Metagenome Family F044686

Basic Information
Family ID	F044686
Family Type	Metagenome
Number of Sequences	154
Average Sequence Length	46 residues
Representative Sequence	YEGLASREKPGITERTVRARAGAGGAYFKFTVGDGTVNIRRAAQ
Number of Associated Samples	122
Number of Associated Scaffolds	154

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	96.75 %
% of genes from short scaffolds (< 2000 bps)	90.26 %
Associated GOLD sequencing projects	109
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.28

Most Common Taxonomy
Group	Unclassified (57.143 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (9.091 % of family members)
Environment Ontology (ENVO)	Unclassified (53.896 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (68.182 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 16.67% Coil/Unstructured: 83.33%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 154 Family Scaffolds
PF00692	dUTPase	46.10
PF04389	Peptidase_M28	1.30
PF13414	TPR_11	0.65
PF14337	Abi_alpha	0.65
PF12611	Flagellar_put	0.65
PF00132	Hexapep	0.65
PF12728	HTH_17	0.65
PF06559	DCD	0.65

COG ID	Name	Functional Category	% Frequency in 154 Family Scaffolds
COG0717	dCTP deaminase	Nucleotide transport and metabolism [F]	46.75
COG0756	dUTP pyrophosphatase (dUTPase)	Defense mechanisms [V]	46.10

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
All Organisms	root	All Organisms	42.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
cellular organisms	root	All Organisms → cellular organisms	42.21 %
Viruses	superkingdom	All Organisms → Viruses	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	37.01 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	5.19 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	14.94 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	11.04 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	5.19 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.65 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	5.19 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	1.95 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.95 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.65 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.65 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	5.19 %
Blastocatellales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales	1.95 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	1.95 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	0.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.65 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	5.19 %
Pyrinomonadaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae	1.95 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	1.95 %
Chloroflexi bacterium RBG_19FT_COMBO_55_16	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_55_16	0.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.65 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	5.19 %
unclassified Pyrinomonadaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae	1.95 %
Xanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas	1.95 %
Chloroflexi bacterium RBG_19FT_COMBO_55_16	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_55_16	0.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.65 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	5.19 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.95 %
Xanthomonas fragariae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas fragariae	1.95 %
Chloroflexi bacterium RBG_19FT_COMBO_55_16	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_55_16	0.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.65 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	5.19 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.95 %
Xanthomonas fragariae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas fragariae	1.95 %
Chloroflexi bacterium RBG_19FT_COMBO_55_16	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_55_16	0.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.65 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	5.19 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.95 %
Xanthomonas fragariae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas fragariae	1.95 %
Chloroflexi bacterium RBG_19FT_COMBO_55_16	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_55_16	0.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.65 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	5.19 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.95 %
Xanthomonas fragariae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas fragariae	1.95 %
Chloroflexi bacterium RBG_19FT_COMBO_55_16	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_55_16	0.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.65 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	5.19 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.95 %
Xanthomonas fragariae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas fragariae	1.95 %
Chloroflexi bacterium RBG_19FT_COMBO_55_16	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_55_16	0.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.65 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	5.19 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.95 %
Xanthomonas fragariae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas fragariae	1.95 %
Chloroflexi bacterium RBG_19FT_COMBO_55_16	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_55_16	0.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.65 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	5.19 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.95 %
Xanthomonas fragariae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas fragariae	1.95 %
Chloroflexi bacterium RBG_19FT_COMBO_55_16	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_55_16	0.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.65 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	5.19 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.95 %
Xanthomonas fragariae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas fragariae	1.95 %
Chloroflexi bacterium RBG_19FT_COMBO_55_16	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_55_16	0.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.65 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
campanulids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids	5.19 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.95 %
Xanthomonas fragariae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas fragariae	1.95 %
Chloroflexi bacterium RBG_19FT_COMBO_55_16	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_55_16	0.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.65 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
Asterales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales	5.19 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.95 %
Xanthomonas fragariae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas fragariae	1.95 %
Chloroflexi bacterium RBG_19FT_COMBO_55_16	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_55_16	0.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.65 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
Asteraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae	5.19 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.95 %
Xanthomonas fragariae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas fragariae	1.95 %
Chloroflexi bacterium RBG_19FT_COMBO_55_16	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_55_16	0.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.65 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
Asteroideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae	5.19 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.95 %
Xanthomonas fragariae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas fragariae	1.95 %
Chloroflexi bacterium RBG_19FT_COMBO_55_16	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_55_16	0.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.65 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
Anthemideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae	5.19 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.95 %
Xanthomonas fragariae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas fragariae	1.95 %
Chloroflexi bacterium RBG_19FT_COMBO_55_16	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_55_16	0.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.65 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
Anthemidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae	5.19 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.95 %
Xanthomonas fragariae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas fragariae	1.95 %
Chloroflexi bacterium RBG_19FT_COMBO_55_16	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_55_16	0.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.65 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
Tanacetum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum	5.19 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.95 %
Xanthomonas fragariae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas fragariae	1.95 %
Chloroflexi bacterium RBG_19FT_COMBO_55_16	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_55_16	0.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.65 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.14 %
Tanacetum cinerariifolium	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	5.19 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.95 %
Xanthomonas fragariae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas fragariae	1.95 %
Chloroflexi bacterium RBG_19FT_COMBO_55_16	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_55_16	0.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.65 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.65 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2199352025\|deepsgr__Contig_70564	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	627	Open in IMG/M
3300000956\|JGI10216J12902_120335400	Not Available	566	Open in IMG/M
3300004114\|Ga0062593_101290596	Not Available	773	Open in IMG/M
3300004114\|Ga0062593_103280931	Not Available	519	Open in IMG/M
3300004157\|Ga0062590_100812170	Not Available	862	Open in IMG/M
3300005093\|Ga0062594_101113357	Not Available	773	Open in IMG/M
3300005093\|Ga0062594_101556641	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	682	Open in IMG/M
3300005293\|Ga0065715_10888040	Not Available	579	Open in IMG/M
3300005295\|Ga0065707_10703566	Not Available	638	Open in IMG/M
3300005331\|Ga0070670_101789162	Not Available	566	Open in IMG/M
3300005331\|Ga0070670_101944724	Not Available	542	Open in IMG/M
3300005334\|Ga0068869_100047680	All Organisms → cellular organisms → Bacteria → Proteobacteria	3095	Open in IMG/M
3300005335\|Ga0070666_10375070	All Organisms → cellular organisms → Bacteria	1021	Open in IMG/M
3300005336\|Ga0070680_101434650	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	598	Open in IMG/M
3300005340\|Ga0070689_102183803	Not Available	507	Open in IMG/M
3300005341\|Ga0070691_10595744	Not Available	652	Open in IMG/M
3300005345\|Ga0070692_10760077	Not Available	658	Open in IMG/M
3300005345\|Ga0070692_11034478	Not Available	576	Open in IMG/M
3300005364\|Ga0070673_101263968	Not Available	693	Open in IMG/M
3300005441\|Ga0070700_100063300	All Organisms → cellular organisms → Bacteria → Proteobacteria	2339	Open in IMG/M
3300005441\|Ga0070700_100293786	All Organisms → cellular organisms → Bacteria → Proteobacteria	1183	Open in IMG/M
3300005444\|Ga0070694_101767883	Not Available	526	Open in IMG/M
3300005457\|Ga0070662_101186398	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	656	Open in IMG/M
3300005459\|Ga0068867_101007111	All Organisms → cellular organisms → Bacteria → Acidobacteria	756	Open in IMG/M
3300005539\|Ga0068853_100955782	Not Available	824	Open in IMG/M
3300005543\|Ga0070672_101798664	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	551	Open in IMG/M
3300005545\|Ga0070695_100991933	Not Available	683	Open in IMG/M
3300005545\|Ga0070695_101143314	Not Available	639	Open in IMG/M
3300005547\|Ga0070693_101393332	Not Available	545	Open in IMG/M
3300005548\|Ga0070665_101708621	Not Available	637	Open in IMG/M
3300005564\|Ga0070664_101794775	Not Available	582	Open in IMG/M
3300005577\|Ga0068857_100345691	All Organisms → cellular organisms → Bacteria → Proteobacteria	1377	Open in IMG/M
3300005577\|Ga0068857_100831991	All Organisms → cellular organisms → Bacteria → Acidobacteria	883	Open in IMG/M
3300005578\|Ga0068854_102187045	Not Available	512	Open in IMG/M
3300005615\|Ga0070702_100037545	All Organisms → cellular organisms → Bacteria → Proteobacteria	2691	Open in IMG/M
3300005616\|Ga0068852_102639211	All Organisms → cellular organisms → Bacteria → Acidobacteria	522	Open in IMG/M
3300005617\|Ga0068859_100084596	All Organisms → cellular organisms → Bacteria → Proteobacteria	3217	Open in IMG/M
3300005618\|Ga0068864_100189268	All Organisms → cellular organisms → Bacteria → Proteobacteria	1886	Open in IMG/M
3300005618\|Ga0068864_101303364	Not Available	727	Open in IMG/M
3300005719\|Ga0068861_101433143	Not Available	676	Open in IMG/M
3300005840\|Ga0068870_10062483	All Organisms → cellular organisms → Bacteria	2006	Open in IMG/M
3300005840\|Ga0068870_10421714	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas fragariae	873	Open in IMG/M
3300005842\|Ga0068858_100199306	All Organisms → cellular organisms → Bacteria → Acidobacteria	1892	Open in IMG/M
3300005842\|Ga0068858_100314529	All Organisms → cellular organisms → Bacteria	1496	Open in IMG/M
3300005844\|Ga0068862_100617398	All Organisms → cellular organisms → Bacteria → Proteobacteria	1043	Open in IMG/M
3300005844\|Ga0068862_102089456	Not Available	577	Open in IMG/M
3300006031\|Ga0066651_10101265	All Organisms → cellular organisms → Bacteria	1451	Open in IMG/M
3300006237\|Ga0097621_100553910	All Organisms → cellular organisms → Bacteria → Proteobacteria	1047	Open in IMG/M
3300006804\|Ga0079221_10371768	All Organisms → cellular organisms → Bacteria	873	Open in IMG/M
3300006846\|Ga0075430_101671126	Not Available	523	Open in IMG/M
3300006847\|Ga0075431_100997835	All Organisms → cellular organisms → Bacteria	804	Open in IMG/M
3300006852\|Ga0075433_10069159	All Organisms → cellular organisms → Bacteria → Acidobacteria	3100	Open in IMG/M
3300006852\|Ga0075433_10281026	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas fragariae	1475	Open in IMG/M
3300006881\|Ga0068865_101828653	Not Available	549	Open in IMG/M
3300006918\|Ga0079216_11414442	Not Available	576	Open in IMG/M
3300006931\|Ga0097620_101144183	All Organisms → cellular organisms → Bacteria	857	Open in IMG/M
3300006931\|Ga0097620_102104389	Not Available	623	Open in IMG/M
3300007004\|Ga0079218_11047634	All Organisms → cellular organisms → Bacteria → Acidobacteria	824	Open in IMG/M
3300007076\|Ga0075435_100303929	All Organisms → cellular organisms → Bacteria → Proteobacteria	1365	Open in IMG/M
3300009094\|Ga0111539_11680506	Not Available	736	Open in IMG/M
3300009094\|Ga0111539_11743159	Not Available	722	Open in IMG/M
3300009100\|Ga0075418_10414077	All Organisms → cellular organisms → Bacteria	1442	Open in IMG/M
3300009147\|Ga0114129_12515659	Not Available	615	Open in IMG/M
3300009148\|Ga0105243_13070498	Not Available	506	Open in IMG/M
3300009162\|Ga0075423_10930756	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas fragariae	922	Open in IMG/M
3300009162\|Ga0075423_12816558	Not Available	533	Open in IMG/M
3300009174\|Ga0105241_10085202	All Organisms → cellular organisms → Bacteria → Acidobacteria	2483	Open in IMG/M
3300009174\|Ga0105241_12515573	Not Available	516	Open in IMG/M
3300009177\|Ga0105248_12409963	Not Available	599	Open in IMG/M
3300009551\|Ga0105238_12285877	Not Available	576	Open in IMG/M
3300009551\|Ga0105238_12682437	Not Available	535	Open in IMG/M
3300009553\|Ga0105249_10385329	All Organisms → cellular organisms → Bacteria → Proteobacteria	1429	Open in IMG/M
3300010038\|Ga0126315_10561390	All Organisms → cellular organisms → Bacteria → Acidobacteria	734	Open in IMG/M
3300010038\|Ga0126315_11201492	Not Available	515	Open in IMG/M
3300010041\|Ga0126312_10488809	All Organisms → cellular organisms → Bacteria → Acidobacteria	880	Open in IMG/M
3300010041\|Ga0126312_11294311	Not Available	539	Open in IMG/M
3300010359\|Ga0126376_11814309	Not Available	648	Open in IMG/M
3300010362\|Ga0126377_10072878	Not Available	3060	Open in IMG/M
3300010362\|Ga0126377_12874364	Not Available	555	Open in IMG/M
3300010375\|Ga0105239_13439915	Not Available	515	Open in IMG/M
3300010397\|Ga0134124_10490148	All Organisms → Viruses → Predicted Viral	1187	Open in IMG/M
3300010399\|Ga0134127_10102643	All Organisms → cellular organisms → Bacteria → Acidobacteria	2509	Open in IMG/M
3300010399\|Ga0134127_10450577	Not Available	1286	Open in IMG/M
3300010399\|Ga0134127_13537903	Not Available	512	Open in IMG/M
3300010400\|Ga0134122_12851421	Not Available	537	Open in IMG/M
3300010401\|Ga0134121_10357547	All Organisms → cellular organisms → Bacteria → Proteobacteria	1308	Open in IMG/M
3300011119\|Ga0105246_11560236	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	622	Open in IMG/M
3300012212\|Ga0150985_114693773	Not Available	539	Open in IMG/M
3300012361\|Ga0137360_11316529	Not Available	624	Open in IMG/M
3300012929\|Ga0137404_11779930	Not Available	573	Open in IMG/M
3300012955\|Ga0164298_11278928	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	560	Open in IMG/M
3300013297\|Ga0157378_10554138	All Organisms → cellular organisms → Bacteria → Proteobacteria	1155	Open in IMG/M
3300013297\|Ga0157378_10634311	All Organisms → cellular organisms → Bacteria	1083	Open in IMG/M
3300013306\|Ga0163162_10735057	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1107	Open in IMG/M
3300013308\|Ga0157375_10114514	All Organisms → cellular organisms → Bacteria	2798	Open in IMG/M
3300013308\|Ga0157375_11912330	Not Available	704	Open in IMG/M
3300013760\|Ga0120188_1042455	Not Available	562	Open in IMG/M
3300014326\|Ga0157380_10435295	All Organisms → cellular organisms → Bacteria → Proteobacteria	1255	Open in IMG/M
3300014326\|Ga0157380_12410564	Not Available	591	Open in IMG/M
3300014968\|Ga0157379_10296366	All Organisms → cellular organisms → Bacteria	1473	Open in IMG/M
3300014968\|Ga0157379_11066595	Not Available	773	Open in IMG/M
3300014968\|Ga0157379_11354352	Not Available	689	Open in IMG/M
3300015371\|Ga0132258_12840045	All Organisms → cellular organisms → Bacteria → Proteobacteria	1205	Open in IMG/M
3300015372\|Ga0132256_101158767	Not Available	887	Open in IMG/M
3300018466\|Ga0190268_12288122	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	509	Open in IMG/M
3300024287\|Ga0247690_1008722	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1169	Open in IMG/M
3300025321\|Ga0207656_10677654	Not Available	528	Open in IMG/M
3300025903\|Ga0207680_10732457	Not Available	709	Open in IMG/M
3300025908\|Ga0207643_10088947	All Organisms → cellular organisms → Bacteria → Proteobacteria	1798	Open in IMG/M
3300025908\|Ga0207643_10941527	Not Available	559	Open in IMG/M
3300025918\|Ga0207662_11279365	Not Available	521	Open in IMG/M
3300025919\|Ga0207657_10861190	All Organisms → cellular organisms → Bacteria	699	Open in IMG/M
3300025920\|Ga0207649_10678895	Not Available	798	Open in IMG/M
3300025923\|Ga0207681_10572079	All Organisms → cellular organisms → Bacteria → Acidobacteria	931	Open in IMG/M
3300025930\|Ga0207701_11251122	Not Available	610	Open in IMG/M
3300025940\|Ga0207691_11711275	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300025942\|Ga0207689_10189256	All Organisms → cellular organisms → Bacteria	1698	Open in IMG/M
3300025945\|Ga0207679_10445324	All Organisms → cellular organisms → Bacteria	1148	Open in IMG/M
3300025945\|Ga0207679_11357200	Not Available	652	Open in IMG/M
3300025960\|Ga0207651_10940509	Not Available	771	Open in IMG/M
3300025981\|Ga0207640_11532142	Not Available	599	Open in IMG/M
3300026023\|Ga0207677_10718146	All Organisms → cellular organisms → Bacteria → Acidobacteria	888	Open in IMG/M
3300026067\|Ga0207678_10987534	Not Available	745	Open in IMG/M
3300026095\|Ga0207676_10811121	Not Available	913	Open in IMG/M
3300026118\|Ga0207675_102173309	Not Available	570	Open in IMG/M
3300026142\|Ga0207698_11596211	Not Available	668	Open in IMG/M
3300027637\|Ga0209818_1230868	Not Available	551	Open in IMG/M
3300027880\|Ga0209481_10257246	All Organisms → cellular organisms → Bacteria → Acidobacteria	880	Open in IMG/M
3300027880\|Ga0209481_10362393	Not Available	740	Open in IMG/M
3300027886\|Ga0209486_10670788	Not Available	665	Open in IMG/M
3300027909\|Ga0209382_10671550	All Organisms → cellular organisms → Bacteria → Proteobacteria	1119	Open in IMG/M
3300028047\|Ga0209526_10288785	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_19FT_COMBO_55_16	1113	Open in IMG/M
3300028380\|Ga0268265_11301849	Not Available	727	Open in IMG/M
3300031547\|Ga0310887_10354743	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	852	Open in IMG/M
3300031548\|Ga0307408_100306597	All Organisms → cellular organisms → Bacteria → Proteobacteria	1332	Open in IMG/M
3300031548\|Ga0307408_101692759	Not Available	602	Open in IMG/M
3300031548\|Ga0307408_101799541	Not Available	585	Open in IMG/M
3300031731\|Ga0307405_10929411	Not Available	738	Open in IMG/M
3300031854\|Ga0310904_10965482	Not Available	605	Open in IMG/M
3300031901\|Ga0307406_11003279	Not Available	716	Open in IMG/M
3300031943\|Ga0310885_10356923	Not Available	769	Open in IMG/M
3300031944\|Ga0310884_10269754	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	937	Open in IMG/M
3300031995\|Ga0307409_100860931	Not Available	918	Open in IMG/M
3300032004\|Ga0307414_10397112	All Organisms → cellular organisms → Bacteria → Proteobacteria	1197	Open in IMG/M
3300032074\|Ga0308173_11733395	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	588	Open in IMG/M
3300032157\|Ga0315912_11194743	Not Available	602	Open in IMG/M
3300033412\|Ga0310810_10455460	All Organisms → cellular organisms → Bacteria → Proteobacteria	1294	Open in IMG/M
3300034820\|Ga0373959_0187502	Not Available	541	Open in IMG/M
3300034965\|Ga0370497_0122304	Not Available	635	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	60.39%
Environmental	Environmental	39.61%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	60.39%
Terrestrial	Environmental → Terrestrial	38.96%
Aquatic	Environmental → Aquatic	0.65%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	38.96%
Rhizosphere	Host-Associated → Plants → Rhizosphere	37.66%
Rhizoplane	Host-Associated → Plants → Rhizoplane	22.08%
Sediment	Environmental → Aquatic → Sediment	0.65%
Roots	Host-Associated → Plants → Roots	0.65%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	27.27%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	25.32%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	20.13%
Soil	Host-Associated → Plants → Rhizosphere → Soil	12.34%
Loam	Environmental → Terrestrial → Soil → Loam	11.04%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.95%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.65%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.65%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.65%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	25.32%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	20.13%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	14.94%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	12.34%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	9.09%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	6.49%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.25%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.95%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.95%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.65%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.65%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.65%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.65%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.65%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.65%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.65%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	9.09%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	8.44%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	7.14%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	5.84%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	5.19%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	5.19%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	4.55%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	4.55%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.90%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	3.25%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	3.25%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.25%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	3.25%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	3.25%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.60%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	2.60%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.60%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.95%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.95%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.30%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.30%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.30%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.30%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.30%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.65%
Terrestrial	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial	0.65%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.65%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.65%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.65%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.65%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.65%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.65%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.65%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.65%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.65%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.65%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.65%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.65%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2199352025	Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental	Open in IMG/M
3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300013760	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300018076	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300024287	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31	Environmental	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025327	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)	Environmental	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027637	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)	Environmental	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental	Open in IMG/M
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated	Open in IMG/M
3300031943	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Host-Associated	Open in IMG/M
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental	Open in IMG/M
3300032157	Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Host-Associated	Open in IMG/M
3300034965	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.28
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.28
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F044686

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
deepsgr_00956070	2199352025	Soil	DYEGLETREKPGITERTIRARAGSGGAFFKFTVGDGLIGIKKMSQ
JGI10216J12902_1203354001	3300000956	Soil	SGKIVNTYEGLGTREKPGITERTIRGRAGAGGAYFRFTVGDGVINIR*
F14TB_1000643412	3300001431	Soil	LRTGKIEDTYGALASRQKPGLTPTVMRARAGVGGAFFKFTVGDGTLLLKKTAN*
Ga0062593_1012905961	3300004114	Soil	GIVAREKPGLQPQTMRARAGSGGAFFKFTVGDGTVNIRRSDQSK*
Ga0062593_1032809311	3300004114	Soil	ASREKPGITERTVRGRAGAGGAYFKFTVGDGMVNIRRAAQ*
Ga0062590_1008121702	3300004157	Soil	TGKIVNTHEGIVAREKPGLQPQTMRARAGSGGAFFKFTVGDGTVNIRRSDQSK*
Ga0062594_1011133572	3300005093	Soil	EVLRTGKIVNTFEGLASREKPGITEKTVRARAGAGGAYFKFTVGDGTVNIRRAEQ*
Ga0062594_1015566412	3300005093	Soil	RNGKIVNTYDGLASREKPGITERTVRARAGAGGPYFKFTVGDGIVNIRKGGT*
Ga0065715_108880402	3300005293	Miscanthus Rhizosphere	LRTGQIVNTHEGIVAREKPGLQPQTMRARAGSGGAFFKFTVGDGTVNIRRSDQSK*
Ga0065707_107035661	3300005295	Switchgrass Rhizosphere	NTYEGLASREKPGITERSVRARAGAGGAYFKFTVGDGTVNIRRAAQ*
Ga0070670_1017891622	3300005331	Switchgrass Rhizosphere	VLRTGTIVNTYEGLAAREKPGITERTVRARAGAGGAYFKFTVGDGTVNIRRAVQ*
Ga0070670_1019447241	3300005331	Switchgrass Rhizosphere	GKIVNTYEGLASREKPGITERTVRARAGAGGAFFRFTVGDGTVNIRKAVQ*
Ga0068869_1000476801	3300005334	Miscanthus Rhizosphere	HEGIVAREKPGLQPQTMRARAGSGGAFFKFTVGDGTVNIRRSDQSK*
Ga0070666_103750701	3300005335	Switchgrass Rhizosphere	MGKIAYDYEGLETREKPGITERTIRARAGSGGAFFKFTVGDGLIGIKKMSQ*
Ga0070680_1014346502	3300005336	Corn Rhizosphere	ASREKPGITEKTVRARAGAGGAYFKFTVGDGTVNIRRAEQ*
Ga0070689_1021838032	3300005340	Switchgrass Rhizosphere	LETREKPGITERTVRARAGSGGAYFKFTVGDGVINIKKNGS*
Ga0070691_105957441	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	HDGLAAREKPGITEHTVRARAGSGGAYFKFTVGDGTVNIRKAGP*
Ga0070692_107600772	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	LTSREKPGLTERTVRARAGSGGAYFKFTVGDGTVNIRRAAQ*
Ga0070692_110344782	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	VGQIVNSYEGLEVREKPGITERSVRARAGAGGPFFKFTIGDGILTIKKSPS*
Ga0070673_1012639681	3300005364	Switchgrass Rhizosphere	SREKPGLTERTVRARAGSGGAYFKFTVGDGTVNIRRAAQ*
Ga0070700_1000633001	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	IVNTFEGLASREKPGITEKTVRARAGAGGAYFKFTVGDGTVNIRRAAQ*
Ga0070700_1002937863	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	GKIVNTYEGLAPREKPGITERTVRARAGYGGAFFTFTVGDGMVNIRRAGS*
Ga0070694_1017678831	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	RTGKIVNTYEGLGAREKPGITERTVRARAGAGGAFFKFTVGDGTVNIKRSGEQ*
Ga0070662_1011863982	3300005457	Corn Rhizosphere	EKREKPGVTERVVRARAGAGGAFFKFTVGDGTLNFVKSTG*
Ga0068867_1010071111	3300005459	Miscanthus Rhizosphere	STYEGLASREKPGITERTVRARAGAGGAFFRFTVGDGTVNIRKATQ*
Ga0068853_1009557821	3300005539	Corn Rhizosphere	SDILRSGKIVNTYEGLGTREKPGITERTIRGRAGAGGAYFHFTVGDGVINIK*
Ga0070672_1017986642	3300005543	Miscanthus Rhizosphere	GLTSREKPGLTERTVRARAGSGGAYFKFTVGDGTVNIRRAAQ*
Ga0070695_1009919332	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	EGLEAREKPGLTERTVRARAGAGGPVFKFTVGDGTVNIRRTGT*
Ga0070695_1011433141	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	RTGKIVNAYEALQSREKPGITERTVRARAGAGGPFFRFTVGDGVVNIRKTAP*
Ga0070693_1013933322	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	NTYDGLTSREKPGLTERTVRARAGSGGAYFKFTVGDGTVNIRRAAQ*
Ga0070665_1017086211	3300005548	Switchgrass Rhizosphere	EKPGITERTIRARAGSGGAFFKFTVGDGLIGIKKMSQ*
Ga0070664_1017947752	3300005564	Corn Rhizosphere	LTAREKPGITERTVRARAGAGGAFFKFTVGDGTVNIRKAAQ*
Ga0068857_1003456913	3300005577	Corn Rhizosphere	VLRTGKIVNTYEGLASREKPGITERTVRARAGAGGAYFKFTVGDGTVNIRRAAQ*
Ga0068857_1008319913	3300005577	Corn Rhizosphere	GKIVNTYEGLASREKPGITERTVRARAGAGGAYFKFTVGDGVVNIRRVAQ*
Ga0068854_1021870451	3300005578	Corn Rhizosphere	GKIVNAYEALQSREKPGITERTVRARAGAGGPFFRFTVGDGVVNIRKTAP*
Ga0070702_1000375451	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	YEGLASREKPGITERTVRARAGAGGAYFKFTVGDGTVNIRRAAQ*
Ga0068852_1026392111	3300005616	Corn Rhizosphere	GKIINTYDGLTSREKPGLTERTVRARAGAGGAYFKFTVGDGTVNIRRASQ*
Ga0068859_1000845961	3300005617	Switchgrass Rhizosphere	GITEKTVRARAGAGGAYFKFTVGDGTVNIRRAEQ*
Ga0068864_1001892681	3300005618	Switchgrass Rhizosphere	KPGITERTVRARAGAGGPYFKFTVGDGIVNIRKGGT*
Ga0068864_1013033642	3300005618	Switchgrass Rhizosphere	GKIVNTYEALESREKPGITERTVRARAGAGGAYFKFTVGDGVVNIRKSAQ*
Ga0068861_1014331432	3300005719	Switchgrass Rhizosphere	LASREKPGITERTVRARAGAGGPYFKFTVGDGIVNIRKGGT*
Ga0068870_100624831	3300005840	Miscanthus Rhizosphere	NEYDALATREKPGITDRTIRARAGSGGAFFKFTVGDGVINLKKTAVTQP*
Ga0068870_104217141	3300005840	Miscanthus Rhizosphere	SYEGLEVREKPGITERSVRARAGAGGPFFKFTIGDGILTIKKSPS*
Ga0068858_1001993061	3300005842	Switchgrass Rhizosphere	GITERTVRARAGAGGAIFKFTVGDGTVNIRRTAP*
Ga0068858_1003145291	3300005842	Switchgrass Rhizosphere	REKPGITEKTVRARAGAGGAYFKFTVGDGTVNIRRAAQ*
Ga0068862_1006173981	3300005844	Switchgrass Rhizosphere	TFEGLASREKPGITERTVRGRAGAGGAYFKFTVGDGTVNIRRAAQ*
Ga0068862_1020894561	3300005844	Switchgrass Rhizosphere	EGLASREKPGITERTVRARAGAGGAFFRFTVGDGIVNIRKATQ*
Ga0066651_101012653	3300006031	Soil	GRIVNTYEGLDTREKPGITERTIRARAGAGGAFFRFTVGDGVIGIKKIGQVSGP*
Ga0070716_1004297623	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	ILRAGNIVDNYGALASRERPGITPTVMRARAGAGGPFFKFTVGVGTVSINKLL*
Ga0097621_1005539103	3300006237	Miscanthus Rhizosphere	FEGLASREKPGITERTVRGRAGAGGAYFKFTVGDGTVNIRRAAQ*
Ga0079221_103717683	3300006804	Agricultural Soil	EILRTGKIVNTYEGLDAREKPGITERTVRARAGAGGAFFKFTVGDGTVNIKRSEGQ*
Ga0075430_1016711261	3300006846	Populus Rhizosphere	GKIVNTYEGLAPREKPGITERTVRARAGAGGAFFRFTVGDGTVNIRKAAQ*
Ga0075431_1009978351	3300006847	Populus Rhizosphere	SGKIVDTFGGLQSRQKPGITERVMRARAGAGGAFFKFTVGDGTVNFIKSGG*
Ga0075433_100691591	3300006852	Populus Rhizosphere	GITERTVRARVGSGGPFFKFTVGDGTVNIRKSGT*
Ga0075433_102810261	3300006852	Populus Rhizosphere	PGITERTVRARAGAGGAFFKFTVGDGTVNIKRSGEQ*
Ga0068865_1018286532	3300006881	Miscanthus Rhizosphere	YDGLATREKPGITERLIRGRAGSGGAFFKFIVGDGLINLRKANP*
Ga0079216_114144422	3300006918	Agricultural Soil	RSGKIVNTHEGLASREKPGITERTVRARAGAGGAFFRITVGDGTVNIRKVAQ*
Ga0097620_1011441831	3300006931	Switchgrass Rhizosphere	TSREKPGLTERTVRARAGAGGAYFKFTVGDGTVNIRRASQ*
Ga0097620_1021043891	3300006931	Switchgrass Rhizosphere	RVGKIVNGYDALETREKPGITEHTIRARAGSGGAYFRFTIGDGMINIKKSGS*
Ga0079218_110476341	3300007004	Agricultural Soil	PGFNGDIDAEVLRIGKIVTTHEGLAAREKPGITERTVRARAGAGGAYFRITVGDGTVNIRKATQ*
Ga0075435_1003039293	3300007076	Populus Rhizosphere	TREKPGITERTIRGRAGAGGAYFHFTVGDGVINIR*
Ga0111539_116805061	3300009094	Populus Rhizosphere	DIDAEILRTGKIVTTHDGLAAREKPGITEHTVRARAGSGGAYFKFTVGDGTVNIRKAGP*
Ga0111539_117431591	3300009094	Populus Rhizosphere	TERTMRARAGAGGAFFRFTVGDGVIGIRKTGPVSSQ*
Ga0075418_104140771	3300009100	Populus Rhizosphere	LPAGFKGDLDADALRRGQIVNTHDGIVAREKPGIQPQTMRARAGSGGAFFRFTIGDGVVNIRKAGS*
Ga0114129_125156591	3300009147	Populus Rhizosphere	KPGITERTVRARAGSGGAFFKFTVGDGTVNIRKSAQ*
Ga0105243_130704982	3300009148	Miscanthus Rhizosphere	EKPGITERTVRARAGAGGAYFKFTVGDGTVNIRRAAQ*
Ga0075423_109307562	3300009162	Populus Rhizosphere	ESLESREKPGITERTMRARAGAGGAYFKFTVGDGVVHIRKGGS*
Ga0075423_128165581	3300009162	Populus Rhizosphere	REKPGITERTVRARAGAGGAYFKFTVGDGTVNIRRGGS*
Ga0105241_100852023	3300009174	Corn Rhizosphere	ILFNGKIVNTYEALATREKPGITERVVRGRAGAGGAFFKFTVGDGTVNIKRSGVQ*
Ga0105241_125155732	3300009174	Corn Rhizosphere	RTGKIINTYEGLVSREKPGLTERTVRARAGSGGAYFKFTVGDGTVNIRRAAQ*
Ga0105248_124099632	3300009177	Switchgrass Rhizosphere	ESREKPGITERTVRARAGAGGAYFKFTVGDGVVNIRKSAQ*
Ga0105238_122858772	3300009551	Corn Rhizosphere	YEGLASREKPGITERTVRARAGSGGAYFKFTVGDGTVNIRRAAQ*
Ga0105238_126824372	3300009551	Corn Rhizosphere	RGGKIVSTYDGLEPREKPGITERIVRARAGAGGPFFKFTVGEGMVNIKRSGEQ*
Ga0105249_103853291	3300009553	Switchgrass Rhizosphere	TSREKPGLTERTVRARAGAGGAYFKFTVGDGTVNIRKAGL*
Ga0126315_105613901	3300010038	Serpentine Soil	PGITERIVRARAGAGGAFFKFTVGDGVVNIRKSAP*
Ga0126315_112014921	3300010038	Serpentine Soil	GLSSREKPGITERTVRARAGAGGAFFRFTVGDGTVNIQRAAAQ*
Ga0126312_104888091	3300010041	Serpentine Soil	KIVNTYEGLLMREKPGITERTVRARAGAGGAYFKFTVGDGTVNIKRSGEQ*
Ga0126312_112943111	3300010041	Serpentine Soil	GKIVNTYEGLVSREKPGLTERVVWGRAGAGGAYFKFTVGDGTVNIRRAGT*
Ga0126376_118143092	3300010359	Tropical Forest Soil	LTSREKPGLTERTVRARAGAGGAYFKFTVGDGTVNIRRAAQ*
Ga0126377_100728784	3300010362	Tropical Forest Soil	LESREKPGITEKIVRARAGAGGATFRFTVGDGLISLKKSGE*
Ga0126377_128743642	3300010362	Tropical Forest Soil	EKPGLTERTVRGRAGAGGAYFKFTVGDGTVNIRRAGQ*
Ga0105239_134399151	3300010375	Corn Rhizosphere	TGKIVNTYDGLASREKPGITERTVRARAGAGGAYFKFTVGDGVVNIRRVAQ*
Ga0134124_104901481	3300010397	Terrestrial Soil	GLTERSVRARAGAGGAYFKFTVGDGTVNIRRATQ*
Ga0134127_101026431	3300010399	Terrestrial Soil	HEGLVSREKPGITERTVRARAGAGGAFFRVTVGDGTVNIRKVAQ*
Ga0134127_104505771	3300010399	Terrestrial Soil	PGITERTVRARAGAGGPYFKFTVGDGIVNIRKGGT*
Ga0134127_135379031	3300010399	Terrestrial Soil	REKPGITERTVRARAGAGGPFFKFTVGDGVVNIRKATQ*
Ga0134122_128514212	3300010400	Terrestrial Soil	LRTGKIVNAYEALQSREKPGITERTVRARAGAGGQFFRFTVGDGVVNIRKTAP*
Ga0134121_103575473	3300010401	Terrestrial Soil	EKLGITDRTIRARAGSGGAFFKFTVGDGVINLKKTAVTQP*
Ga0105246_115602361	3300011119	Miscanthus Rhizosphere	IVNTFEGLASREKPGITEKTVRARAGAGGAYFKFTVGDGTVNIRRAEQ*
Ga0150985_1146937731	3300012212	Avena Fatua Rhizosphere	DGLNMREKPGITERSIRARAGSGGAFFRFTVGDGVVNFKKTAVQ*
Ga0137360_113165292	3300012361	Vadose Zone Soil	ANTFPGLEARDKPGITERTIRARAGAGGATLKFTVGDGTISIKKRIEE*
Ga0137361_116868441	3300012362	Vadose Zone Soil	TLPGLEAREKPGLTERAIRARAGAGGATLKFTVGDGTIYIKKKVEE*
Ga0137404_117799302	3300012929	Vadose Zone Soil	PGITERTVRARAGAGGAYFKFTVGDGVVNIRRAAQ*
Ga0164298_112789282	3300012955	Soil	GLTAREKPGITEQTMRARAGAGGPFFKFTVGDGMVNIKRSGEQ*
Ga0157378_105541383	3300013297	Miscanthus Rhizosphere	VLRTGKIVSTYEGLASREKPGITERTVRARAGAGGAFFRFTVGDGTVKIRKATQ*
Ga0157378_106343113	3300013297	Miscanthus Rhizosphere	SREKPGITERTVRGRAGAGGAYFKFTVGDGIVNIRRAAQ*
Ga0163162_107350572	3300013306	Switchgrass Rhizosphere	QKPGITERIVRARAGAGGAFFKFTVGDGTLNFVKSGG*
Ga0157375_101145141	3300013308	Miscanthus Rhizosphere	PGITEHTVRARAGSGGAYFKFTVGDGTVNIRKAGP*
Ga0157375_119123301	3300013308	Miscanthus Rhizosphere	NTYEGLITREKPGITERIVRARAGAGGAYFKFTVGDGTVNIKRSAEK*
Ga0120188_10424551	3300013760	Terrestrial	KIVNSYEGLASREKPGITERTIRARAGAGGPYFKFTVGDGTVNIRKSGT*
Ga0157380_104352953	3300014326	Switchgrass Rhizosphere	EKPGITERTVRARAGAGGAYFKFTVGDGTVNIRRVAQ*
Ga0157380_124105642	3300014326	Switchgrass Rhizosphere	YEGLASREKPGITERTVRARAGAGGPYFKFTVGDGTVNIRKSGS*
Ga0157379_102963661	3300014968	Switchgrass Rhizosphere	GKIVNTYEGLAPREKPGITERTVRARAGYGGAFFSFTVGDGIVNIRRAGS*
Ga0157379_110665951	3300014968	Switchgrass Rhizosphere	YDYEGLETREKPGITERTIRARAGSGGAFFKFTVGDGLIGIKKMNQ*
Ga0157379_113543522	3300014968	Switchgrass Rhizosphere	EGLASREKPGITEKTVRARAGAGGAYFKFTVGDGTVNIRRAEQ*
Ga0132258_128400451	3300015371	Arabidopsis Rhizosphere	EKREKPGITERVVRARAGAGGAFFKFTVGEGTINFTKFVPG*
Ga0132256_1011587672	3300015372	Arabidopsis Rhizosphere	LATREKPGITDRTIRARAGSGGAFFKFTVGDGVINLKKTAVTQP*
Ga0184609_104660672	3300018076	Groundwater Sediment	LRVGQIEDTFAALETREKPGITTRIVRARAGAGGASFKFTVGDGTIRIRKLTMSDQ
Ga0190268_122881221	3300018466	Soil	SGQIVNTHDGIVAREKPGIQPQTMRARAGSGGAFFKFTIGDGVVNIRKAGS
Ga0247690_10087223	3300024287	Soil	GKIVNTYDGLAAREKPGITEQTVRARAGVGGAFFKFTVGDGTVNIKRSGEQ
Ga0207656_106776542	3300025321	Corn Rhizosphere	KPGITERTVRARAGSGGAYFKFTVGDGTVNIRRAAQ
Ga0209751_105614251	3300025327	Soil	ADILRTGRIEDTFAALESRGRPGITDRVMRARAGAGGAFFKFTVGDGTIRIKKLVMNDR
Ga0207680_107324572	3300025903	Switchgrass Rhizosphere	YDYEGLETREKPGITERTIRARAGSGGAFFKFTVGDGLIGIKKMSQ
Ga0207643_100889474	3300025908	Miscanthus Rhizosphere	NEYDALATREKPGITDRTIRARAGSGGAFFKFTVGDGVINLKKTAVTQP
Ga0207643_109415271	3300025908	Miscanthus Rhizosphere	KPGITERTIRARAGSGGAFFKFTVGDGLIGIKKMSQ
Ga0207662_112793651	3300025918	Switchgrass Rhizosphere	AEILRTGKIVTTHDGLAAREKPGITEHTVRARAGSGGAYFKFTVGDGTVNIRKAGP
Ga0207657_108611901	3300025919	Corn Rhizosphere	TYEGLASREKPGITERTVRARAGSGGAYFKFTVGDGTVNIRRAAQ
Ga0207649_106788951	3300025920	Corn Rhizosphere	GGKIVSTYDGLEPREKPGITERIVRARAGAGGPFFKFTVGEGMVNIKRSGEP
Ga0207681_105720793	3300025923	Switchgrass Rhizosphere	RTGKIVNTFEGLASREKPGITEKTVRARAGAGGAYFKFTVGDGTVNIRRAAQ
Ga0207701_112511221	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	RMGKIAYDYEGLETREKPGITERTIRARAGSGGAFFKFTVGDGLIGIKKMSQ
Ga0207691_117112751	3300025940	Miscanthus Rhizosphere	NTYEGLTSREKPGLTERTVRARAGSGGAYFKFTVGDGTVNIRRAAQ
Ga0207689_101892564	3300025942	Miscanthus Rhizosphere	KIAYDYEGLETREKPGITERTIRARAGSGGAFFKFTVGDGLIGIKKMSQ
Ga0207679_104453241	3300025945	Corn Rhizosphere	ASREKPGITERTVRARAGSGGAYFKFTVGDGTVNIRRAAQ
Ga0207679_113572002	3300025945	Corn Rhizosphere	EKPGITERTVRARAGAGGPYFKFTVGDGVVNIRKAAP
Ga0207651_109405092	3300025960	Switchgrass Rhizosphere	LRIGKIAYDYEGLETREKPGITDRTIRARAGSGGPFFKFTVGDGLIGIKKMNQ
Ga0207640_115321421	3300025981	Corn Rhizosphere	KIVNAYDGLASREKPGITERTVRARAGAGGPYFKFTVGDGTVNIRKSGS
Ga0207677_107181462	3300026023	Miscanthus Rhizosphere	IAYDYEGLETREKPGITERTIRARAGSGGAFFKFTVGDGLIGIKKMSQ
Ga0207678_109875342	3300026067	Corn Rhizosphere	RSYYSTGTIVNTYEGLASREKPGITERTVRARAGAGGAYFKFTVGDGTVNIRRAAQ
Ga0207676_108111211	3300026095	Switchgrass Rhizosphere	KIINTYEGLTSREKPGLTERTVRARAGSGGPYFKFTVGDGTVNIRRAAQ
Ga0207675_1021733092	3300026118	Switchgrass Rhizosphere	LRTGKIVNAYEALQSREKPGITERTVRARAGAGGPFFKFTVGDGVVNIRKSAP
Ga0207698_115962112	3300026142	Corn Rhizosphere	GKIINTYDGLTSREKPGLTERTVRARAGAGGAYFKFTVGDGTVNIRRASQ
Ga0209818_12308682	3300027637	Agricultural Soil	SREKPGITERTVRARAGAGGAFFRITVGDGTVNIRKVAQ
Ga0209481_102572461	3300027880	Populus Rhizosphere	EVLRTGKIVNTYEGLASREKPGITERTVRARAGAGGPFFKFTVGDGTVNIRKGGS
Ga0209481_103623931	3300027880	Populus Rhizosphere	IDADVLRSGQIVNTHDGIVAREKPGIQPQTMRARAGSGGAFFRFTIGDGVVNIRKAGS
Ga0209486_106707881	3300027886	Agricultural Soil	PGFNGDIDAEVLRIGKIVTTHEGLAAREKPGITERTVRARAGAGGAYFRITVGDGTVNIRKATQ
Ga0209382_106715501	3300027909	Populus Rhizosphere	KPGIQPQTMRARAGSGGAFFRFTIGDGVVNIRKAGS
Ga0209526_102887853	3300028047	Forest Soil	AIAFPGLEAREKPGLTERSIRARAGAGGATLKFTVGAGTIYIKKKIEE
Ga0268265_113018491	3300028380	Switchgrass Rhizosphere	LRTGKIVNTFEGLASREKPGITEKTVRARAGAGGAYFKFTVGDGTVNIRRAEQ
Ga0310887_103547431	3300031547	Soil	LRTGKIVDNFGQLETRQKPGITEKVVRARAGAGGAFFKFTVGEGTLNFVKSGG
Ga0307408_1003065971	3300031548	Rhizosphere	LRTGKIVNTYEGLASREKPGITERTVRARAGAGGAYFKFTVGDGVVNIRRAAQ
Ga0307408_1016927591	3300031548	Rhizosphere	ASREKPGITERTVRARAGAGGPYFKFTVGDGIVNIRKGGT
Ga0307408_1017995411	3300031548	Rhizosphere	LRNGKIVNTYEELAAREKPGITERTVRARAGAGGAYFKFTVGDGTVNIKRSGEQ
Ga0307405_109294112	3300031731	Rhizosphere	ASREKPGITERTVRARAGAGGPYFKFTVGDGTVNIRKSGS
Ga0310904_109654821	3300031854	Soil	AREKPGITEHTVRARAGSGGAYFKFTVGDGTVNIRKAGP
Ga0307406_110032792	3300031901	Rhizosphere	GLAPREKPGITERTIRARAGAGGAFFRFTVGDGTVNIRKAVQ
Ga0310885_103569231	3300031943	Soil	DNFGQLETRQKPGITEKVVRARAGAGGAFFKFTVGDGTLNFVKSGG
Ga0310884_102697541	3300031944	Soil	RTGKIVDNFGQLETRQKPGITEKVVRARAGAGGAFFKFTVGDGTLNFVKSGG
Ga0307409_1008609311	3300031995	Rhizosphere	ITDRIVRARAGAGGAFFKFTVGDGAIRIGKLAISDQ
Ga0307414_103971121	3300032004	Rhizosphere	ELAAREKPGITERTVRARAGAGGAYFKFTVGDGTVNIKRSGDQ
Ga0308173_117333951	3300032074	Soil	EKPGITERTVRGRAGAGGAYFKFTVGDGVVNIRRAAQ
Ga0315912_111947432	3300032157	Soil	DILFGGKIVNTYEGLAAREKPGITERTVRGRAGAGGAFFKFTVGNGTVNLKRSEVK
Ga0310810_104554603	3300033412	Soil	NTYEGLGTREKPGITERTIRGRAGAGGAYFHFTVGDGVINIM
Ga0373959_0187502_394_540	3300034820	Rhizosphere Soil	IVNTHEGLASREKPGITERTVRARAGAGGAFFKFTVGDGTVNIRKAAQ
Ga0370497_0122304_510_635	3300034965	Untreated Peat Soil	LEVREKPGITERTVRARAGSGGAFFKFTVGDGTVNIRKVSQ

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign