Basic Information | |
---|---|
Family ID | F044676 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 154 |
Average Sequence Length | 46 residues |
Representative Sequence | EALAHTLTLQPDLSSAHVENNTVYANPADRSRFLEGLRKAGLKN |
Number of Associated Samples | 130 |
Number of Associated Scaffolds | 154 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.01 % |
% of genes near scaffold ends (potentially truncated) | 94.81 % |
% of genes from short scaffolds (< 2000 bps) | 91.56 % |
Associated GOLD sequencing projects | 119 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (68.831 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.130 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.818 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.299 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.67% β-sheet: 0.00% Coil/Unstructured: 58.33% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 154 Family Scaffolds |
---|---|---|
PF12146 | Hydrolase_4 | 8.44 |
PF00156 | Pribosyltran | 5.84 |
PF13414 | TPR_11 | 3.90 |
PF03061 | 4HBT | 3.90 |
PF08028 | Acyl-CoA_dh_2 | 2.60 |
PF00353 | HemolysinCabind | 2.60 |
PF14534 | DUF4440 | 2.60 |
PF13577 | SnoaL_4 | 2.60 |
PF00486 | Trans_reg_C | 1.95 |
PF12728 | HTH_17 | 1.95 |
PF06568 | DUF1127 | 1.95 |
PF12697 | Abhydrolase_6 | 1.95 |
PF01479 | S4 | 1.30 |
PF07719 | TPR_2 | 1.30 |
PF13683 | rve_3 | 1.30 |
PF02738 | MoCoBD_1 | 1.30 |
PF01569 | PAP2 | 0.65 |
PF05977 | MFS_3 | 0.65 |
PF01546 | Peptidase_M20 | 0.65 |
PF16576 | HlyD_D23 | 0.65 |
PF13586 | DDE_Tnp_1_2 | 0.65 |
PF13186 | SPASM | 0.65 |
PF13701 | DDE_Tnp_1_4 | 0.65 |
PF05199 | GMC_oxred_C | 0.65 |
PF13517 | FG-GAP_3 | 0.65 |
PF03447 | NAD_binding_3 | 0.65 |
PF00248 | Aldo_ket_red | 0.65 |
PF05120 | GvpG | 0.65 |
PF04909 | Amidohydro_2 | 0.65 |
PF04079 | SMC_ScpB | 0.65 |
PF00166 | Cpn10 | 0.65 |
PF13424 | TPR_12 | 0.65 |
PF13649 | Methyltransf_25 | 0.65 |
PF02518 | HATPase_c | 0.65 |
PF13437 | HlyD_3 | 0.65 |
PF01464 | SLT | 0.65 |
PF13411 | MerR_1 | 0.65 |
COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
---|---|---|---|
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 2.60 |
COG5457 | Uncharacterized conserved protein YjiS, DUF1127 family | Function unknown [S] | 1.95 |
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
COG1386 | Chromosome segregation and condensation protein ScpB | Transcription [K] | 0.65 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.65 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 68.83 % |
Unclassified | root | N/A | 31.17 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000033|ICChiseqgaiiDRAFT_c0443946 | Not Available | 575 | Open in IMG/M |
3300000955|JGI1027J12803_100212327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1673 | Open in IMG/M |
3300003373|JGI25407J50210_10117242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 656 | Open in IMG/M |
3300003659|JGI25404J52841_10077944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 692 | Open in IMG/M |
3300004070|Ga0055488_10085677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 746 | Open in IMG/M |
3300004643|Ga0062591_101789713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 626 | Open in IMG/M |
3300005162|Ga0066814_10006183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1318 | Open in IMG/M |
3300005204|Ga0068997_10086176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 660 | Open in IMG/M |
3300005329|Ga0070683_100720385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 956 | Open in IMG/M |
3300005331|Ga0070670_101175763 | Not Available | 701 | Open in IMG/M |
3300005332|Ga0066388_103863512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 764 | Open in IMG/M |
3300005332|Ga0066388_106557753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 587 | Open in IMG/M |
3300005332|Ga0066388_107543875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
3300005332|Ga0066388_108403587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 514 | Open in IMG/M |
3300005332|Ga0066388_108406489 | Not Available | 514 | Open in IMG/M |
3300005334|Ga0068869_102050936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 514 | Open in IMG/M |
3300005335|Ga0070666_10818012 | Not Available | 687 | Open in IMG/M |
3300005340|Ga0070689_101105785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 708 | Open in IMG/M |
3300005344|Ga0070661_101337746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 602 | Open in IMG/M |
3300005353|Ga0070669_100221873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1495 | Open in IMG/M |
3300005438|Ga0070701_10552150 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
3300005455|Ga0070663_102055998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 514 | Open in IMG/M |
3300005518|Ga0070699_100475154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1134 | Open in IMG/M |
3300005535|Ga0070684_101427012 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 652 | Open in IMG/M |
3300005543|Ga0070672_101342404 | Not Available | 639 | Open in IMG/M |
3300005544|Ga0070686_101818465 | Not Available | 519 | Open in IMG/M |
3300005564|Ga0070664_100590485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1029 | Open in IMG/M |
3300005564|Ga0070664_101210701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 712 | Open in IMG/M |
3300005614|Ga0068856_100128706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2536 | Open in IMG/M |
3300005616|Ga0068852_101463962 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300005618|Ga0068864_102452793 | Not Available | 528 | Open in IMG/M |
3300005713|Ga0066905_101677131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
3300005713|Ga0066905_101753893 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300005764|Ga0066903_105226648 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
3300005764|Ga0066903_107725409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
3300005834|Ga0068851_10138269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1323 | Open in IMG/M |
3300005834|Ga0068851_10617476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 661 | Open in IMG/M |
3300005841|Ga0068863_101929521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 600 | Open in IMG/M |
3300005937|Ga0081455_10087714 | All Organisms → cellular organisms → Bacteria | 2531 | Open in IMG/M |
3300005937|Ga0081455_10329638 | Not Available | 1084 | Open in IMG/M |
3300005985|Ga0081539_10245540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 798 | Open in IMG/M |
3300005985|Ga0081539_10492065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
3300006046|Ga0066652_101497593 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
3300006048|Ga0075363_100453480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 758 | Open in IMG/M |
3300006058|Ga0075432_10083865 | Not Available | 1158 | Open in IMG/M |
3300006173|Ga0070716_100948269 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300006175|Ga0070712_100772899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 823 | Open in IMG/M |
3300006178|Ga0075367_10443948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 822 | Open in IMG/M |
3300006237|Ga0097621_100577538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1025 | Open in IMG/M |
3300006358|Ga0068871_100365103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1279 | Open in IMG/M |
3300006577|Ga0074050_11718865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 920 | Open in IMG/M |
3300006603|Ga0074064_11098878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
3300006844|Ga0075428_100019019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7597 | Open in IMG/M |
3300006880|Ga0075429_101568437 | Not Available | 572 | Open in IMG/M |
3300006969|Ga0075419_10125474 | Not Available | 1665 | Open in IMG/M |
3300006969|Ga0075419_10634996 | Not Available | 752 | Open in IMG/M |
3300009094|Ga0111539_11196618 | Not Available | 883 | Open in IMG/M |
3300009100|Ga0075418_10024515 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 6604 | Open in IMG/M |
3300009100|Ga0075418_12246527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 595 | Open in IMG/M |
3300009101|Ga0105247_10197749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1349 | Open in IMG/M |
3300009101|Ga0105247_10244415 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
3300009101|Ga0105247_11551730 | Not Available | 542 | Open in IMG/M |
3300009148|Ga0105243_12994143 | Not Available | 512 | Open in IMG/M |
3300009156|Ga0111538_10357031 | Not Available | 1850 | Open in IMG/M |
3300009174|Ga0105241_11975744 | Not Available | 573 | Open in IMG/M |
3300009553|Ga0105249_10218051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1876 | Open in IMG/M |
3300009789|Ga0126307_11447920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 557 | Open in IMG/M |
3300010043|Ga0126380_10605887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 863 | Open in IMG/M |
3300010043|Ga0126380_11957619 | Not Available | 535 | Open in IMG/M |
3300010360|Ga0126372_11452851 | Not Available | 720 | Open in IMG/M |
3300010362|Ga0126377_10233709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SHOUNA76 | 1780 | Open in IMG/M |
3300010362|Ga0126377_10818324 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 991 | Open in IMG/M |
3300010396|Ga0134126_10749981 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
3300012285|Ga0137370_10668516 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300012505|Ga0157339_1035739 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300012948|Ga0126375_11000548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 681 | Open in IMG/M |
3300012951|Ga0164300_10199793 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300012951|Ga0164300_10215764 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300012958|Ga0164299_10462813 | Not Available | 833 | Open in IMG/M |
3300012960|Ga0164301_10268862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1130 | Open in IMG/M |
3300012987|Ga0164307_10687910 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300012989|Ga0164305_10384339 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300013105|Ga0157369_11312592 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300013296|Ga0157374_10742228 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 996 | Open in IMG/M |
3300014969|Ga0157376_10904070 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 901 | Open in IMG/M |
3300015077|Ga0173483_10042087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1713 | Open in IMG/M |
3300015077|Ga0173483_10713679 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300015077|Ga0173483_10927578 | Not Available | 515 | Open in IMG/M |
3300015371|Ga0132258_10604282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 2754 | Open in IMG/M |
3300015374|Ga0132255_103500585 | Not Available | 668 | Open in IMG/M |
3300016357|Ga0182032_10130670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1828 | Open in IMG/M |
3300016404|Ga0182037_10706798 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 863 | Open in IMG/M |
3300017999|Ga0187767_10014023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1629 | Open in IMG/M |
3300018067|Ga0184611_1221450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
3300018074|Ga0184640_10276145 | Not Available | 763 | Open in IMG/M |
3300018468|Ga0066662_10437396 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
3300018469|Ga0190270_10029253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 3556 | Open in IMG/M |
3300018469|Ga0190270_13060225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 529 | Open in IMG/M |
3300018476|Ga0190274_10059310 | Not Available | 2823 | Open in IMG/M |
3300018920|Ga0190273_10705619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 783 | Open in IMG/M |
3300019362|Ga0173479_10608376 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300019886|Ga0193727_1069080 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300020005|Ga0193697_1116431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
3300023263|Ga0247800_1069711 | Not Available | 672 | Open in IMG/M |
3300023270|Ga0247784_1115679 | Not Available | 689 | Open in IMG/M |
3300025901|Ga0207688_10388992 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
3300025907|Ga0207645_10827942 | Not Available | 629 | Open in IMG/M |
3300025925|Ga0207650_10507182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1009 | Open in IMG/M |
3300025926|Ga0207659_11316470 | Not Available | 620 | Open in IMG/M |
3300025929|Ga0207664_11091358 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300025936|Ga0207670_10356745 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
3300025940|Ga0207691_10173625 | Not Available | 1886 | Open in IMG/M |
3300025945|Ga0207679_10464042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1125 | Open in IMG/M |
3300025945|Ga0207679_10853966 | Not Available | 831 | Open in IMG/M |
3300025949|Ga0207667_11709223 | Not Available | 596 | Open in IMG/M |
3300025953|Ga0210068_1035782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 747 | Open in IMG/M |
3300025972|Ga0207668_10882868 | Not Available | 795 | Open in IMG/M |
3300025972|Ga0207668_11124332 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 705 | Open in IMG/M |
3300026075|Ga0207708_10806962 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300026078|Ga0207702_10578571 | Not Available | 1101 | Open in IMG/M |
3300026095|Ga0207676_10756011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 946 | Open in IMG/M |
3300026374|Ga0257146_1038736 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300026886|Ga0207982_1001998 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300027523|Ga0208890_1042711 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300027907|Ga0207428_10287195 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
3300027909|Ga0209382_10049578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5006 | Open in IMG/M |
3300027909|Ga0209382_11261180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rivibacter → Rivibacter subsaxonicus | 752 | Open in IMG/M |
3300027910|Ga0209583_10114192 | Not Available | 1059 | Open in IMG/M |
3300028704|Ga0307321_1070654 | Not Available | 682 | Open in IMG/M |
3300028708|Ga0307295_10042641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1158 | Open in IMG/M |
3300028711|Ga0307293_10076878 | Not Available | 1052 | Open in IMG/M |
3300028712|Ga0307285_10140001 | Not Available | 658 | Open in IMG/M |
3300028768|Ga0307280_10019805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1925 | Open in IMG/M |
3300028782|Ga0307306_10035551 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
3300028791|Ga0307290_10051489 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
3300028796|Ga0307287_10186043 | Not Available | 789 | Open in IMG/M |
3300028796|Ga0307287_10363632 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
3300028812|Ga0247825_10778561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 690 | Open in IMG/M |
3300028814|Ga0307302_10613602 | Not Available | 541 | Open in IMG/M |
3300030989|Ga0308196_1049561 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300031198|Ga0307500_10010788 | All Organisms → cellular organisms → Bacteria | 1870 | Open in IMG/M |
3300031455|Ga0307505_10652258 | Not Available | 514 | Open in IMG/M |
3300031474|Ga0170818_111195400 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300031770|Ga0318521_10088166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SHOUNA76 | 1687 | Open in IMG/M |
3300031858|Ga0310892_10710519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 690 | Open in IMG/M |
3300032003|Ga0310897_10425668 | Not Available | 632 | Open in IMG/M |
3300032174|Ga0307470_10252935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1165 | Open in IMG/M |
3300033433|Ga0326726_12500123 | Not Available | 501 | Open in IMG/M |
3300034090|Ga0326723_0184148 | Not Available | 923 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.13% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.79% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.84% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.25% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.25% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 3.25% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.60% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.95% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.95% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.95% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.30% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.30% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.30% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.30% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.30% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.30% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.30% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.30% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.65% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.65% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.65% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.65% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.65% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.65% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.65% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.65% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.65% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.65% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.65% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.65% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001116 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 | Environmental | Open in IMG/M |
3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
3300005204 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
3300023270 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5 | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025953 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
3300026886 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAB (SPAdes) | Environmental | Open in IMG/M |
3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiDRAFT_04439461 | 3300000033 | Soil | GMLGRTDEAKEALVRTLTMQPDLSSAHVANDTVYSDPDVRARFLEGLRKAGLQS* |
JGI1027J12803_1002123271 | 3300000955 | Soil | LQPDLSSAHVANNTVFANPDDRARFLLGLQRAGLKD* |
JGI12627J13344_1042041 | 3300001116 | Forest Soil | PKHSGAWRLLTVSLGLLGKTDEAKAALAQTLKLQPDLSLNHVESNTIYADPVDRARFREGLLKAGLDR* |
JGI25407J50210_101172422 | 3300003373 | Tabebuia Heterophylla Rhizosphere | EEAQAALAHTLTLQPDLSSAHVVNDTVFADAADRSRFLEGLRKAGLKX* |
JGI25404J52841_100779442 | 3300003659 | Tabebuia Heterophylla Rhizosphere | LLGKIDEAREALARTLALQPDLSSAHVANNTVFANPDDRARFLLGLQKAGLRD* |
Ga0055488_100856773 | 3300004070 | Natural And Restored Wetlands | IDEAKQALAHARSLQPDLSLNHVEKNTVYVDPADRARFLQGLRNAGLQD* |
Ga0062591_1017897131 | 3300004643 | Soil | ALAHTLKLQPDLSIDHVEKNTVYADPADRSRFLEGLRKAGLKG* |
Ga0066814_100061832 | 3300005162 | Soil | GRVDEAKAALAHTLTLQPDLSSAHVEINTVYANPEDRARFLEGLRKAGLKN* |
Ga0068997_100861761 | 3300005204 | Natural And Restored Wetlands | LLGRTEEARKALARTLTLQPDLSSAHVAQNTVYTDPLHRERFLQGLRNAGLED* |
Ga0070683_1007203852 | 3300005329 | Corn Rhizosphere | LGKIDEAREALARTLALQPDLSSAHVTHDTVFVNPNDRERFLQGLLNAGLKN* |
Ga0070670_1011757631 | 3300005331 | Switchgrass Rhizosphere | VSLGLLGRIDEAKAALARTLTLQPDLSISHVEINTVYADPADRLRFREGLRKAGLEK* |
Ga0066388_1038635123 | 3300005332 | Tropical Forest Soil | AKEALVRTLTMQPDLSSAHVANDTVYSDADVRERFLEGLRRAGLKD* |
Ga0066388_1065577531 | 3300005332 | Tropical Forest Soil | AREALERTLALQPDLSSAHVTHDTVFVNANDRARFLQGLLNAGLKK* |
Ga0066388_1075438752 | 3300005332 | Tropical Forest Soil | RTLALQPDLSSAHVTHDTVFVNPNDRARFLQGLLNAGLKN* |
Ga0066388_1084035872 | 3300005332 | Tropical Forest Soil | AKEALVRTLTMQPDLSSAHVANDTVYSDPDVRERFLEGLRRAGLKD* |
Ga0066388_1084064892 | 3300005332 | Tropical Forest Soil | AREALVHTLSLQPDLSSAHVENNTVYTDPADRSRFLLGLQKAGLTT* |
Ga0068869_1020509361 | 3300005334 | Miscanthus Rhizosphere | DEAKAALARTLTLQPDLSISHVEINTVYADPADRLRFREGLRKAGLEK* |
Ga0070666_108180123 | 3300005335 | Switchgrass Rhizosphere | LGRIDEAKAALARTLTLQPDLSISHVEINTVYADPADRLRFREGLRKAGLEK* |
Ga0070689_1011057852 | 3300005340 | Switchgrass Rhizosphere | LGREDEARAALARTLALQPDLSIDHVETNTVYANAADRARFRDGLRKAGLEN* |
Ga0070661_1013377461 | 3300005344 | Corn Rhizosphere | EAKDALAHTMTLQPDLSSAHVEINTVYANPEDRARFLEGLRKAGLKN* |
Ga0070669_1002218732 | 3300005353 | Switchgrass Rhizosphere | DEAKDALAHTLTLQPDLSSAHVEINTVYANPEDRARFLEGLRKAGLKN* |
Ga0070701_105521501 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | RTLALQPDLSSAHVTHDTVFVNPNDRERFLQGLLNAGLKN* |
Ga0070663_1020559981 | 3300005455 | Corn Rhizosphere | KDALAHTLTLQPDLASAHVEMNTVYANPQERSRFLEGLRKAGLKN* |
Ga0070699_1004751542 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RQALAHTLTLQPDLSLSHVEKNTVFANPSDRSRFLLGLQRAGLKD* |
Ga0070684_1014270122 | 3300005535 | Corn Rhizosphere | EAKAALTQTLTLQPDLSLAHVENNNIYAEPADRERFREGLLKAGLTR* |
Ga0070672_1013424041 | 3300005543 | Miscanthus Rhizosphere | ARTLELSPDFSLDHVEKNTVYADPADRARFLEGLRKAGLGG* |
Ga0070686_1018184651 | 3300005544 | Switchgrass Rhizosphere | ARTLELSPDFSLDHVEKNTIYADPADRARFLEGLRKAGLGG* |
Ga0070664_1005904851 | 3300005564 | Corn Rhizosphere | LLGKIDEAREALARTLALQPDLSSAHVTHDTVFVNPNDRERFLQGLLNAGLKN* |
Ga0070664_1012107012 | 3300005564 | Corn Rhizosphere | GKIDEAREALARTLALQPDLSSAHVTHDTVFVNPNDRERFLQGLLNAGLKN* |
Ga0068856_1001287062 | 3300005614 | Corn Rhizosphere | MTASLGMLGKLDDAREALARAQMLQPDLSSAQVESNTVYANPAERSRFIEGLRQAGLRH* |
Ga0068852_1014639621 | 3300005616 | Corn Rhizosphere | MQTLTLQPDLSSDHVVNNTVYVNSSDRSRFLLGLQKAGLKH* |
Ga0068864_1024527932 | 3300005618 | Switchgrass Rhizosphere | PDLSSAHVEINTVYANPEDRSRFLEGLRKAGLKN* |
Ga0066905_1016771311 | 3300005713 | Tropical Forest Soil | TLTMQPDLSSAHVADNTVYADPADRSRFLEGLRKAGLKD* |
Ga0066905_1017538932 | 3300005713 | Tropical Forest Soil | TMQPDLSSAHVANDTVYSDPDVRARFLEGLRKAGLQN* |
Ga0066903_1052266482 | 3300005764 | Tropical Forest Soil | DEAKEALVRTLTMHPDLSSAHVENDTVFSDPADRERFLEGLRRAGLKN* |
Ga0066903_1077254091 | 3300005764 | Tropical Forest Soil | RTLALQPDLSSAHVTHDTVFVNPNDRARFLQGLLNAGLKY* |
Ga0068851_101382692 | 3300005834 | Corn Rhizosphere | LLGRVDEAKDALAHTLTLQPDLSSAHVEINTVYANPEDRARFLEGLRKAGLKN* |
Ga0068851_106174762 | 3300005834 | Corn Rhizosphere | MQTLALQPDLSSDHVVNNTVYVNSSDRSRFLLGLQKAGLKH* |
Ga0068863_1019295211 | 3300005841 | Switchgrass Rhizosphere | GLLGKIDEAREALARTLALQPDLSSAHVTHDTVFVNPNDRERFLQGLLNAGLKN* |
Ga0081455_100877145 | 3300005937 | Tabebuia Heterophylla Rhizosphere | QPDLSSAHVANNTVFANPDDRARFLLGLQRAGLKD* |
Ga0081455_103296382 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MAHKELKYNEEARAALAHTLTLHPDLSSAHVVNDTVFANPADRARFLEGLRKAGLEK* |
Ga0081539_102455401 | 3300005985 | Tabebuia Heterophylla Rhizosphere | EEAQVALAHTLELHPDFSLDHVEKNTIYADPADRQRFLEGLRRAGLKG* |
Ga0081539_104920652 | 3300005985 | Tabebuia Heterophylla Rhizosphere | EAHAALKHTLTLQPELSLDHVEKNTVYADPADRARFLEGLRKAGLKS* |
Ga0066652_1014975931 | 3300006046 | Soil | LGMLGRIDEAKEALARTRVLHPDLSLAHVEKDTVYADPADRARFLQGLRSAGLQD* |
Ga0075363_1004534801 | 3300006048 | Populus Endosphere | LGKLDEAREALAHARMLQPELSSAQVESSTVYANSAERARFIEGFRKAGLSD* |
Ga0075432_100838653 | 3300006058 | Populus Rhizosphere | PDLSSAHVANNTVFANPDDRARFLLGLQKAGLRD* |
Ga0070716_1009482692 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LQPDLSSAHVEINTVYANPEDRARFLEGLRKTGLKN* |
Ga0070712_1007728992 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GKLDEAKEALAHARTLQPDLASSQVESNTVYANPAERSRFIEGLRQAGLRH* |
Ga0075367_104439481 | 3300006178 | Populus Endosphere | LGKEEEAGAALKHTLTLQPELSLDHVEKNTVYADPADRARFLEGLRRAGLKS* |
Ga0097621_1005775383 | 3300006237 | Miscanthus Rhizosphere | ALQPDLKMSHVEHNTVYADPADRARFLEGLRKAGLQS* |
Ga0068871_1003651031 | 3300006358 | Miscanthus Rhizosphere | LGLLGRVDEAKDALAHTLTLQPDLSSAHVEINTVYANPEDRSRFLEGLRKAGLKN* |
Ga0074050_117188651 | 3300006577 | Soil | LQPDLSSAHVEINTVYANPEDRARFLEGLRKAGLKN* |
Ga0074064_110988781 | 3300006603 | Soil | EAREALARTLALQPDLSSAHVTHDTVFVNPNDRERFLQGLLNAGLKN* |
Ga0075428_1000190198 | 3300006844 | Populus Rhizosphere | AQEALARTLALQPDLSSAHVANNTVFANPDDRARFLLGLQRAGLKD* |
Ga0075429_1015684371 | 3300006880 | Populus Rhizosphere | QEALARTLALQPDLSSAHVANNTVFANPDDRARFLLGLQRAGLKD* |
Ga0075419_101254744 | 3300006969 | Populus Rhizosphere | LARTLALQPDLSSAHVANNTVFANPDDRARFLLGLQKAGLRD* |
Ga0075419_106349963 | 3300006969 | Populus Rhizosphere | EAQEALARTLALQPDLSSAHVANNTVFANPDDRARFLLGLQRAGLKD* |
Ga0111539_111966182 | 3300009094 | Populus Rhizosphere | PDLSSAHVANNTVFANPDDRARFLLGLQRAGLKD* |
Ga0075418_1002451514 | 3300009100 | Populus Rhizosphere | EALARTLALQPDLSSAHVANNTVFANPDDRARFLLGLQKAGLRD* |
Ga0075418_122465272 | 3300009100 | Populus Rhizosphere | SLGLLGKTDEANAALAQTLMLQPDLSLDHVESNTIYADPADRARFREGLLRAGLTR* |
Ga0105247_101977491 | 3300009101 | Switchgrass Rhizosphere | TASLGMLGKLDEAREALAHAQMLQPGLSSAQVESNTVYANPTERARFIEGLRQAGLRH* |
Ga0105247_102444152 | 3300009101 | Switchgrass Rhizosphere | AALAHTLTLQPDLSSAHVEINTVYANPEDRARFLEGLRKAGLKN* |
Ga0105247_115517301 | 3300009101 | Switchgrass Rhizosphere | RTLELSPDFSLDHVEKNTIYADPADRARFLEGLRKAGLGG* |
Ga0105243_129941431 | 3300009148 | Miscanthus Rhizosphere | LEAALAQTLTLQPDLSLDHVESNTIYADPADRARFREGLLKAGLNC* |
Ga0111538_103570311 | 3300009156 | Populus Rhizosphere | EAQEALARTLALQPDLSSAHVANNTVFANPDDRARFLLGLQKAGLRD* |
Ga0105241_119757442 | 3300009174 | Corn Rhizosphere | LLGRQDEAREALERTLALQPDLKMSHVEHNTVYADPADRARFLEGLRKAGLQS* |
Ga0105249_102180511 | 3300009553 | Switchgrass Rhizosphere | ALAHTLTLQPDLSSAHVEINTVYANPEDRARFLEGLRKAGLKN* |
Ga0126307_114479201 | 3300009789 | Serpentine Soil | AKVALAQTLRLQPDLSLDHVENNTIYADPADRARFREGLRKAGLER* |
Ga0126380_106058871 | 3300010043 | Tropical Forest Soil | HTLTMQPDLSSAHVADNTVYADPADRSRFLEGLRKAGLKD* |
Ga0126380_119576191 | 3300010043 | Tropical Forest Soil | QPDLSEAHVTNDTVFADPADRSRFLEGLRKAGLQR* |
Ga0126372_114528511 | 3300010360 | Tropical Forest Soil | LAHTLTLQPDLSSAHVEANTVFADPADRSRFLLGLQKAGLQR* |
Ga0126377_102337091 | 3300010362 | Tropical Forest Soil | ALQPDLSSAHVTHDTVFVNPNDRARFLQGLLNAGLKQ* |
Ga0126377_108183242 | 3300010362 | Tropical Forest Soil | EAKEALARTLTLQPDLSSAHVANNTVFANPDDRARFLLGLQKAGLKD* |
Ga0134126_107499812 | 3300010396 | Terrestrial Soil | AHTLTLQPDLAGAHVEMNTVYANQQDRSRFLEGLRKAGLKN* |
Ga0150985_1024423712 | 3300012212 | Avena Fatua Rhizosphere | LTVSLALLGKIEEAKAALAQTLVLQPDLSLAHVENNNIYADPADRERFREGLIKAGLTR* |
Ga0137370_106685161 | 3300012285 | Vadose Zone Soil | AREALAHTLTMPPDLSSAHVTNDTVYADPADRARFLEGLRKAGLKG* |
Ga0157339_10357392 | 3300012505 | Arabidopsis Rhizosphere | AHTLTLQPDLSSAHVEINTVYANPEDRARFLEGLRKAGLKN* |
Ga0157310_103409692 | 3300012916 | Soil | LLTVSLALLGKTEEAKAALTQTLTLQPDLSLAHVENNNIYAEPADRERFREGLLKAGLTR |
Ga0126375_110005482 | 3300012948 | Tropical Forest Soil | LAHTLTMQPDLSSAHVADNTVYADPADRSRFLEGLRKAGLKD* |
Ga0164300_101997931 | 3300012951 | Soil | LQPDLSSDHVVNNTVYVNSSDRSRFLLGLQKAGLKH* |
Ga0164300_102157641 | 3300012951 | Soil | TDLSSAHVENNTVYANPADRSRFLEGLRKAGLKN* |
Ga0164299_104628131 | 3300012958 | Soil | SESLAHTLTLQPDLSSDHVANNTVYANASDRSRFLSGLQKAGLRD* |
Ga0164301_102688623 | 3300012960 | Soil | ALQPDLSLSHVESNTIYADPADRARFREGRVKAGMTCH* |
Ga0164307_106879102 | 3300012987 | Soil | ESLMQTLTLQPDLSSDHVVNNTVYVNSSDRSRFLLGLQKAGLKH* |
Ga0164305_103843392 | 3300012989 | Soil | EALAHTLTLQPDLSSAHVENNTVYANPADRSRFLEGLRKAGLKN* |
Ga0157369_113125922 | 3300013105 | Corn Rhizosphere | LGLLGRVDEAKDALAHTLTLQPDLSSAHVEINTVYANPEDRARFLEGLRKAGLKN* |
Ga0157374_107422281 | 3300013296 | Miscanthus Rhizosphere | LALQPDLSSAHVTHDTVFVNPKDRARFLQGLLNAGLKN* |
Ga0157376_109040702 | 3300014969 | Miscanthus Rhizosphere | PDLSSAHVTHDTVFVNPNDRERFLQGLRNAGLKN* |
Ga0173483_100420871 | 3300015077 | Soil | AAKVEEANAALEQTLMLQPDLSLDHVESNNIYADPAERARFREGLVKAGMTCH* |
Ga0173483_107136792 | 3300015077 | Soil | IDEAKDALAHTLTLQPDLASAHVEMNTVYANPQERSRFLEGLRKAGLKN* |
Ga0173483_109275782 | 3300015077 | Soil | GREDEARAALARTLALQPDLSIEHVETNTVYANAADRARFRDGLRKAGLEN* |
Ga0132258_106042826 | 3300015371 | Arabidopsis Rhizosphere | GRIDEAKAALAHTLELSPDFSLDHVEKNTVYADPADRARFLEGLRRAGLKS* |
Ga0132255_1035005852 | 3300015374 | Arabidopsis Rhizosphere | RAGTLTLQPDLSISHVEINAVYADPADRLRFREGLRKAGLEK* |
Ga0182032_101306701 | 3300016357 | Soil | MQPDLSSAHVADNTVYADPADRSRFLEGLRKAGLKD |
Ga0182037_107067983 | 3300016404 | Soil | HTLTMQPDLSSAHVADNTVYADPADRSRFLEGLRKAGLKD |
Ga0187767_100140231 | 3300017999 | Tropical Peatland | RLDEAKAALEQTRKLQPDLSSAHVVNNTVYVNAADRNRFLEGLRKAGLKD |
Ga0184611_12214502 | 3300018067 | Groundwater Sediment | GKIDDAKEALLRTLALQPDFSSAHVANNTVFAKPDDRARFLLGLRRAGLKD |
Ga0184640_102761451 | 3300018074 | Groundwater Sediment | AALARTLALQPDLSIDHVETNTVYANAADRARFRDGLRKAGLEN |
Ga0066662_104373961 | 3300018468 | Grasslands Soil | LAQTLTLQPDLALAHVENNNIYADPTDRERFREGLLKAGLNR |
Ga0190270_100292531 | 3300018469 | Soil | LTLQPDLSGDHVEKNTVFANPSDRSRFLLGLRNAGLKG |
Ga0190270_130602252 | 3300018469 | Soil | AKQALAHTLTLQPDLSGDHVEKNTVFANPSDRSRFLLGLRNAGLKG |
Ga0190274_100593101 | 3300018476 | Soil | EAKAALAQTLKLQPDLSLNHVESNTIYADPADRARFREGLLKAGLDR |
Ga0190271_126365052 | 3300018481 | Soil | WRLLTVSLGLLGNVDEAKAALAQTLKLQPDLSLGHVESNTIYADPADRARFREGLLKAGLDR |
Ga0190273_107056193 | 3300018920 | Soil | ALAHTLTLQPDLSGDHVEKNTVFANPSDRSRFLLGLRNAGLKG |
Ga0173479_106083761 | 3300019362 | Soil | RLDEAREALAHTLTLQPDLASAHVENNTVYANPADRSRFLEGLRKAGLRN |
Ga0193727_10690802 | 3300019886 | Soil | RIDEAEEALAHTLTLQPDLSGAHVVNDTVFANPADRSRFLEGLRKAGLKA |
Ga0193697_11164312 | 3300020005 | Soil | AHTLKLQPDLSIDHVEKNTVYADPADRSRFLEGLRKAGLKG |
Ga0247800_10697112 | 3300023263 | Soil | DDAREALARAQMLQPDLSSAQVESNTVYANPAERSRFIEGLRQAGLRH |
Ga0247784_11156791 | 3300023270 | Plant Litter | RTLALQPDLSIEHVETNTVYANAADRARFRDGLRKAGLEN |
Ga0207688_103889921 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | HTLALSPDFSLDHVEKNTVYADPADRARFLEGLRRAGLKS |
Ga0207645_108279421 | 3300025907 | Miscanthus Rhizosphere | DEAKAALAHTLTLQPDLSGDHVETNTVFADPADRARFLEGLRRAGLKS |
Ga0207650_105071822 | 3300025925 | Switchgrass Rhizosphere | DEAREALARTLALQPDLSSAHVTHDTVFVNPKDRARFLQGLLNAGLKN |
Ga0207659_113164701 | 3300025926 | Miscanthus Rhizosphere | EAGTALVQTLTLQPDLSLDHVESNNIYADPADRARFREGLLRAGLNR |
Ga0207664_110913582 | 3300025929 | Agricultural Soil | MTVSLGLLGRVEEAREALAHTLTMQPDLSSAHVTNDTVYADPADRARFLEGLRKAG |
Ga0207670_103567452 | 3300025936 | Switchgrass Rhizosphere | AKAALAHTLTLQPDLSSAHVEINTVYANPEDRARFLEGLRKAGLKN |
Ga0207691_101736254 | 3300025940 | Miscanthus Rhizosphere | IDEAKAALARTLELSPDFSLDHVEKNTVYADPADRARFLEGLRKAGLGG |
Ga0207679_104640421 | 3300025945 | Corn Rhizosphere | EAREALARTLALQPDLSSAHVTHDTVFVNPNDRERFLQGLLNAGLKN |
Ga0207679_108539662 | 3300025945 | Corn Rhizosphere | LALQPDLSIEHVETNTVYANAADRARFRDGLRKAGLEN |
Ga0207667_117092231 | 3300025949 | Corn Rhizosphere | GKLDEAREALAHAQMLQPDISSAQVESNTVYANPAERCRLIEGLRKAGLRH |
Ga0210068_10357821 | 3300025953 | Natural And Restored Wetlands | QRHDRAQALAHARSLQPDLSLNHVEKNTVYVDPADRARFLQGLRNAGLQD |
Ga0207668_108828681 | 3300025972 | Switchgrass Rhizosphere | KAALARTLELSPDFSLDHVEKNTIYADPADRARFLEGLRKAGLGG |
Ga0207668_111243322 | 3300025972 | Switchgrass Rhizosphere | RTLALQPDLSSAHVTHDTVFVNPNDRERFLQGLLNAGLKN |
Ga0207708_108069621 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | IDEAKAALARTLELSPDFSLDHVEKNTIYADPADRARFLEGLRKAGLGG |
Ga0207702_105785712 | 3300026078 | Corn Rhizosphere | KAALTQTLTLQPDLSLAHVENNNIYADPADRERFRGGLLKAGLTR |
Ga0207676_107560113 | 3300026095 | Switchgrass Rhizosphere | LALQPDLSSDHVVNNTVYVNSSDRSRFLLGLQKAGLKH |
Ga0257146_10387361 | 3300026374 | Soil | LQPDLSSAHVEINTVYANPEDRSRFLEGLRKAGLKN |
Ga0207982_10019982 | 3300026886 | Soil | GLLGRVDEAKDALAHTLTLQPDLSSAHVEINTVYANPEDRARFLEGLRKAGLKN |
Ga0208890_10427112 | 3300027523 | Soil | VDEAKAALAHTLTLQPDLSSAHVEINTVYANPEDRARFLEGLRKAGLKN |
Ga0207428_102871951 | 3300027907 | Populus Rhizosphere | ALAHTLTLQPDLSSAHVEINTVYANPEDRARFLEGLRKAGLKN |
Ga0209382_100495781 | 3300027909 | Populus Rhizosphere | RTLALQPDLSSAHVANNTVFANPDDRARFLLGLQRAGLKD |
Ga0209382_112611802 | 3300027909 | Populus Rhizosphere | ALVRTLTMQPDLSSAHVANDTVYSDPDVRARFLEGLRKAGLQS |
Ga0209583_101141923 | 3300027910 | Watersheds | LTLQPDLSSDHVANNTVYTNESDRSRFLLGLQKAGLRQ |
Ga0307321_10706542 | 3300028704 | Soil | REDEARAALARTLALQPDLSIDHVETNTVYANAADRARFRDGLRKAGLEN |
Ga0307295_100426412 | 3300028708 | Soil | EAGEALSRTLALQPDLSSAHVVHDTVFVNPNDRARFLLGLQNAGLKD |
Ga0307293_100768781 | 3300028711 | Soil | SLGMLGKLDEAREALAHAQMLQPDLSSAHVESNTVYANAAERSRFIEGLRKAGLRH |
Ga0307285_101400012 | 3300028712 | Soil | LALLGREDEARAALARTLALQPDLSIDHVETNTVYANAADRARFRDGLRKAGLEN |
Ga0307280_100198051 | 3300028768 | Soil | LARTLALQPDLSSAHVVHDTVFVNPNDRARFLLGLQNAGLKD |
Ga0307306_100355512 | 3300028782 | Soil | IDEAKEALAHTLTLQPDLSAAHVANDTVFANPADRSRFLEGLRKAGLKA |
Ga0307290_100514891 | 3300028791 | Soil | KEALAHTLTLQPDLSAAHVANDTVFANPADRSRFLEGLRKAGLKA |
Ga0307287_101860431 | 3300028796 | Soil | KLDEAREALAHAQMLQPDLSSAHVESNTVYANAAERSRFIEGLRKAGLRH |
Ga0307287_103636321 | 3300028796 | Soil | AREALSSTLALQPDFSSAHVADNTVFANSDDRARFLLGLRRAGLKD |
Ga0247825_107785611 | 3300028812 | Soil | GLLDRIDEAKQALAHTLTLQPDLSSAHVEKNTVFAELSDRNRFLLGLRKAGIKE |
Ga0307302_106136022 | 3300028814 | Soil | ELVHTLRLQPDLSSAHVEHDTVYTDPADRSRFLLGLRKAGLMN |
Ga0308196_10495612 | 3300030989 | Soil | DEAEEALAHTLTLQPDLSGAHVVNDTVFANPADRSRFLEGLRKAGLKN |
Ga0307500_100107881 | 3300031198 | Soil | GKIDEARESLVQTLTLQPDLSSDHVVNNTVYVNSSDRSRFLLGLQKAGLKH |
Ga0307505_106522582 | 3300031455 | Soil | RESLMQTLTLQPDLSSDHVANNTVYVNSSDRSRFLLGLQKAGLKH |
Ga0170818_1111954001 | 3300031474 | Forest Soil | DEAEEALAHTLTLQPDLSGAHVVNDTVFANPADRSRFLEGLRKAGLKA |
Ga0307468_1012054351 | 3300031740 | Hardwood Forest Soil | HAGAWRLLTVSLALLGKVEEAKAALVQTLILQPDLSLDHVENNNIYAEPADRARFREGLVKAGLNR |
Ga0318521_100881662 | 3300031770 | Soil | RTLALQPDLSSAHVTNDTVFVNSNDRARFLQGLLNAGLKN |
Ga0310892_107105192 | 3300031858 | Soil | ELSPDFSLDHVEKNTIYADPADRARFLEGLRKAGLGG |
Ga0310897_104256682 | 3300032003 | Soil | ALAHTLTLQPDLSLSHVEKNTVFANPSDRSRFLLGLQRAGLKD |
Ga0307470_102529353 | 3300032174 | Hardwood Forest Soil | ALVRTLTMQPDLSNAHVENDTVYSDPDVRARFLEGLRKAGLQS |
Ga0326726_125001231 | 3300033433 | Peat Soil | TLALQPDLSSDHVANNTVYADASDRFRFLLGLQKAGLRD |
Ga0326723_0184148_754_921 | 3300034090 | Peat Soil | LGLLGKIDEAKEALAHALTLQPDLSSAHVENNTVFVNPADRARFLEGLRKAGLKD |
⦗Top⦘ |