Metagenome / Metatranscriptome Family F044694

Basic Information
Family ID	F044694
Family Type	Metagenome / Metatranscriptome
Number of Sequences	154
Average Sequence Length	39 residues
Representative Sequence	MKKLKEILDQIATGIKNKLGLDGSFAGNYQMAVIRLKHK
Number of Associated Samples	121
Number of Associated Scaffolds	154

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	25.32 %
% of genes near scaffold ends (potentially truncated)	21.43 %
% of genes from short scaffolds (< 2000 bps)	88.31 %
Associated GOLD sequencing projects	110
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.37

Most Common Taxonomy
Group	Unclassified (55.195 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (7.792 % of family members)
Environment Ontology (ENVO)	Unclassified (46.753 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (55.844 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 25.37% β-sheet: 11.94% Coil/Unstructured: 62.69%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 154 Family Scaffolds
PF14771	DUF4476	33.77
PF02629	CoA_binding	2.60
PF00549	Ligase_CoA	1.95
PF10670	DUF4198	1.30
PF01835	MG2	1.30
PF07494	Reg_prop	0.65

COG ID	Name	Functional Category	% Frequency in 154 Family Scaffolds
COG0045	Succinyl-CoA synthetase, beta subunit	Energy production and conversion [C]	1.95
COG0074	Succinyl-CoA synthetase, alpha subunit	Energy production and conversion [C]	1.95
COG2373	Uncharacterized conserved protein YfaS, alpha-2-macroglobulin family	General function prediction only [R]	1.30
COG3292	Periplasmic ligand-binding sensor domain	Signal transduction mechanisms [T]	0.65

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
All Organisms	root	All Organisms	44.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
cellular organisms	root	All Organisms → cellular organisms	44.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	44.16 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	43.51 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	43.51 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.65 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	43.51 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.65 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
unclassified Bacteroidetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes	20.13 %
Chitinophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia	9.09 %
Sphingobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia	0.65 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.65 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	20.13 %
Chitinophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales	9.09 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	20.13 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	9.09 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.65 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	20.13 %
Terrimonas	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas	2.60 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	0.65 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	20.13 %
Terrimonas ferruginea	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	2.60 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	0.65 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	20.13 %
Terrimonas ferruginea	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	2.60 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	0.65 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	20.13 %
Terrimonas ferruginea	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	2.60 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	0.65 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	20.13 %
Terrimonas ferruginea	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	2.60 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	0.65 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	20.13 %
Terrimonas ferruginea	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	2.60 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	0.65 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	20.13 %
Terrimonas ferruginea	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	2.60 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	0.65 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	20.13 %
Terrimonas ferruginea	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	2.60 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	0.65 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	20.13 %
Terrimonas ferruginea	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	2.60 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	0.65 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	20.13 %
Terrimonas ferruginea	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	2.60 %
Endopterygota	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	0.65 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	20.13 %
Terrimonas ferruginea	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	2.60 %
Coleoptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera	0.65 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	20.13 %
Terrimonas ferruginea	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	2.60 %
Polyphaga	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga	0.65 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	20.13 %
Terrimonas ferruginea	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	2.60 %
Elateriformia	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Elateriformia	0.65 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	20.13 %
Terrimonas ferruginea	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	2.60 %
Elateroidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Elateriformia → Elateroidea	0.65 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	20.13 %
Terrimonas ferruginea	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	2.60 %
Lampyridae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Elateriformia → Elateroidea → Lampyridae	0.65 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	20.13 %
Terrimonas ferruginea	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	2.60 %
Luciolinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Elateriformia → Elateroidea → Lampyridae → Luciolinae	0.65 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	20.13 %
Terrimonas ferruginea	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	2.60 %
Abscondita	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Elateriformia → Elateroidea → Lampyridae → Luciolinae → Abscondita	0.65 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.19 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	20.13 %
Terrimonas ferruginea	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	2.60 %
Abscondita terminalis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Elateriformia → Elateroidea → Lampyridae → Luciolinae → Abscondita → Abscondita terminalis	0.65 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.65 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.65 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090001\|CNB_F6ESG4R02FX251	Not Available	587	Open in IMG/M
2228664022\|INPgaii200_c0774119	Not Available	1012	Open in IMG/M
3300000043\|ARcpr5yngRDRAFT_c020855	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	555	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_101567909	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	999	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_101568509	Not Available	562	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_101569797	Not Available	568	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_101570403	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	524	Open in IMG/M
3300000559\|F14TC_100204679	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	3262	Open in IMG/M
3300000559\|F14TC_102171009	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1393	Open in IMG/M
3300000579\|AP72_2010_repI_A01DRAFT_1001327	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	5082	Open in IMG/M
3300000955\|JGI1027J12803_101345457	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Elateriformia → Elateroidea → Lampyridae → Luciolinae → Abscondita → Abscondita terminalis	1104	Open in IMG/M
3300002099\|JGI24808J26613_1014263	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	1405	Open in IMG/M
3300002100\|JGI24809J26612_1019236	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	1213	Open in IMG/M
3300002100\|JGI24809J26612_1066402	Not Available	537	Open in IMG/M
3300003453\|ERB_1005152	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	10000	Open in IMG/M
3300004114\|Ga0062593_100018100	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	3617	Open in IMG/M
3300004114\|Ga0062593_100908375	Not Available	891	Open in IMG/M
3300004463\|Ga0063356_100107811	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	3046	Open in IMG/M
3300004479\|Ga0062595_101177491	Not Available	678	Open in IMG/M
3300004479\|Ga0062595_101465302	Not Available	627	Open in IMG/M
3300004643\|Ga0062591_101852415	Not Available	617	Open in IMG/M
3300005175\|Ga0066673_10861517	Not Available	516	Open in IMG/M
3300005184\|Ga0066671_10933080	Not Available	549	Open in IMG/M
3300005290\|Ga0065712_10277400	Not Available	903	Open in IMG/M
3300005294\|Ga0065705_10043556	Not Available	843	Open in IMG/M
3300005328\|Ga0070676_10445965	Not Available	909	Open in IMG/M
3300005329\|Ga0070683_100714888	Not Available	959	Open in IMG/M
3300005331\|Ga0070670_101191589	Not Available	696	Open in IMG/M
3300005332\|Ga0066388_104920042	Not Available	679	Open in IMG/M
3300005335\|Ga0070666_10417676	Not Available	966	Open in IMG/M
3300005338\|Ga0068868_100416369	Not Available	1162	Open in IMG/M
3300005341\|Ga0070691_10621488	Not Available	640	Open in IMG/M
3300005353\|Ga0070669_101159391	Not Available	667	Open in IMG/M
3300005355\|Ga0070671_100087940	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	2600	Open in IMG/M
3300005355\|Ga0070671_101994538	Not Available	516	Open in IMG/M
3300005366\|Ga0070659_100393569	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	1169	Open in IMG/M
3300005535\|Ga0070684_100868408	Not Available	845	Open in IMG/M
3300005549\|Ga0070704_102257201	Not Available	506	Open in IMG/M
3300005564\|Ga0070664_100072870	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2946	Open in IMG/M
3300005569\|Ga0066705_10108160	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1662	Open in IMG/M
3300005574\|Ga0066694_10622065	Not Available	503	Open in IMG/M
3300005578\|Ga0068854_100861022	Not Available	794	Open in IMG/M
3300005598\|Ga0066706_10388353	Not Available	1110	Open in IMG/M
3300005616\|Ga0068852_100925173	Not Available	889	Open in IMG/M
3300005718\|Ga0068866_10452878	Not Available	839	Open in IMG/M
3300005841\|Ga0068863_100982441	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea	847	Open in IMG/M
3300005985\|Ga0081539_10062719	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2030	Open in IMG/M
3300006046\|Ga0066652_100407911	Not Available	1240	Open in IMG/M
3300006173\|Ga0070716_100144983	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1520	Open in IMG/M
3300006237\|Ga0097621_100672943	Not Available	951	Open in IMG/M
3300006854\|Ga0075425_102527192	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	568	Open in IMG/M
3300006954\|Ga0079219_10864260	Not Available	724	Open in IMG/M
3300010046\|Ga0126384_12399862	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	510	Open in IMG/M
3300010048\|Ga0126373_10031055	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	4619	Open in IMG/M
3300010092\|Ga0127468_1033614	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	764	Open in IMG/M
3300010096\|Ga0127473_1103310	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	670	Open in IMG/M
3300010098\|Ga0127463_1063138	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1059	Open in IMG/M
3300010335\|Ga0134063_10244089	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	853	Open in IMG/M
3300010360\|Ga0126372_11817092	Not Available	653	Open in IMG/M
3300010362\|Ga0126377_10690856	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1072	Open in IMG/M
3300010366\|Ga0126379_10507823	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1278	Open in IMG/M
3300010376\|Ga0126381_100670691	Not Available	1481	Open in IMG/M
3300010400\|Ga0134122_10085387	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2477	Open in IMG/M
3300010403\|Ga0134123_10930184	Not Available	878	Open in IMG/M
3300012201\|Ga0137365_10008062	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	8407	Open in IMG/M
3300012201\|Ga0137365_10249630	Not Available	1320	Open in IMG/M
3300012212\|Ga0150985_109986672	Not Available	932	Open in IMG/M
3300012212\|Ga0150985_119896202	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1116	Open in IMG/M
3300012212\|Ga0150985_120708880	Not Available	819	Open in IMG/M
3300012212\|Ga0150985_122629051	Not Available	946	Open in IMG/M
3300012224\|Ga0134028_1181875	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	648	Open in IMG/M
3300012224\|Ga0134028_1289480	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1021	Open in IMG/M
3300012285\|Ga0137370_10756689	Not Available	603	Open in IMG/M
3300012350\|Ga0137372_10185649	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1675	Open in IMG/M
3300012356\|Ga0137371_10414631	Not Available	1044	Open in IMG/M
3300012378\|Ga0134025_1109662	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	790	Open in IMG/M
3300012386\|Ga0134046_1053320	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	896	Open in IMG/M
3300012388\|Ga0134031_1157039	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1166	Open in IMG/M
3300012392\|Ga0134043_1258295	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1030	Open in IMG/M
3300012397\|Ga0134056_1230416	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	823	Open in IMG/M
3300012405\|Ga0134041_1015960	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	987	Open in IMG/M
3300012469\|Ga0150984_101572205	Not Available	840	Open in IMG/M
3300012469\|Ga0150984_102600118	Not Available	811	Open in IMG/M
3300012495\|Ga0157323_1030037	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	571	Open in IMG/M
3300012511\|Ga0157332_1080235	Not Available	524	Open in IMG/M
3300012899\|Ga0157299_10154587	Not Available	652	Open in IMG/M
3300012923\|Ga0137359_10040536	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	4031	Open in IMG/M
3300012923\|Ga0137359_10185373	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1859	Open in IMG/M
3300012951\|Ga0164300_10350024	Not Available	793	Open in IMG/M
3300012957\|Ga0164303_10806679	Not Available	646	Open in IMG/M
3300012957\|Ga0164303_10833706	Not Available	638	Open in IMG/M
3300012960\|Ga0164301_10407545	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	954	Open in IMG/M
3300012986\|Ga0164304_11481407	Not Available	561	Open in IMG/M
3300013100\|Ga0157373_11410026	Not Available	530	Open in IMG/M
3300013296\|Ga0157374_10198037	Not Available	1966	Open in IMG/M
3300014969\|Ga0157376_10072714	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	2926	Open in IMG/M
3300014969\|Ga0157376_10206958	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	1809	Open in IMG/M
3300014969\|Ga0157376_11121595	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	813	Open in IMG/M
3300015085\|Ga0167632_1031085	Not Available	707	Open in IMG/M
3300015371\|Ga0132258_11007377	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	2105	Open in IMG/M
3300015371\|Ga0132258_11617655	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1635	Open in IMG/M
3300015371\|Ga0132258_11651775	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1617	Open in IMG/M
3300015371\|Ga0132258_12680423	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1244	Open in IMG/M
3300015372\|Ga0132256_101886048	Not Available	705	Open in IMG/M
3300015373\|Ga0132257_100090328	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	3508	Open in IMG/M
3300015373\|Ga0132257_104165274	Not Available	526	Open in IMG/M
3300015374\|Ga0132255_105432799	Not Available	539	Open in IMG/M
3300017792\|Ga0163161_11320830	Not Available	627	Open in IMG/M
3300017792\|Ga0163161_11735208	Not Available	554	Open in IMG/M
3300017947\|Ga0187785_10088701	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1220	Open in IMG/M
3300017947\|Ga0187785_10384403	Not Available	670	Open in IMG/M
3300017994\|Ga0187822_10262287	Not Available	597	Open in IMG/M
3300018482\|Ga0066669_10605141	Not Available	961	Open in IMG/M
3300021445\|Ga0182009_10068552	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1551	Open in IMG/M
3300021445\|Ga0182009_10084053	Not Available	1423	Open in IMG/M
3300021445\|Ga0182009_10198092	Not Available	976	Open in IMG/M
3300021478\|Ga0210402_10584079	Not Available	1036	Open in IMG/M
3300024055\|Ga0247794_10141969	Not Available	745	Open in IMG/M
3300025315\|Ga0207697_10247635	Not Available	788	Open in IMG/M
3300025315\|Ga0207697_10284339	Not Available	733	Open in IMG/M
3300025321\|Ga0207656_10220650	Not Available	921	Open in IMG/M
3300025899\|Ga0207642_10039708	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2048	Open in IMG/M
3300025899\|Ga0207642_10279331	Not Available	960	Open in IMG/M
3300025900\|Ga0207710_10360569	Not Available	741	Open in IMG/M
3300025907\|Ga0207645_10118791	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1715	Open in IMG/M
3300025911\|Ga0207654_10457026	Not Available	896	Open in IMG/M
3300025913\|Ga0207695_10344219	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1378	Open in IMG/M
3300025919\|Ga0207657_10567158	Not Available	887	Open in IMG/M
3300025919\|Ga0207657_10744850	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	759	Open in IMG/M
3300025920\|Ga0207649_10067634	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	2269	Open in IMG/M
3300025920\|Ga0207649_10069108	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2248	Open in IMG/M
3300025923\|Ga0207681_10380642	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	1136	Open in IMG/M
3300025931\|Ga0207644_10296819	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1301	Open in IMG/M
3300025931\|Ga0207644_10829693	Not Available	774	Open in IMG/M
3300025931\|Ga0207644_11429972	Not Available	581	Open in IMG/M
3300025932\|Ga0207690_10944762	Not Available	716	Open in IMG/M
3300025934\|Ga0207686_11776234	Not Available	510	Open in IMG/M
3300025937\|Ga0207669_10901362	Not Available	739	Open in IMG/M
3300025941\|Ga0207711_10236976	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1672	Open in IMG/M
3300025944\|Ga0207661_10542373	Not Available	1065	Open in IMG/M
3300025945\|Ga0207679_11576507	Not Available	602	Open in IMG/M
3300025960\|Ga0207651_10291726	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1353	Open in IMG/M
3300026041\|Ga0207639_11244992	Not Available	698	Open in IMG/M
3300026095\|Ga0207676_12284867	Not Available	538	Open in IMG/M
3300026323\|Ga0209472_1257611	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	557	Open in IMG/M
3300027775\|Ga0209177_10421405	Not Available	540	Open in IMG/M
3300028380\|Ga0268265_12685654	Not Available	503	Open in IMG/M
3300031716\|Ga0310813_11877231	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	564	Open in IMG/M
3300032180\|Ga0307471_102637462	Not Available	637	Open in IMG/M
3300032955\|Ga0335076_10495770	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1105	Open in IMG/M
3300033004\|Ga0335084_10654504	Not Available	1073	Open in IMG/M
3300033412\|Ga0310810_10572084	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1096	Open in IMG/M
3300033412\|Ga0310810_10608895	Not Available	1046	Open in IMG/M
3300033475\|Ga0310811_10282851	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1929	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	55.84%
Host-Associated	Host-Associated	44.16%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	55.19%
Plants	Host-Associated → Plants	44.16%
Aquatic	Environmental → Aquatic	0.65%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	54.55%
Rhizosphere	Host-Associated → Plants → Rhizosphere	22.73%
Rhizoplane	Host-Associated → Plants → Rhizoplane	20.78%
Freshwater	Environmental → Aquatic → Freshwater	0.65%
Volcanic	Environmental → Terrestrial → Volcanic	0.65%
Roots	Host-Associated → Plants → Roots	0.65%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	45.45%
Soil	Host-Associated → Plants → Rhizosphere → Soil	15.58%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	11.69%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	9.09%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	7.14%
Loam	Environmental → Terrestrial → Soil → Loam	6.49%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.60%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.65%
Fumaroles	Environmental → Terrestrial → Volcanic → Fumaroles	0.65%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.65%

Habitat	Taxonomy	Distribution
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	7.79%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	7.79%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	7.14%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	6.49%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	5.19%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	5.19%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	4.55%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.90%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.90%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	3.25%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	2.60%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.60%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.60%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.60%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.95%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.95%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.95%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.95%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.95%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.30%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.30%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.30%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.30%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	1.30%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.30%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.30%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.30%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	1.30%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.65%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.65%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.65%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.65%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.65%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.65%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.65%
Volcano-Associated Fumarole	Environmental → Terrestrial → Volcanic → Fumaroles → Unclassified → Volcano-Associated Fumarole	0.65%
Quercus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere	0.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.65%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.65%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.65%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.65%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.65%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.65%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.65%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090001	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB	Host-Associated	Open in IMG/M
2228664022	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000043	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere	Host-Associated	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300000579	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300002099	Soil microbial communities from Manhattan, Kansas, USA - Sample 400um MDA	Environmental	Open in IMG/M
3300002100	Soil microbial communities from Manhattan, Kansas, USA - Sample 500um MDA	Environmental	Open in IMG/M
3300003453	Combined Assembly of Gp0111477, Gp0111476	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005184	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120	Environmental	Open in IMG/M
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005574	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143	Environmental	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010092	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010096	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010098	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012224	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012378	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012386	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012388	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012392	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012397	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012405	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012495	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610	Host-Associated	Open in IMG/M
3300012511	Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10	Environmental	Open in IMG/M
3300012899	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015085	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300017994	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300024055	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026323	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)	Environmental	Open in IMG/M
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032955	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033475	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.37
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.37
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F044694

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
CNB_02116040	2088090001	Quercus Rhizosphere	MKRLKEILDQIATGIKNKLSLPGSFAGNYQMAVIRLKQII
INPgaii200_07741192	2228664022	Soil	MKKLKEILDQIATGIKNKLGLNGSFAGNYQVAVISLKHK
ARcpr5yngRDRAFT_0208552	3300000043	Arabidopsis Rhizosphere	MTMEKLKQIFEKLSTGFKNKLGLDGIFSGNYQMAVIYLKK*
INPhiseqgaiiFebDRAFT_1015679092	3300000364	Soil	MKKLKEILDQIATGIKHKXGLDGSFAGSYQMAVIYLKK*
INPhiseqgaiiFebDRAFT_1015685092	3300000364	Soil	MXKLKXILDQIATGIKXKLGLDGSFAGNYQMAVITLKCK*
INPhiseqgaiiFebDRAFT_1015697972	3300000364	Soil	MKKLKEILDQIATGIKNKLGLNGSFAGNYQVAVISLKHK*
INPhiseqgaiiFebDRAFT_1015704032	3300000364	Soil	MKKIKDILNQIATGIKNKLGLHGSFAGNYQMAVISLKK*
F14TC_1002046792	3300000559	Soil	MEKLKQIFEKLSTGFKNKLGLDGIFSGNYQMAVIYLKK*
F14TC_1021710092	3300000559	Soil	MKKLKEILDQIATGIKNKLGLDGSFAGNYQMAVIRLKHK*
AP72_2010_repI_A01DRAFT_10013274	3300000579	Forest Soil	MKNLKEILDQLTTGIKHKLGLYGYLAGNYQMAVILKDK*
JGI1027J12803_1013454573	3300000955	Soil	LKEILDQIATGIKNKLGLNGSFAGNYQVAVISLKHK*
JGI24808J26613_10142632	3300002099	Soil	MNKLKEILDQIATGIKNKLGLDGSFAGNYQMALITLKCK*
JGI24809J26612_10192361	3300002100	Soil	MEKIKEILNQIATGIKNKLGLNGSFAGNYQMAVIILKNK*
JGI24809J26612_10664023	3300002100	Soil	MNKLKEILDQIATGIKNKLGLNGSFAGNYQMALITLKCK*
ERB_10051527	3300003453	Volcano-Associated Fumarole	MKKLKKIVNNITTGIRNKLRQYGSSAGNYQMAPLYLKRK*
Ga0062593_1000181005	3300004114	Soil	MKKLKEILDRIATGIKNKLGLDGAFAGNYQMAVITLKCK*
Ga0062593_1009083751	3300004114	Soil	MMKLKEILDRIATGIKNKLGLDGSFTGNYQMAVILLKHN*
Ga0063356_1001078112	3300004463	Arabidopsis Thaliana Rhizosphere	MKKLKEILDQLATGIKNKLGLDGSFAGNYQMAVILLKHK*
Ga0062595_1011774912	3300004479	Soil	MKKLKEMLDQIATGIKNKLGLNGSFAGNYQMAVIRLKHK*
Ga0062595_1014653022	3300004479	Soil	MKKLKEILDQIATGIKNKLGLDGSSTGNYQMAVIRLKHK*
Ga0062591_1018524152	3300004643	Soil	MKKLKKILDQIATGIKHKLGLDGSFAGNYQMAVILLKHK*
Ga0066673_108615172	3300005175	Soil	MKKLKEILNQITTGIKNKLGLDGSFAGNYQMAVIILKHKI*
Ga0066671_109330801	3300005184	Soil	MKKIKEIFEKIANGISNNPGLPGISSGNYQMAVIILKLK*
Ga0065712_102774002	3300005290	Miscanthus Rhizosphere	MKKLKDILDQIATGIKNKLGLDGTFAGNYQMAVILLKHK*
Ga0065705_100435562	3300005294	Switchgrass Rhizosphere	MKKLKEILDQIATGIKNKLGLDGSFAGNYQMALITLKCK*
Ga0070676_104459651	3300005328	Miscanthus Rhizosphere	MKKLKEILDQIATGIKNKLGLDGSFAGNYQVAVIILKHK*
Ga0070683_1007148881	3300005329	Corn Rhizosphere	MKKLKKILDQIATGIKHKLGLDGSFAGNYQMAVILLEHK*
Ga0070670_1011915892	3300005331	Switchgrass Rhizosphere	MKKLKEILDQIATGIKNKLGLDGSFAGNYQVAIIILKHK*
Ga0066388_1049200422	3300005332	Tropical Forest Soil	MKRLKEILDQIATGIKNKLGLNGSFAGNYQMAVITLKCN*
Ga0070666_104176761	3300005335	Switchgrass Rhizosphere	MKKLKEILDRIATGIKNKLGLDGSFAGNYQMAVIRLKQK*
Ga0068868_1004163691	3300005338	Miscanthus Rhizosphere	MKKLKMILDQIATGIKNKLGLDGSFAGNYQMAVITLKCK*
Ga0070691_106214882	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	MKKLKEILDQIATGIKNKLGLNGSSTGNYQMAVIRLKHK*
Ga0070669_1011593912	3300005353	Switchgrass Rhizosphere	MKKLKEILDQIATGIKNKLGLDGSFAGNYQMAVILLKRK*
Ga0070671_1000879402	3300005355	Switchgrass Rhizosphere	MNKLKMILDQIATGIKNKLGLDGSFAGNYQMAVITLKCK*
Ga0070671_1019945382	3300005355	Switchgrass Rhizosphere	MKKLKDILDQIATGIRNKLGLDGTFAGNYQMAVILLKHK*
Ga0070659_1003935692	3300005366	Corn Rhizosphere	MKKLKEILDQIATGIKNKLGPDGSSTGNYQMAVIRLKHK*
Ga0070684_1008684081	3300005535	Corn Rhizosphere	MKKLKDILDQIATGIKNKLGLDGTFAGNYQMAVVLLKHK*
Ga0070704_1022572012	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	MKKLKEILDRLATGIKNKLGLDGSFAGNYQMAVITLKCK*
Ga0070664_1000728702	3300005564	Corn Rhizosphere	MKKLKEILDQIATGIKNKLGLDGSFAGNYQMAIILLKRK*
Ga0066705_101081602	3300005569	Soil	VKKIREILNQIATGIKNKLGLDGSFAGNYHMAVIYLKK*
Ga0066694_106220652	3300005574	Soil	MKKLKEILNQIATGIKNKLGLNGSFAGNYQMAVSYLKK*
Ga0068854_1008610221	3300005578	Corn Rhizosphere	MKLKEILDRIATGIKNKLGLDGSFTGNYQMAVILLKHN*
Ga0066706_103883531	3300005598	Soil	MKKIEEILNQITTGIKNKLGLDGSFAGNYQMAVIILKHKI*
Ga0068852_1009251731	3300005616	Corn Rhizosphere	MKKLKDILDQIATGIKNKLGLDGSFAGNYQMAIILLKRK*
Ga0068866_104528781	3300005718	Miscanthus Rhizosphere	TMKKLKEILDQIATGIKNKLGLDGSFAGNYQVAVIILKHK*
Ga0068863_1009824412	3300005841	Switchgrass Rhizosphere	MKKLKQILDQIATGIKNKLGPDGSFAGNYQMALIKLKHK*
Ga0081539_100627192	3300005985	Tabebuia Heterophylla Rhizosphere	MKNLKQILEQIFTGLKNKLGLHGIFSGNYQMAVIYLKK*
Ga0066652_1004079111	3300006046	Soil	MKKLKEILNQIATGIKNKLGLHGSFAGNYQMAVIYLKK*
Ga0070716_1001449832	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MKKIKEILNQIATGIKNKLGLDGSFAGNYQMAVIYLNK*
Ga0097621_1006729432	3300006237	Miscanthus Rhizosphere	MKKLKEILNQIATGIKNKLGLDGSFAGNYQMAVILLKHK*
Ga0075425_1025271922	3300006854	Populus Rhizosphere	MKKLKEILNQIATGIKNKLGLNGSFAGNYQMAVIYLKK*
Ga0079219_108642602	3300006954	Agricultural Soil	MKRLKEILDQIATGVKNKLGLDGSFAGNYQMAVITLKCK*
Ga0126384_123998622	3300010046	Tropical Forest Soil	MKRLKEILDQIATGIKHKLGLDGSFAGSYQMAVIYLKK*
Ga0126373_100310553	3300010048	Tropical Forest Soil	MKRLKEILDQIATGIKYKLGLTGSFAGTYQMAVTCLKQ*
Ga0127468_10336142	3300010092	Grasslands Soil	AVMKKLKEILNQIATGIKNKLGLHGSFAGNYQMAVIYLKK*
Ga0127473_11033101	3300010096	Grasslands Soil	KEILNQIATGIKNKLGLDGSFAGNYQMAVIYLKK*
Ga0127463_10631381	3300010098	Grasslands Soil	VVKELIEILNQIATGIKNKLGLHGSFAGNYQMAVIYLKK*
Ga0134063_102440892	3300010335	Grasslands Soil	MKKLKEILNQIATGIKNKLGLNVSFAGNYQMAVSYLKK*
Ga0126372_118170923	3300010360	Tropical Forest Soil	MKKLKDILDQIATGPDSYRDKNKLGLDGSFAGNYQMAVIH*
Ga0126377_106908562	3300010362	Tropical Forest Soil	MKKLKEILDQIATGIKYKLGLDGSFAGSYQMAVIYLKK*
Ga0126379_105078232	3300010366	Tropical Forest Soil	MKKIKDILNQIATGIKNKLGLHGSFAGNYQMAVIYLKK*
Ga0126381_1006706912	3300010376	Tropical Forest Soil	MKRLKEILDQIATGVKNKLGLTGSFAGTYQMAVIYLKQ*
Ga0134122_100853872	3300010400	Terrestrial Soil	MKKLKEILDQIATGVKNKLGLDGSFAGTYQMAVITLKCK*
Ga0134123_109301841	3300010403	Terrestrial Soil	EILDQIATGVKNKLGLDGSFAGNYQMAVIRLKQK*
Ga0137365_100080628	3300012201	Vadose Zone Soil	MKKLKQILEQISTGVKNKLGLPGIFSGNYQMAVIYLKK*
Ga0137365_102496303	3300012201	Vadose Zone Soil	MKKLKEILNQIATGIKNKLGLDGSFAGNYQMAVIILKHKI*
Ga0150985_1099866721	3300012212	Avena Fatua Rhizosphere	KKLKKILDEIATGIINKLGLDGSFAGNYQMAVITIKHK*
Ga0150985_1198962023	3300012212	Avena Fatua Rhizosphere	KKLKEMLDRIATGIKNKIGLNGSFAGNYQVAVITLKYK*
Ga0150985_1207088801	3300012212	Avena Fatua Rhizosphere	LKEILDQIATGIKNKLSLPGSFAGNYQMAVIILKQK*
Ga0150985_1226290512	3300012212	Avena Fatua Rhizosphere	KKLKEILDQIATGVKNKLGLDGSFAGSYPMAVITIKHK*
Ga0134028_11818751	3300012224	Grasslands Soil	GGCMKKIREILNQIATGIKNKLGLDGSFAGNYQMAIIYLKK*
Ga0134028_12894801	3300012224	Grasslands Soil	KKLKEILNQIATGIKNKLGLNGSFAGNYQMAVSYLKK*
Ga0137370_107566891	3300012285	Vadose Zone Soil	MKKLKQILEQISTGVKNKLGLSGLFSGNYQMAVIHLKK*
Ga0137372_101856492	3300012350	Vadose Zone Soil	MKKLKQILEQISTGVKNKLGLPGIFSGNYQMAIIYLKK*
Ga0137371_104146312	3300012356	Vadose Zone Soil	MRKLKEILNQIATGIKNKLGLDGSFAGNYQMAVIILKHKI*
Ga0134025_11096621	3300012378	Grasslands Soil	KKLKEILNQIATGIKNKLGLHGSFAGNYQMAVIYLKK*
Ga0134046_10533201	3300012386	Grasslands Soil	KKLKEILNQIATGIKNKLGLNGSFAGNYQMAVIYLKK*
Ga0134031_11570391	3300012388	Grasslands Soil	KKLKEILNQIATGIKNKLGLDGSFAGNYQMAVINLKK*
Ga0134043_12582952	3300012392	Grasslands Soil	VMKKLKEILNQIATGIKNKLGLHGSFAGNYQMAVIYLKK*
Ga0134056_12304162	3300012397	Grasslands Soil	KKLKEILNQIATGIKNKLGLDGSFAGNYQMAVIYFKK*
Ga0134041_10159601	3300012405	Grasslands Soil	KKLKEILNQIATGIKHKLGLDGSFAGNYQMAVIYLKK*
Ga0150984_1015722052	3300012469	Avena Fatua Rhizosphere	KKLKEILDQIATGVKNKLGLDGSFAGSYQMAVITIKHK*
Ga0150984_1026001181	3300012469	Avena Fatua Rhizosphere	KEILDQIATGIKNKLSLHGSFAGNYQMAVILKHK*
Ga0157323_10300372	3300012495	Arabidopsis Rhizosphere	MKKLKEMLDQIATGIKNKLGLNGSFAGNYQMAVIYLKK*
Ga0157332_10802352	3300012511	Soil	MTMEKLKQILEKLSTGFENKLGLDGIFSGNYQMAVIYLKK*
Ga0157299_101545871	3300012899	Soil	MKKLKEILDRIATGIKNKLGLDGSFAGNYQMAVIRLIHK*
Ga0137359_100405361	3300012923	Vadose Zone Soil	MKKLKQILERISTGVINKPGLHGIFSGNYQMAVIY
Ga0137359_101853731	3300012923	Vadose Zone Soil	QKGESMKKLKQILERISTGVINKPGLHGIFSGNYQMAVIYFKK*
Ga0164300_103500241	3300012951	Soil	MNKLKEILDQIATGIKNKLGLDGSFAGNYQMAVIRLKHK*
Ga0164303_108066793	3300012957	Soil	MKKLKEILDRIATGIKNKLGLDGSFAGNYQMAVITLNCK*
Ga0164303_108337061	3300012957	Soil	MKKLKEILDQIATGIKNKLGLNGSFPGNYHMAAILLKYK*
Ga0164301_104075452	3300012960	Soil	MNKLKEILNQIATGIKNKLGPDGSFAGNYQMAVIRLKHK*
Ga0164304_114814071	3300012986	Soil	MKKLKEILDQIATGIKNKLGPDGSFAGNYQMAVIRLKHK*
Ga0157373_114100261	3300013100	Corn Rhizosphere	MKKLKEILDQIATGIKNKLGLDDSSTGNYQMAVIRLKHK*
Ga0157374_101980371	3300013296	Miscanthus Rhizosphere	KLKEILDQIATGIKNKLGLDGSFAGNYQMAVIRLKQK*
Ga0157376_100727144	3300014969	Miscanthus Rhizosphere	MKKLKQILDQIATGIKNKLGLDGSFAGNYQMALIKLKHK*
Ga0157376_102069583	3300014969	Miscanthus Rhizosphere	MKKLKEILDQIATGIKNKLGLNGSFAGNYQMAVIRLKHK*
Ga0157376_111215952	3300014969	Miscanthus Rhizosphere	MKKLKQILDQIATGIKNKLGLNGSFAGNYQMAVLKLKHK*
Ga0167632_10310851	3300015085	Glacier Forefield Soil	MKKLKEILNQITTGIKNKLGPDGSFAGNYQMAVIILKIKI*
Ga0132258_110073773	3300015371	Arabidopsis Rhizosphere	MKNLKQILERISTGVKNKLGLHGIFSGNYQMAVIYLKK*
Ga0132258_116176552	3300015371	Arabidopsis Rhizosphere	MKKLKEILDQIATGVKNKLGLDGSFAGNYQMAIISLKRK*
Ga0132258_116517753	3300015371	Arabidopsis Rhizosphere	MKKLKEILDQIVTGIKNKLGLDGSFAGNYQMAVSRLKHK*
Ga0132258_126804232	3300015371	Arabidopsis Rhizosphere	MKKLKEILEKLSTGVKNKLGLDGIFSGTYQMAVIYLKK*
Ga0132256_1018860482	3300015372	Arabidopsis Rhizosphere	MKKLKEILDRIATGIKNKLGLDGSFAGNYQMAVSRLKHK*
Ga0132257_1000903282	3300015373	Arabidopsis Rhizosphere	MEKLKQILEKLSTGFENKLGLDGIFSGNYQMAVIYLKK*
Ga0132257_1041652742	3300015373	Arabidopsis Rhizosphere	MNKLKEILDQIVTGIKNKLGLDGSFAGTYQMAVITLKCK*
Ga0132255_1054327992	3300015374	Arabidopsis Rhizosphere	MKKLKEILEKLSTGVKNKLGLDGIFSGTYQMAVIYL
Ga0163161_113208301	3300017792	Switchgrass Rhizosphere	MKKLKEILDQIATGIKNKLGLDGSSTGNYQMAVIRLKHK
Ga0163161_117352082	3300017792	Switchgrass Rhizosphere	MKKLKMILDQIATGIKNKLGLDGSFAGNYQMAVITLKCK
Ga0187785_100887013	3300017947	Tropical Peatland	MKKLKEILDQLTTGIKHKLGLYGYLAGNYQMAVILKDK
Ga0187785_103844032	3300017947	Tropical Peatland	MMKRLKKILDQIATGPDSYRDKNKPGLIGSFAGNYQMAVITLKCK
Ga0187822_102622872	3300017994	Freshwater Sediment	MKRIKEILEKIATGIKNKFGLFGYSAGNYQMAVIILK
Ga0066669_106051412	3300018482	Grasslands Soil	MKKLKEILNQITTGIKNKLGLDGSFAGNYQMAVIILKHKI
Ga0182009_100685522	3300021445	Soil	MKRLKEILDQIATGPDSYRDKNKLGLDGAFAGNHQMAVINLKCK
Ga0182009_100840532	3300021445	Soil	MKKLKEILDRIATGIKNKLGLNGSFPGNYQMAIITLKYK
Ga0182009_101980922	3300021445	Soil	MKKLKEMLDQIATGIKNKLGLNGSFAGNYQMAVIRLKHK
Ga0210402_105840791	3300021478	Soil	MKKVIETLKQISTGIKNKFGLRGYSAGNYHVAVIIIKYK
Ga0247794_101419692	3300024055	Soil	MKLKEILDRIATGIKNKLGLDGSFTGNYQMAVILLKHN
Ga0207697_102476352	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MKKLKEILDRIATGIKNKLGLDGSFAGNYQMAVIRLKQK
Ga0207697_102843392	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	KLKTMKKLKEILDQIATGIKNKLGLDGSSTGNYQMAVIRLKHK
Ga0207656_102206502	3300025321	Corn Rhizosphere	MKKLKDILDQIATGIRNKLGLDGTFAGNYQMAVIRLKQK
Ga0207642_100397082	3300025899	Miscanthus Rhizosphere	MKKLKEILDQIATGIKNKLGLDGSFAGNYQVAVIILKHK
Ga0207642_102793311	3300025899	Miscanthus Rhizosphere	MNKLKMILDQIATGIKNKLGLDGSFAGNYQMAVITLKCK
Ga0207710_103605692	3300025900	Switchgrass Rhizosphere	MKKLKDILDQIATGIKNKLGLDGTFAGNYQMAVILLKHK
Ga0207645_101187912	3300025907	Miscanthus Rhizosphere	MKKLKEILDRIATGIKNKLGLDGSFAGNYQMAVIRLKQ
Ga0207654_104570261	3300025911	Corn Rhizosphere	MKKLKEILDQIATGIKNKLGLNGSFAGNYQMAVIRLNHK
Ga0207695_103442192	3300025913	Corn Rhizosphere	MKKLKEILDQIATGIKNKLGLDGSFAGNYQVAIIILKHK
Ga0207657_105671582	3300025919	Corn Rhizosphere	MKKLKEILDQIATGIKNKLGLDGSFAGNYQMAVIRLKHK
Ga0207657_107448501	3300025919	Corn Rhizosphere	MKKLKEILDQIATGIKNKLGLDGSFAGNYQMAIILLKRK
Ga0207649_100676343	3300025920	Corn Rhizosphere	MKKLKKILDQIATGIKHKLGLDGSFAGNYQMAVILLKHK
Ga0207649_100691081	3300025920	Corn Rhizosphere	MMKLKEILDRIATGIKNKLGLDGSFTGNYQMAVILLKHN
Ga0207681_103806423	3300025923	Switchgrass Rhizosphere	TMKKLKEILDRIATGIKNKLGLDGSFAGNYQMAVIRLKQK
Ga0207644_102968191	3300025931	Switchgrass Rhizosphere	MKKLKQILDQIATGIKNKLGLNGSFAGNYQMAVLELKHK
Ga0207644_108296932	3300025931	Switchgrass Rhizosphere	MNKLKMILDQIATGIKNKLGLDGSFAGNYQMAVIRLKHK
Ga0207644_114299722	3300025931	Switchgrass Rhizosphere	MKKLKDILDQIATGIRNKLGLDGTFAGNYQMAVILLKHK
Ga0207690_109447621	3300025932	Corn Rhizosphere	MKKLKEILDQIATGIKNKLGPDGSSTGNYQMAVIRLKHK
Ga0207686_117762341	3300025934	Miscanthus Rhizosphere	MKRLKEILDQIATGIKNKLGLNGSFAGNYQVAVIILKH
Ga0207669_109013622	3300025937	Miscanthus Rhizosphere	MKKLKEILDQIATGIKNKLGLDGSFAGNYQMAVIRLKQK
Ga0207711_102369764	3300025941	Switchgrass Rhizosphere	MKKLKDILDQIATGIKNKLGLDGSFAGNYQMAVITLKCK
Ga0207661_105423731	3300025944	Corn Rhizosphere	MKKLKKILDQIATGIKHKLGLDGSFAGNYQMAVILLEHK
Ga0207679_115765071	3300025945	Corn Rhizosphere	MKKLKQILDQIATGIKNKLGLNGSFAGNYQMAVLKLKHK
Ga0207651_102917262	3300025960	Switchgrass Rhizosphere	MKKLKEMLDQIATGIKNKLGLNGSFAGNYKMAVIRLKHK
Ga0207639_112449922	3300026041	Corn Rhizosphere	MKKLKEILDRIATGIKNKLGLDGSFAGIYQMAVIRLKQK
Ga0207676_122848672	3300026095	Switchgrass Rhizosphere	FEGKSITMKKLKEILDQIATGIKNKLGLDGSFAGNYQVAIIILKHK
Ga0209472_12576111	3300026323	Soil	MKKLKEILNQIATGIKNKLGLNGSFAGNYQMAVSYLKK
Ga0209177_104214051	3300027775	Agricultural Soil	AKQLVMKRLKEILDQIATGVKNKLDLDGSFAGNYQMAVITLKCK
Ga0268265_126856541	3300028380	Switchgrass Rhizosphere	MKKLKEILDQIATGIKNKLGLDGSFAGNYQMAVILLKRK
Ga0310813_118772311	3300031716	Soil	QKGKPMKNLKQILERISTGVKNKLGLHGIFSGNYQMAVIYLKK
Ga0307471_1026374621	3300032180	Hardwood Forest Soil	MNKLKEILNQIATGIKNKLGPDGSFAGNYQMAVIRLKHK
Ga0335076_104957701	3300032955	Soil	AMKKLKEILDQLTTGIKNKLGLYGYLAGNYQMAVILKDK
Ga0335084_106545042	3300033004	Soil	MKKLKKILDQLATGIKHKFGLYGYLAGNHQMAAILKDK
Ga0310810_105720842	3300033412	Soil	MKNLKQILERISTGVKNKLGLHGIFSGNYQMAVIYLKK
Ga0310810_106088952	3300033412	Soil	MKKLKEILDRIATGIKNKLGLDGAFAGNYQMAVITLKCK
Ga0310811_102828513	3300033475	Soil	MKKLKEILDRIATGIKNKLGLDGAFAGNYQMAIITIKCK

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign