPEWATSN
Ga0315899_1026320523300031784FreshwaterMMHVYAQYFHPTTMLERVRDVRFYRNPRTMFKGFRVPDWATSKEHAGWEFDAYSRQAW
Ga0315899_1084938413300031784FreshwaterMNKFHKEPYIQHHIFAQYFHPDSLLERVREVRFYRQPRTLFKGFRVPDWATAEKNHGWELDTYSRQAWDN
Ga0315906_1120526313300032050FreshwaterMNHVYAQYFHPETLLERVRDVRFYRLPRTIFKGFTVPDWARSKEK
Ga0314668_1016588933300032481SeawaterGIRIEDFYMHKFHKEPYIMNHVFAQNFHPETILERVRDVCFYRRPRTLFKGFKVPDWATAEQRNGW
Ga0314689_1015024313300032518SeawaterKSREIGIRIEDFYMHKFHKEPYIMNHVFAQNFHPETILERVRDVCFYRRPRTLFKGFKVPDWATAEQRNGW
Ga0314689_1026589723300032518SeawaterFYMHKFHKEPYFMHHLYAQYFHPETLLERVRDVRFYRFPRTLFKGFRVPDWATADKRSGW
Ga0314676_1023572713300032519SeawaterGIRIEDFYMHKFHKEPYIMHHIYAQYFHPESLLERVRDVSFYRRPRTLFKGFRVPDWATSEKRNGW
Ga0314667_1038418513300032520SeawaterHVYAQYFHPSSLQERVRDVAFYRKPRTLFKGFKVPDWATSEKRNGW
Ga0314682_1054133113300032540SeawaterHKEPYFMNHVYAQYFHPETLLERVRDVHFYRKTRTLYKGFKVPEWAQADKMNGW
Ga0314678_1011274223300032666SeawaterIRVEDFYMNKFHKEPYFMNHVYAQYFHPSSLQERVRDVAFYRKPRTLFKGFKVPDWATSEKRNGW
Ga0314692_1018550913300032754SeawaterYFMFHIYAQNFHPDSLLERVRDVNFYRRTRTLYKGFKVPEWATA
Ga0314709_1070274213300032755SeawaterKSREIGIRVEDFYMNKFHKEPYFMNHVYAQYFHPSSLQERVRDVAFYRKPRTLFKGFKVPDWATSEKRNGW
Ga0334989_0077896_1106_13243300033984FreshwaterMRVEDVYCNKFHKEPYIMMHLYAQYFHPTTLLERVRDVRFYRNPRTMFKGFKVPDWATAKEKHGWEFDAYSR
Ga0334989_0113543_335_5623300033984FreshwaterLRVEDVYCNKFHKEPYIMFHMYAQYFHPSTLLERVRDVRFYRQPRTIFKGFKVPDWATSKEHAGWEFDAYSRQAW
Ga0334989_0377628_2_1873300033984FreshwaterMRVEDVYNNKFHKEPYVMMHLYAQYFHPTTLLERVRDVRFYRQPRTMFKGFKVPEWATAKEA
Ga0334998_0511494_521_6673300034019FreshwaterMMHVYAQYFHPTTMLERVRDVRFYRNPRTMFKGFRVPDWATSKEHAGWE
Ga0335001_0451087_2_1543300034064FreshwaterMRVEDLYENKFHKEPYIMHHIYAQYFHPDTLLERVRNVRFYRQPRTIFKGF
Ga0310127_201368_3_2273300034072Fracking WaterMRVEDVYENKFHKEPYIMFHLYAQYFHPETLLERVRDVRFYRQPRTLFKGFTVPDWATAQKQHGWDTDAYSRKAW
Ga0335068_0120991_335_5623300034116FreshwaterLRVEDIYCNKFHKEPYIMFHMYAQYFHPSTLLERVRDVRFYRQPRTIFKGFKVPDWATSKEHAGWEFDAYSRQAW
Ga0335056_0675729_368_5263300034120FreshwaterMFHIYAQYFHPETLLERVRDTSFHRRPRTIFKGFTVPDWATAEKRHGWQVDAY
Ga0334997_0583639_507_6893300034280FreshwaterMNHVYQQYFHPETLLERVRDVRFYRLPRTIFKGFTVPDWARSKEKHGWEIDVYSRQAWEN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.