NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F044609

Metagenome Family F044609

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044609
Family Type Metagenome
Number of Sequences 154
Average Sequence Length 42 residues
Representative Sequence HANFANPAFTDVESIGTTNSPFGKITSTVGTPRLIQFSLRYSF
Number of Associated Samples 134
Number of Associated Scaffolds 154

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.32 %
% of genes near scaffold ends (potentially truncated) 96.75 %
% of genes from short scaffolds (< 2000 bps) 82.47 %
Associated GOLD sequencing projects 127
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.403 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(14.935 % of family members)
Environment Ontology (ENVO) Unclassified
(31.169 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.597 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 8.45%    Coil/Unstructured: 91.55%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 154 Family Scaffolds
PF00155Aminotran_1_2 32.47
PF02627CMD 27.27
PF07883Cupin_2 2.60
PF12867DinB_2 1.95
PF00156Pribosyltran 1.30
PF13365Trypsin_2 1.30
PF07805Obsolete Pfam Family 0.65
PF12787EcsC 0.65
PF07238PilZ 0.65
PF01842ACT 0.65
PF08388GIIM 0.65
PF08899DUF1844 0.65
PF02668TauD 0.65
PF00990GGDEF 0.65
PF00069Pkinase 0.65
PF02518HATPase_c 0.65
PF02416TatA_B_E 0.65
PF14667Polysacc_synt_C 0.65
PF13185GAF_2 0.65
PF01844HNH 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 154 Family Scaffolds
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 27.27
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 27.27
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.60
COG1826Twin-arginine protein secretion pathway components TatA and TatBIntracellular trafficking, secretion, and vesicular transport [U] 0.65
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 0.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.40 %
UnclassifiedrootN/A2.60 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004092|Ga0062389_102509046All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae684Open in IMG/M
3300004092|Ga0062389_104993574All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae500Open in IMG/M
3300004635|Ga0062388_100059231All Organisms → cellular organisms → Bacteria2546Open in IMG/M
3300005174|Ga0066680_10860455All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum541Open in IMG/M
3300005175|Ga0066673_10535234All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300005179|Ga0066684_10012295All Organisms → cellular organisms → Bacteria4195Open in IMG/M
3300005541|Ga0070733_10018755All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4312Open in IMG/M
3300005548|Ga0070665_100037460All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4877Open in IMG/M
3300005559|Ga0066700_10010769All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4743Open in IMG/M
3300005561|Ga0066699_10265023All Organisms → cellular organisms → Bacteria1216Open in IMG/M
3300005586|Ga0066691_10394340All Organisms → cellular organisms → Bacteria → Acidobacteria822Open in IMG/M
3300005842|Ga0068858_101497876All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300005995|Ga0066790_10205695All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae841Open in IMG/M
3300006028|Ga0070717_10727416All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300006041|Ga0075023_100375441All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300006176|Ga0070765_100285956All Organisms → cellular organisms → Bacteria1521Open in IMG/M
3300006176|Ga0070765_101743138All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300006852|Ga0075433_11918613All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300006871|Ga0075434_100836307All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300006903|Ga0075426_10777821All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068719Open in IMG/M
3300006914|Ga0075436_101560226All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300006954|Ga0079219_10054720All Organisms → cellular organisms → Bacteria1740Open in IMG/M
3300007255|Ga0099791_10646320All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300009038|Ga0099829_11491273All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300009089|Ga0099828_10533625All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300009093|Ga0105240_12712267All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300009520|Ga0116214_1375167All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300009661|Ga0105858_1236026All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300009698|Ga0116216_10030085All Organisms → cellular organisms → Bacteria → Acidobacteria3384Open in IMG/M
3300010047|Ga0126382_12140565All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300010048|Ga0126373_13027659All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300010321|Ga0134067_10042879All Organisms → cellular organisms → Bacteria1437Open in IMG/M
3300010343|Ga0074044_10562388All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300010358|Ga0126370_11181907All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300010360|Ga0126372_12915090All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300010361|Ga0126378_10052063All Organisms → cellular organisms → Bacteria3821Open in IMG/M
3300010366|Ga0126379_11091838All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300010376|Ga0126381_100133638All Organisms → cellular organisms → Bacteria3233Open in IMG/M
3300010376|Ga0126381_100161009All Organisms → cellular organisms → Bacteria2959Open in IMG/M
3300010376|Ga0126381_103545303All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300010376|Ga0126381_104092889All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300010398|Ga0126383_12083145All Organisms → cellular organisms → Bacteria → Acidobacteria654Open in IMG/M
3300012200|Ga0137382_10624461All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium770Open in IMG/M
3300012205|Ga0137362_11729241All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis512Open in IMG/M
3300012207|Ga0137381_10208587All Organisms → cellular organisms → Bacteria1694Open in IMG/M
3300012211|Ga0137377_10047275All Organisms → cellular organisms → Bacteria3964Open in IMG/M
3300012285|Ga0137370_10850590All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300012363|Ga0137390_10650952All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1018Open in IMG/M
3300012532|Ga0137373_10480513All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300012918|Ga0137396_10525628All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium876Open in IMG/M
3300012923|Ga0137359_10764097All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300012924|Ga0137413_10921475All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300012925|Ga0137419_10977671All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300012925|Ga0137419_11213702All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300012927|Ga0137416_10662380All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300012927|Ga0137416_12147545All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300012931|Ga0153915_12435129All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300012957|Ga0164303_10793745Not Available650Open in IMG/M
3300012971|Ga0126369_10079743All Organisms → cellular organisms → Bacteria2900Open in IMG/M
3300012971|Ga0126369_10088253All Organisms → cellular organisms → Bacteria2772Open in IMG/M
3300012977|Ga0134087_10256261All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300012986|Ga0164304_11863953All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300013306|Ga0163162_11281640All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300013306|Ga0163162_11501722All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300015193|Ga0167668_1089363All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300015241|Ga0137418_10434280All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300015373|Ga0132257_100075023All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3836Open in IMG/M
3300016270|Ga0182036_10054186All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2535Open in IMG/M
3300016270|Ga0182036_11521035All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300016357|Ga0182032_11667144All Organisms → cellular organisms → Bacteria → Proteobacteria556Open in IMG/M
3300016371|Ga0182034_10003104All Organisms → cellular organisms → Bacteria8542Open in IMG/M
3300017823|Ga0187818_10444012All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300017936|Ga0187821_10310007All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300017955|Ga0187817_10697835All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300017973|Ga0187780_10048790All Organisms → cellular organisms → Bacteria2941Open in IMG/M
3300018007|Ga0187805_10622615All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300018058|Ga0187766_10940943All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300018085|Ga0187772_11030943All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300018085|Ga0187772_11360575All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300018433|Ga0066667_10053745All Organisms → cellular organisms → Bacteria2448Open in IMG/M
3300018433|Ga0066667_11156963All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300020199|Ga0179592_10370454All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300020579|Ga0210407_10131065All Organisms → cellular organisms → Bacteria1922Open in IMG/M
3300020580|Ga0210403_10542724All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300020583|Ga0210401_10669666All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300021046|Ga0215015_10014607All Organisms → cellular organisms → Bacteria1729Open in IMG/M
3300021168|Ga0210406_10445796All Organisms → cellular organisms → Bacteria1031Open in IMG/M
3300021171|Ga0210405_10992575All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300021180|Ga0210396_11670570All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300021402|Ga0210385_10128547All Organisms → cellular organisms → Bacteria1795Open in IMG/M
3300021405|Ga0210387_10652043All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300021420|Ga0210394_10723385All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300021475|Ga0210392_10296081All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300021478|Ga0210402_10136384All Organisms → cellular organisms → Bacteria2228Open in IMG/M
3300021478|Ga0210402_10182548All Organisms → cellular organisms → Bacteria1923Open in IMG/M
3300021478|Ga0210402_11528280All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300021479|Ga0210410_11191951All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300024224|Ga0247673_1045241All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300024284|Ga0247671_1080757All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300024287|Ga0247690_1046787All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300025910|Ga0207684_10990505All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300025922|Ga0207646_11731975All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300025934|Ga0207686_10465793All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300026475|Ga0257147_1027004All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300026523|Ga0209808_1010458All Organisms → cellular organisms → Bacteria4701Open in IMG/M
3300026542|Ga0209805_1100348All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300026542|Ga0209805_1327663All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300026557|Ga0179587_10508940All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium790Open in IMG/M
3300026941|Ga0207741_1011778All Organisms → cellular organisms → Bacteria → Acidobacteria1005Open in IMG/M
3300027480|Ga0208993_1092730All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300027737|Ga0209038_10070053All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300027748|Ga0209689_1014726All Organisms → cellular organisms → Bacteria → Acidobacteria5014Open in IMG/M
3300027824|Ga0209040_10439171All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300027825|Ga0209039_10292470All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300027855|Ga0209693_10120296All Organisms → cellular organisms → Bacteria1300Open in IMG/M
3300027905|Ga0209415_10812159All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300028646|Ga0302159_10036606All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300028871|Ga0302230_10119571All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300029990|Ga0311336_10665214All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300030043|Ga0302306_10073396All Organisms → cellular organisms → Bacteria1334Open in IMG/M
3300031128|Ga0170823_13742481All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300031231|Ga0170824_124408556All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300031474|Ga0170818_115507571All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300031564|Ga0318573_10640809All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300031708|Ga0310686_104062642All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300031708|Ga0310686_118751214All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sanguinis662Open in IMG/M
3300031715|Ga0307476_10550804All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300031716|Ga0310813_12156843All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300031753|Ga0307477_10445651All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300031754|Ga0307475_11149053All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300031771|Ga0318546_10343017All Organisms → cellular organisms → Bacteria1039Open in IMG/M
3300031796|Ga0318576_10215908All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300031820|Ga0307473_10248147All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300031823|Ga0307478_10622442All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300031962|Ga0307479_10575450All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300032051|Ga0318532_10313269All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300032094|Ga0318540_10574557All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300032174|Ga0307470_10437039All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300032174|Ga0307470_10880367All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300032174|Ga0307470_11803315All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300032180|Ga0307471_100069258All Organisms → cellular organisms → Bacteria3033Open in IMG/M
3300032180|Ga0307471_100144987All Organisms → cellular organisms → Bacteria2271Open in IMG/M
3300032180|Ga0307471_102579787All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300032756|Ga0315742_12002237All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300032770|Ga0335085_12291654All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300032782|Ga0335082_11228002Not Available617Open in IMG/M
3300032783|Ga0335079_11112911All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300032829|Ga0335070_10028554All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia6378Open in IMG/M
3300032892|Ga0335081_10293550All Organisms → cellular organisms → Bacteria2159Open in IMG/M
3300032955|Ga0335076_10035661All Organisms → cellular organisms → Bacteria4985Open in IMG/M
3300033134|Ga0335073_11860728All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300033158|Ga0335077_11208891All Organisms → cellular organisms → Bacteria739Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.99%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.44%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil7.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.49%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.19%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.90%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.25%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.60%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.60%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.60%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.95%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.95%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.30%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.30%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.30%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.30%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.30%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.65%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.65%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.65%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.65%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.65%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.65%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009661Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015193Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300024224Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14EnvironmentalOpen in IMG/M
3300024284Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12EnvironmentalOpen in IMG/M
3300024287Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026475Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-AEnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026941Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 39 (SPAdes)EnvironmentalOpen in IMG/M
3300027480Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_2EnvironmentalOpen in IMG/M
3300028871Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1EnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062389_10250904623300004092Bog Forest SoilWNHVNFANPAVTDVESISLPNSPFGKITSDLGTPRLIQFSLRYTF*
Ga0062389_10499357423300004092Bog Forest SoilWNHVNFANPAVTDVESISLPNSPFGKITSDLGTPRLIQFSLRYMF*
Ga0062388_10005923133300004635Bog Forest SoilWNHANFGNPSVTDVETIGGPSSPFGKITSTVGTPRLIQFSLRYSF*
Ga0066680_1086045513300005174SoilWNHTNFGNPSVTDIEAGGAFGKIVQTVGTPRLIQFSLRWAF*
Ga0066673_1053523423300005175SoilFANPGNGTATDVEIPGSFGRIFSTVGTPRLIQFSLRYAF*
Ga0066684_1001229563300005179SoilIWNHTNFANPAINDVENPGAFGRIFSTVGTPRLIQFSLRYAF*
Ga0070733_1001875563300005541Surface SoilFASPAFTDVESPSNFGQITNTTGTPRLIQFSLRYAF*
Ga0070665_10003746013300005548Switchgrass RhizosphereANFANPVSTDVENPGSFGFITSTKGVPRLIQFSLRYSF*
Ga0066700_1001076913300005559SoilPTVTDVETIGGANSPFGKITSTVGTPRLVQFSLRYAF*
Ga0066699_1026502333300005561SoilNIWNHANFANPASTDVQNPGAFGKIVSTVGTPRLIQFSLRYAF*
Ga0066691_1039434023300005586SoilNHTNFGNPSVTDIEAGGAFGKIVQTVGTPRLIQFSLRWAF*
Ga0068858_10149787613300005842Switchgrass RhizosphereHANFANPAINDVETITHDASGNPTSGGPFGKIFSTLGTPRLIQFSLKLAF*
Ga0066790_1020569513300005995SoilNFANPSSTEISNPAFGKIFSTVGTPRLIQFSLRYAF*
Ga0070717_1072741613300006028Corn, Switchgrass And Miscanthus RhizosphereTADFFNVWNHTNFANPSVTDVEAGSAFGKIIGTVGTPRLIQFSLRWAF*
Ga0075023_10037544113300006041WatershedsFNHPSFASPFFVDVENPKSLGKITNTVGTPRLIQFSLRYSY*
Ga0070765_10028595623300006176SoilNFGNPAFTDVEGGNFGKITSTVGTPRLIQFSLRYAF*
Ga0070765_10174313813300006176SoilANPSFLDVESIGTTNSPFGKITSTVGTPRLIQFSLRYSF*
Ga0075433_1191861313300006852Populus RhizosphereNPAINDVEVGTGPGSPFGKIFSTVGTPRLIQFSLRYAF*
Ga0075434_10083630733300006871Populus RhizosphereNPVINDVEVGTGPGSPFGKIFSAVGTPRLIQFSLRYAF*
Ga0075426_1077782123300006903Populus RhizosphereFANPAFTDVEVGSAFGKIFNSTGTPRLIQFSLRWAF*
Ga0075436_10156022623300006914Populus RhizosphereNPAINDVENPGAFGQIISTVGTPRLIQFSLRYAF*
Ga0079219_1005472013300006954Agricultural SoilNHPNFGNPVQTDVSFPAGSFALINSTVGTPRLIQFQLRYSF*
Ga0099791_1064632013300007255Vadose Zone SoilILNHANFANPVINDVETIGVPNSPFGKIFSTVGTPRLIQFSLRYSF*
Ga0099829_1149127323300009038Vadose Zone SoilNPAVNDVETIGVPNSPFGKITSTVGTPRLIQFSLRYAF*
Ga0099828_1053362523300009089Vadose Zone SoilDNPTVTDVETIGTPNSPFGKITGTVGTPRLIQFSLRYAF*
Ga0105240_1271226723300009093Corn RhizosphereNFASPAFNDVENPGAFGKIFSTVGTPRLIQFQLRYSF*
Ga0116214_137516723300009520Peatlands SoilAVTDVETIGLPNSPFGKIISDRGVPRLIQFSLRYAF*
Ga0105858_123602623300009661Permafrost SoilHANFANPSVTDLESIGTTNSPFGKITSTIGTPRLIQFSLRYAF*
Ga0116216_1003008513300009698Peatlands SoilIWNHANFGNPAITDVETTGGGTLLQSQTPFGKITQTVGTPRLIQFSLRWAF*
Ga0126382_1214056523300010047Tropical Forest SoilFNIWNHANFGNPAVTDVENPSALGKIISTVGTPRLIQFSLRYAF*
Ga0126373_1302765923300010048Tropical Forest SoilHANFASPAQSDVENASTFSKITQTVGTPRLIQFSLRYAF*
Ga0134067_1004287933300010321Grasslands SoilWNHANFGNPAQADVENPSTFGKITQTVGTPRLIQFSLRWAF*
Ga0074044_1056238813300010343Bog Forest SoilFGNPQITDVEAISTGAFGKINTTLGQPRLIQFSLRYSF*
Ga0126370_1118190723300010358Tropical Forest SoilVEIIGANPATSPFGKIFSTVGTPRLIQFALRYAF*
Ga0126372_1291509013300010360Tropical Forest SoilFFNIWNHANFANPAFTDVEMDSAFGKIFNSTRTPRLIQFSLR*
Ga0126378_1005206313300010361Tropical Forest SoilPNFANPASTDFENQGAFAKIVSTLGNPRVIQFSLRYAF*
Ga0126379_1109183813300010366Tropical Forest SoilHANFGNPTVTDVETIGLPNSPFGKITSTLGTPRLIQFSLRLAF*
Ga0126381_10013363813300010376Tropical Forest SoilFGNPTVTDVETIGGANSPFGKITSTVGTPRLIQFSLRYAY*
Ga0126381_10016100943300010376Tropical Forest SoilVTDVETIGLTNSPFGRITSTVGTPRLIQFSLRLAF*
Ga0126381_10354530313300010376Tropical Forest SoilMRFTEDFFNLWNHANFANPAFTDVEVGSASGKIFNSTGTPRLIQSSLRRAF*
Ga0126381_10409288913300010376Tropical Forest SoilANFANPAFTDVEVGSAFGKIFNSTGTPRLIQFSLRWAF*
Ga0126383_1208314523300010398Tropical Forest SoilALNFLNHANFANPSITDVETINAVDPSASPFGKIFSTVGTPRLIQFSLRLSF*
Ga0137382_1062446123300012200Vadose Zone SoilFNIWNHANFANPAINDVENPGPFGKIFSTVGTPRLIQFSLRYAF*
Ga0137362_1172924113300012205Vadose Zone SoilDFFNIWNHTNFGNPAANDVESIGVPNSPFGKIISTVGTPRLIQFSLRYAF*
Ga0137381_1020858713300012207Vadose Zone SoilNFANPAQADVENPATFGKITQTVGTPRLIQFSIRWAF*
Ga0137377_1004727553300012211Vadose Zone SoilFANPAINDVETIGVPNSPFGKIFSTVGTPRLIQFSLRYSF*
Ga0137370_1085059023300012285Vadose Zone SoilNFANPSINDVETITHDGSGNPTSDGPFGKIFSTVGTPRLIQFSLRYSF*
Ga0137390_1065095233300012363Vadose Zone SoilFSNPSATDVEAIGLPNSPFGKITSALGTPRLIQFSLRYSF*
Ga0137373_1048051313300012532Vadose Zone SoilHANFGNPTQTDVSFQEGSFARINSTVGTPRLIQFQLRYAF*
Ga0137396_1052562813300012918Vadose Zone SoilANFANPAFNDVENPGPFGKIFSTVGTPSLIQFSLRYAF*
Ga0137359_1076409713300012923Vadose Zone SoilNIWNHANFASPASNDVEIPGAFGKINSTVGTPRLIQLSLRYAF*
Ga0137413_1092147513300012924Vadose Zone SoilNIWNHANFANPPINDVETITHDALNNPTKDGPFGKIFSTVGTPRLIQFSLRLAF*
Ga0137419_1097767113300012925Vadose Zone SoilNPAINDVETIGVPNSPFGKIFSTVGTPRLIQFSLRYSF*
Ga0137419_1121370213300012925Vadose Zone SoilNHVNFANPAINDVEVGTGPNSPFGKIFSTVGTPRLIQFSLRYAF*
Ga0137416_1066238013300012927Vadose Zone SoilNFANPAINDVENLGAFGQIISTVGTPRLIQFSLRYAF*
Ga0137416_1214754513300012927Vadose Zone SoilNHANFANPALTDIGAGAGFGKIFSTTGTPRLIQFSLRLAF*
Ga0153915_1243512913300012931Freshwater WetlandsHVNFSNPTFTDVESPANFGYITTTKGTPRLIQFSLRWAF*
Ga0164303_1079374513300012957SoilNPVSTDVENPGAFGFITSTRGVPRLIQFSLRYSF*
Ga0126369_1007974353300012971Tropical Forest SoilANPSITDVETIGVPNSPFGQIFATTGTPRLIQFSLRLAF*
Ga0126369_1008825313300012971Tropical Forest SoilDFFNVWNHVNFANPAINDVQVDTGAGSPFGKIFSTVGTPRLIQFSLRYAF*
Ga0134087_1025626113300012977Grasslands SoilVNFANPSINDVETITHDNLGNPTSDGPFGKIFSTVGTPRLIQFSLRYTF*
Ga0164304_1186395313300012986SoilFASPAFTDVESPGNFGQITNTKGTPRLIQLSLRWAF*
Ga0163162_1128164013300013306Switchgrass RhizosphereSPAFNDVENPGAFGKIFSTVGTPRLIQFQLRYSF*
Ga0163162_1150172213300013306Switchgrass RhizosphereNHANFANPAVTDVENPAAFGRIFSTVGTPRLIQFSLRYAF*
Ga0167668_108936323300015193Glacier Forefield SoilHVNFAGPAVTDVENPGAFGKIVSTVGTPRLIQFSLRYAF*
Ga0137418_1043428013300015241Vadose Zone SoilNHANFASPTSADVENPGAFGKINSTVGTPRLIQLSLRYAF*
Ga0132257_10007502313300015373Arabidopsis RhizosphereHTNFGNPVQNDVSFSAGSFALINSTVGTPRLIQFQLRYSF*
Ga0182036_1005418613300016270SoilIWNHANFANPPITDVETIGPNSPFGQIFSTTGTPRLIQFSLRFGF
Ga0182036_1152103523300016270SoilTDFFNVWNHANFANPPINDVETISHDAAGNPTNDGPFGKIFSTVGTPGLIQFSLRLAF
Ga0182032_1166714423300016357SoilNHANFANPPITDVETIGPNSPFGQIFSTTGTPRLIQFSLRFGF
Ga0182034_1000310413300016371SoilANFANPVATDVESPGNFGVITSTKGVPRLIQFSLRYSF
Ga0187818_1044401223300017823Freshwater SedimentFNIWNHANFANPPLTDVETITHDAAGNPTNAGPFGKIFSTLGTPRLIQFSLRLAF
Ga0187821_1031000713300017936Freshwater SedimentHASFANPAVTDVENPGAFGKILNTVGTPRLIQFSLRWAF
Ga0187817_1069783513300017955Freshwater SedimentTDMFNMWNHANFANPAVTDVETISEPNSPFGKIVSSRGVPRLIQFSLRYAF
Ga0187780_1004879033300017973Tropical PeatlandLIANFFNIWNHANFANPSITDVETFNPSNPSASPFGKIFSAVGNPRLIQFSLRLAF
Ga0187805_1062261513300018007Freshwater SedimentNFANPAITDVETINLANPSASPFGKIFSTTGTPRLIQFSLRLAF
Ga0187766_1094094313300018058Tropical PeatlandANPSITDVETINPNNPSASPFGKIFSTVGNPRLIQFSLRLAF
Ga0187772_1103094313300018085Tropical PeatlandITDVETISEPNSPFGKIFSTTGTPRLIQFSLRLAF
Ga0187772_1136057513300018085Tropical PeatlandTDFFNIWNHANFANPAVTDVETIPLPNSPFGKIVSDRGVPRLIQFSLRYAF
Ga0066667_1005374533300018433Grasslands SoilNHANFGNPTVNDAETIPLSNSPFGKIISTVGTPRLIQFSLRYAF
Ga0066667_1115696313300018433Grasslands SoilQNMRFTVDFFNIWNHANFASPSSNDVENPGAFGKIVSTVGNPRLIQLSLRWAF
Ga0179592_1037045413300020199Vadose Zone SoilWNHANFANPSINDVETIGINPATSPFGKIFSTVGTPRLIQFSLRYAF
Ga0210407_1013106533300020579SoilFANPSVTDVQNPAAFGRIFATVGTPRLIQFSLRYAF
Ga0210403_1054272423300020580SoilTTDFFNIWNHANFANPSLTDINSGAGFGKIFSTVGTPRLIQFSLRLTF
Ga0210401_1066966623300020583SoilHANFGNPAFTDVEGGNFGKITSTVGTPRLIQFSLRYAF
Ga0215015_1001460743300021046SoilLGDVYKRQIWNHANFGNPSVNDVETIGVANSPFGKIISTVGTPRLIQFSLRYAF
Ga0210406_1044579623300021168SoilHVNFANPVSTDVESPGNFGLITSAKGVPRLIQFSLRYSF
Ga0210405_1099257523300021171SoilAINDVETIGGPGSPFGKIFSTVGTPRLIQFSLRLSF
Ga0210396_1167057013300021180SoilHANFANPAFTDVESIGTTNSPFGKITSTVGTPRLIQFSLRYSF
Ga0210385_1012854743300021402SoilFANPAFTDVEGGNFGKITSTVGAPRLIQFSLRYSF
Ga0210387_1065204333300021405SoilPSFLDVESIGTTNSPFGKITSTVGTPRLIQFSLRYSF
Ga0210394_1072338523300021420SoilNHVNFANPAVTDVESISLPNSPFGKITSDLGTPRLIQFSLRYMF
Ga0210392_1029608113300021475SoilNHTNFASPAFTDVESSSNFGQITSTKGTPRLIQFSLRYAF
Ga0210402_1013638413300021478SoilHANFANPQINDVETIGGPFGKIFSTVGTPRLIQFSLRLAF
Ga0210402_1018254813300021478SoilIFNHANFANPAINDVETITHDAGGNPTFGGPFGKIFSTVGTPRLIQFSLKLAF
Ga0210402_1152828023300021478SoilWNHANFANPSVTDVQNPAAFGRIFATVGTPRLIQFSLRYAF
Ga0210410_1119195113300021479SoilFASPAQADVENSSTFSRITQTVGTPRLIQFSLRYAF
Ga0247673_104524113300024224SoilWNHANFANPAFTDVEGGNFGKITSTVGTPRLIQFSLRYAF
Ga0247671_108075723300024284SoilHANFFNPAFTDVEGGNFGKITSTVGTSRLIQFSLRYAF
Ga0247690_104678723300024287SoilANFFNPAFTDVEGGNFGKITSTVGTSRLIQFSLRYAF
Ga0207684_1099050523300025910Corn, Switchgrass And Miscanthus RhizosphereNPAINDVETIGVPNSPFGKIFSTVGTPRLIQFSLRYSF
Ga0207646_1173197523300025922Corn, Switchgrass And Miscanthus RhizospherePAINDVETIGVPNSPFGKIFSTVGTPRLIQFSLRYSF
Ga0207686_1046579313300025934Miscanthus RhizosphereNPAINDVEVGSGPGSPFGRIFSTVGTPRLIQFSLRYSF
Ga0257147_102700423300026475SoilNPSGTDVESISLANSPFGKITSTLGTPRLIQFSLRYAF
Ga0209808_101045813300026523SoilANFANPGNGTATDVEIPGSFGRIFSTVGTPRLIQFSLRYAF
Ga0209806_102495143300026529SoilANPSINDVETITHDNLGNPTSDGPFGKIFSTVGTPRLIQFSLRYTF
Ga0209805_110034813300026542SoilNIWNHANFANPASTDVQNPGAFGKIVSTVGTPRLIQFSLRYAF
Ga0209805_132766313300026542SoilFNIWNHANFANPGNGTATDVEIPGSFGRIFSTVGTPRLIQFSLRYAF
Ga0179587_1050894013300026557Vadose Zone SoilNHANFANPAFNDVENPGPFGKIFSTVGTPRLIQFSLRYAF
Ga0207741_101177823300026941Tropical Forest SoilIWNHANFANPAITDVETIGPNSPFGQIFSTTGTPRLIQFSLRFGF
Ga0208993_109273023300027480Forest SoilWNHANFANPGNGTATDVEITGSFGRIFSTVGTPRLIQFSLRYAF
Ga0209038_1007005313300027737Bog Forest SoilPAVTDVETAGTPNSPFGKIVSTNGQPRLIQFSLRYSF
Ga0209689_101472673300027748SoilANFGNPTVTDVETIGGANSPFGKITSTVGTPRLVQFSLRYAF
Ga0209040_1043917113300027824Bog Forest SoilAASANFANPAFTDVEGGNFGRITSTVGAPRLIQFSLRYAF
Ga0209039_1029247013300027825Bog Forest SoilIWNHANFANPSINDVETIGPGSPFGKIFSTVGTPRLIQFSLRLAF
Ga0209693_1012029613300027855SoilFNMWNHANFGNPTVTDVETIGPNSPFGKITSTVGTPRLIQFSLRYSF
Ga0209415_1081215923300027905Peatlands SoilMWNHANFANPAVTDVETIALPNSPFGKIISSRGVPRLIQFSLRYAF
Ga0302159_1003660633300028646FenFNIWNHANFASPASNDVENPGPFGKIQSTVGTPRLIQFQLRYAF
Ga0302230_1011957113300028871PalsaGNPQVTDVETIGPDSPFGKINTTVGQPRLIQFSLRYSF
Ga0311336_1066521423300029990FenFTADFFNIWNHANFSSPSLNDVENPGAFGKIFSTVGTPRLVQLQLRYSF
Ga0302306_1007339613300030043PalsaFDIWNHPNFGNPQVTDVETIGPDSPFGKINTTVGQPRLIQFSLRYSF
Ga0170834_10773586913300031057Forest SoilFANPPINDVETITHDAGGNPTFGGPFGKIFSTVGTPRLIQFSLKLAF
Ga0170823_1374248123300031128Forest SoilSATDVEAIGLPNSPFGKITSALGTPRLIQFSLRYAF
Ga0170824_12440855613300031231Forest SoilWNHANFANPALTDIGAGSGFGKIFSTTGTPRLIQFSLRYAF
Ga0170818_11550757113300031474Forest SoilIWNHANFGNPSVNDVETIPLPNSPFGKITSTVGTPRLIQLSLRYAF
Ga0318573_1064080923300031564SoilHANFASPAQSDVENASTFSKITQTVGTPRLIQFSLRYAF
Ga0310686_10406264223300031708SoilNFGNPAFTDVEGGSFGKITSTVGTPRLIQFSLRYAF
Ga0310686_11875121413300031708SoilMRLFWSVFSSPAFVDVESQRNFGQITSTQGTPRLVQFAGRIAF
Ga0307476_1055080413300031715Hardwood Forest SoilANPVATDVESAGNFGVITSTKGVPRLIQFSLRYSF
Ga0310813_1215684313300031716SoilNQSSQTDVENPGAFGKITSTVGTPRLIQFSLRYAF
Ga0307477_1044565123300031753Hardwood Forest SoilWNHANFGNPAFTDVEGGNFGKITSTVGAPRLIQLSLRYAF
Ga0307475_1114905333300031754Hardwood Forest SoilIWNHANFANPTFTDISNPAFGKIFSTVGTPRLIQFSLRYAF
Ga0318546_1034301713300031771SoilHPNFGNPAVTDVETIGAPNSPFGKITSTVGTPRLIQFSLRLSF
Ga0318576_1021590833300031796SoilIWNHANFASPAQSDVENASTFSKITQTVGTPRLIQFSLRYAF
Ga0307473_1024814713300031820Hardwood Forest SoilDFFNIWNHVNFASPSLNDVENPAAFGKINSTVGTPRLIQLSLRYAF
Ga0307478_1062244213300031823Hardwood Forest SoilVWNHANFANPTFTDISNPAFGKIFSTVGTPRLIQFSLRYAF
Ga0307479_1057545033300031962Hardwood Forest SoilPNFGNPAVTDVETAGVTNSPFGKITSATGTPRLIQFSLRYAF
Ga0318532_1031326923300032051SoilIWNHTNFANPAINDVEVGTGPGSPFGKIFSTVGTPRLIQFSLRYAF
Ga0318540_1057455723300032094SoilIWNHANFANPAVNDVETIGTQNSPFGKITTTVGTSRLIQFSLRLAF
Ga0307470_1043703913300032174Hardwood Forest SoilPSINDVETIGTNPATSPFGKIFSTVGTPRLIQFSLRYAF
Ga0307470_1088036713300032174Hardwood Forest SoilANPAINDVETIGVPNSPFGKIFSTVGTPRLIQFSLRYSF
Ga0307470_1180331523300032174Hardwood Forest SoilNFGNPSSNDVENPGAFGKIVSTVGTPRLIQFQLRYAF
Ga0307471_10006925813300032180Hardwood Forest SoilNIWNHANFSNPASTDVESIPLSNSPFGKIISTVGTPRLIQFSLRYAF
Ga0307471_10014498713300032180Hardwood Forest SoilANFGNPSSNDVENPGAFGKIVSTVGTPRLIQFQLRYAF
Ga0307471_10257978713300032180Hardwood Forest SoilWNHANFGNPSVNDVETISLPNSPFGRITSTVGTPRLIQLSLRYAF
Ga0315742_1200223723300032756Forest SoilVNFGNPAFTDVEGGSFGKITSTVGTPRLIQFSLRYAF
Ga0335085_1229165423300032770SoilNHANFANPVSTDVESPGNFGFITSAKGVPRLIQFSLRYAF
Ga0335082_1122800223300032782SoilNHANFANPVATDVESPGNFGVITSTKGVPRLIQFSVRLSF
Ga0335079_1111291123300032783SoilSNPVATDVESPGNFGVITSTKGVPRLIQFSLRYAF
Ga0335070_1002855493300032829SoilTDVETINASDPSASPFGKIFSTVGTPRLIQFSLRLSF
Ga0335081_1029355013300032892SoilFANPAFTDVEVGSAFGKIFNSTGTPRLMQFSLRWAF
Ga0335076_1003566113300032955SoilITDVETLGEANSPFGKINSTVGNPRLIQFQLRYAF
Ga0335073_1186072813300033134SoilNFANPAVTDVETINLSDPAASPFGKIVSTVGNPRLIQFSLRYSF
Ga0335077_1120889113300033158SoilLWNHTNFSNPSGTDVESIGLANSPFGKITSTAGTPRLIQFSLRYAF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.