NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F044547

Metagenome Family F044547

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044547
Family Type Metagenome
Number of Sequences 154
Average Sequence Length 80 residues
Representative Sequence KLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQRFNKLGDIESIFRQIKAQKTGD
Number of Associated Samples 124
Number of Associated Scaffolds 154

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Archaea
% of genes with valid RBS motifs 1.32 %
% of genes near scaffold ends (potentially truncated) 95.45 %
% of genes from short scaffolds (< 2000 bps) 91.56 %
Associated GOLD sequencing projects 111
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (44.156 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(33.766 % of family members)
Environment Ontology (ENVO) Unclassified
(88.961 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(72.078 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.02%    β-sheet: 0.00%    Coil/Unstructured: 50.98%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 154 Family Scaffolds
PF03237Terminase_6N 17.53
PF03354TerL_ATPase 2.60
PF13456RVT_3 0.65
PF08423Rad51 0.65
PF08273Prim_Zn_Ribbon 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 154 Family Scaffolds
COG4626Phage terminase-like protein, large subunit, contains N-terminal HTH domainMobilome: prophages, transposons [X] 2.60
COG0468RecA/RadA recombinaseReplication, recombination and repair [L] 0.65
COG4643Uncharacterized domain associated with phage/plasmid primaseMobilome: prophages, transposons [X] 0.65

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.83 %
UnclassifiedrootN/A31.17 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000137|LP_F_10_SI03_10DRAFT_c1041875All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon636Open in IMG/M
3300000148|SI47jul10_100mDRAFT_c1044260All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon596Open in IMG/M
3300000152|LPjun08P12500mDRAFT_c1020606Not Available1061Open in IMG/M
3300000152|LPjun08P12500mDRAFT_c1054139Not Available547Open in IMG/M
3300000179|LPjun09P16500mDRAFT_c1016867All Organisms → Viruses → Predicted Viral1179Open in IMG/M
3300000179|LPjun09P16500mDRAFT_c1045948Not Available574Open in IMG/M
3300000222|LPjun09P12500mDRAFT_1077283Not Available509Open in IMG/M
3300000225|SI34jun09_120mDRAFT_1044477All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon902Open in IMG/M
3300000248|LPfeb09P12500mDRAFT_1002718All Organisms → Viruses → Predicted Viral3097Open in IMG/M
3300000248|LPfeb09P12500mDRAFT_1016361All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon919Open in IMG/M
3300000248|LPfeb09P12500mDRAFT_1025381Not Available672Open in IMG/M
3300000251|LPjun08P16500mDRAFT_1019922All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon765Open in IMG/M
3300001450|JGI24006J15134_10187104All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon643Open in IMG/M
3300001683|GBIDBA_10117716All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon767Open in IMG/M
3300002484|JGI25129J35166_1077342All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon603Open in IMG/M
3300002511|JGI25131J35506_1065597Not Available506Open in IMG/M
3300002514|JGI25133J35611_10167423Not Available593Open in IMG/M
3300002760|JGI25136J39404_1059914All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon708Open in IMG/M
3300004110|Ga0008648_10203458All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon538Open in IMG/M
3300005399|Ga0066860_10105892All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon997Open in IMG/M
3300005521|Ga0066862_10307924All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon512Open in IMG/M
3300005593|Ga0066837_10347226Not Available518Open in IMG/M
3300005969|Ga0066369_10100957All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon981Open in IMG/M
3300006306|Ga0068469_1169769Not Available593Open in IMG/M
3300006315|Ga0068487_1031752Not Available812Open in IMG/M
3300006325|Ga0068501_1170745All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon871Open in IMG/M
3300006325|Ga0068501_1314672Not Available547Open in IMG/M
3300006336|Ga0068502_1477108Not Available919Open in IMG/M
3300006336|Ga0068502_1559704All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon840Open in IMG/M
3300006336|Ga0068502_1576803Not Available745Open in IMG/M
3300006339|Ga0068481_1506002Not Available515Open in IMG/M
3300006343|Ga0099699_1008867Not Available750Open in IMG/M
3300006637|Ga0075461_10052113All Organisms → Viruses → Predicted Viral1326Open in IMG/M
3300006637|Ga0075461_10160073All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon687Open in IMG/M
3300006752|Ga0098048_1130275All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon753Open in IMG/M
3300006754|Ga0098044_1094203All Organisms → Viruses → environmental samples → uncultured archaeal virus1232Open in IMG/M
3300006754|Ga0098044_1203866All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon777Open in IMG/M
3300006754|Ga0098044_1243807All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon698Open in IMG/M
3300006789|Ga0098054_1180522All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon773Open in IMG/M
3300006789|Ga0098054_1332050Not Available541Open in IMG/M
3300006793|Ga0098055_1174657Not Available821Open in IMG/M
3300006793|Ga0098055_1178076All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon812Open in IMG/M
3300006793|Ga0098055_1233101All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon694Open in IMG/M
3300006793|Ga0098055_1298322Not Available602Open in IMG/M
3300006802|Ga0070749_10495000All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon666Open in IMG/M
3300006875|Ga0075473_10084492All Organisms → Viruses → Predicted Viral1250Open in IMG/M
3300006900|Ga0066376_10175471All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon1296Open in IMG/M
3300006900|Ga0066376_10494932All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon690Open in IMG/M
3300006902|Ga0066372_10543316Not Available687Open in IMG/M
3300006929|Ga0098036_1056043All Organisms → Viruses → Predicted Viral1223Open in IMG/M
3300007291|Ga0066367_1116974All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon990Open in IMG/M
3300007344|Ga0070745_1232225All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon672Open in IMG/M
3300007363|Ga0075458_10280248All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon506Open in IMG/M
3300007513|Ga0105019_1173732All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon1095Open in IMG/M
3300007514|Ga0105020_1284407All Organisms → Viruses → Predicted Viral1074Open in IMG/M
3300007515|Ga0105021_1176922Not Available1205Open in IMG/M
3300007756|Ga0105664_1071294All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon791Open in IMG/M
3300007765|Ga0105010_1077174All Organisms → Viruses → Predicted Viral1132Open in IMG/M
3300008050|Ga0098052_1301090Not Available606Open in IMG/M
3300008952|Ga0115651_1261855All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon1106Open in IMG/M
3300009173|Ga0114996_10723922All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon727Open in IMG/M
3300009376|Ga0118722_1374251Not Available708Open in IMG/M
3300009409|Ga0114993_10471651All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon936Open in IMG/M
3300009481|Ga0114932_10001797All Organisms → cellular organisms → Bacteria23635Open in IMG/M
3300009593|Ga0115011_11803535All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon552Open in IMG/M
3300009786|Ga0114999_10685192All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon769Open in IMG/M
3300010150|Ga0098056_1093735All Organisms → Viruses → Predicted Viral1026Open in IMG/M
3300010150|Ga0098056_1209133All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon651Open in IMG/M
3300010153|Ga0098059_1245402All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon691Open in IMG/M
3300010934|Ga0137844_1086857All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon892Open in IMG/M
3300013098|Ga0164320_10713799All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon532Open in IMG/M
3300017744|Ga0181397_1059237All Organisms → Viruses → Predicted Viral1046Open in IMG/M
3300017775|Ga0181432_1151988Not Available712Open in IMG/M
3300020198|Ga0194120_10136354Not Available1499Open in IMG/M
3300020198|Ga0194120_10566726All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon500Open in IMG/M
3300020221|Ga0194127_10870028All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon551Open in IMG/M
3300020375|Ga0211656_10231919Not Available553Open in IMG/M
3300020398|Ga0211637_10074024All Organisms → Viruses → Predicted Viral1372Open in IMG/M
3300020407|Ga0211575_10430866Not Available545Open in IMG/M
3300020427|Ga0211603_10342325Not Available574Open in IMG/M
3300020427|Ga0211603_10431630Not Available511Open in IMG/M
3300020443|Ga0211544_10058900All Organisms → Viruses → Predicted Viral1493Open in IMG/M
3300020447|Ga0211691_10119508All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon982Open in IMG/M
3300020447|Ga0211691_10429301Not Available535Open in IMG/M
3300021087|Ga0206683_10480342All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon613Open in IMG/M
3300021185|Ga0206682_10312511All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon682Open in IMG/M
3300021791|Ga0226832_10104866All Organisms → Viruses → Predicted Viral1036Open in IMG/M
3300022043|Ga0196909_100161All Organisms → Viruses → Predicted Viral1744Open in IMG/M
3300022176|Ga0212031_1028608All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon896Open in IMG/M
(restricted) 3300023276|Ga0233410_10069628All Organisms → Viruses → Predicted Viral1067Open in IMG/M
(restricted) 3300024052|Ga0255050_10150969Not Available564Open in IMG/M
(restricted) 3300024062|Ga0255039_10230593All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon779Open in IMG/M
(restricted) 3300024324|Ga0233443_1289526Not Available546Open in IMG/M
(restricted) 3300024327|Ga0233434_1261197All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon603Open in IMG/M
(restricted) 3300024339|Ga0233445_1171384All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon656Open in IMG/M
3300024344|Ga0209992_10436109Not Available512Open in IMG/M
(restricted) 3300024518|Ga0255048_10320855Not Available751Open in IMG/M
3300025045|Ga0207901_1027887All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon768Open in IMG/M
3300025045|Ga0207901_1047125Not Available572Open in IMG/M
3300025052|Ga0207906_1026106All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon806Open in IMG/M
3300025052|Ga0207906_1040215Not Available636Open in IMG/M
3300025103|Ga0208013_1130624All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon613Open in IMG/M
3300025118|Ga0208790_1207193All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon513Open in IMG/M
3300025128|Ga0208919_1010745All Organisms → Viruses → Predicted Viral3739Open in IMG/M
3300025141|Ga0209756_1145960All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon958Open in IMG/M
3300025168|Ga0209337_1076488All Organisms → Viruses → Predicted Viral1636Open in IMG/M
3300025630|Ga0208004_1037038All Organisms → Viruses → Predicted Viral1387Open in IMG/M
3300025674|Ga0208162_1022404All Organisms → Viruses → Predicted Viral2414Open in IMG/M
3300025732|Ga0208784_1127144All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon758Open in IMG/M
3300026079|Ga0208748_1087042All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon797Open in IMG/M
3300026103|Ga0208451_1052844Not Available512Open in IMG/M
3300026115|Ga0208560_1027198Not Available552Open in IMG/M
3300026253|Ga0208879_1303669All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon579Open in IMG/M
3300026263|Ga0207992_1179800All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon514Open in IMG/M
3300026269|Ga0208766_1019420All Organisms → Viruses → Predicted Viral2541Open in IMG/M
3300026279|Ga0208411_1083237All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon921Open in IMG/M
3300027685|Ga0209554_1031517All Organisms → Viruses → Predicted Viral2106Open in IMG/M
3300027801|Ga0209091_10146973All Organisms → Viruses → Predicted Viral1219Open in IMG/M
3300027813|Ga0209090_10318466All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon767Open in IMG/M
3300027844|Ga0209501_10085226All Organisms → Viruses → Predicted Viral2193Open in IMG/M
3300028022|Ga0256382_1037918All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon1095Open in IMG/M
3300028488|Ga0257113_1143381All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon721Open in IMG/M
3300028488|Ga0257113_1181168Not Available623Open in IMG/M
3300028489|Ga0257112_10012483All Organisms → Viruses → Predicted Viral3192Open in IMG/M
3300028535|Ga0257111_1092084All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon963Open in IMG/M
3300031510|Ga0308010_1062794All Organisms → Viruses → Predicted Viral1496Open in IMG/M
3300031596|Ga0302134_10383355All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon517Open in IMG/M
3300031598|Ga0308019_10027078All Organisms → Viruses → Predicted Viral2560Open in IMG/M
3300031612|Ga0308009_10043465All Organisms → Viruses → Predicted Viral1740Open in IMG/M
3300031658|Ga0307984_1066338All Organisms → Viruses → Predicted Viral1097Open in IMG/M
3300031687|Ga0308008_1016221All Organisms → Viruses → Predicted Viral1906Open in IMG/M
3300031688|Ga0308011_10012783All Organisms → Viruses → Predicted Viral2952Open in IMG/M
3300031689|Ga0308017_1003973All Organisms → Viruses → Predicted Viral3789Open in IMG/M
3300031695|Ga0308016_10109800All Organisms → Viruses → Predicted Viral1113Open in IMG/M
3300031757|Ga0315328_10315158All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon913Open in IMG/M
3300031800|Ga0310122_10193775All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon946Open in IMG/M
3300031801|Ga0310121_10115994All Organisms → Viruses → Predicted Viral1700Open in IMG/M
3300031803|Ga0310120_10200653Not Available1092Open in IMG/M
3300032032|Ga0315327_10583777All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon690Open in IMG/M
3300032048|Ga0315329_10066468All Organisms → Viruses → Predicted Viral1779Open in IMG/M
3300032048|Ga0315329_10610121Not Available579Open in IMG/M
3300032278|Ga0310345_10338067Not Available1405Open in IMG/M
3300032278|Ga0310345_11018006All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon809Open in IMG/M
3300032278|Ga0310345_11291455Not Available714Open in IMG/M
3300032278|Ga0310345_11943299Not Available572Open in IMG/M
3300032360|Ga0315334_10586954All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon960Open in IMG/M
3300032360|Ga0315334_11061520Not Available701Open in IMG/M
3300032360|Ga0315334_11728443Not Available532Open in IMG/M
3300032820|Ga0310342_100537734All Organisms → Viruses → Predicted Viral1311Open in IMG/M
3300032820|Ga0310342_100752036All Organisms → Viruses → Predicted Viral1123Open in IMG/M
3300032820|Ga0310342_100928227All Organisms → Viruses → Predicted Viral1016Open in IMG/M
3300034655|Ga0326746_034981Not Available536Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine33.77%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine10.39%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous7.14%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater5.84%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.19%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.19%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater4.55%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine4.55%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater3.90%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine3.90%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine2.60%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.95%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine1.95%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.95%
Marine OceanicEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic1.30%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface1.30%
Background SeawaterEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater0.65%
Filtered SeawaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater0.65%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.65%
Hydrothermal Vent FluidsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids0.65%
Hydrothermal Vent PlumeEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume0.65%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.65%
Subsea Pool Microbial MatEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool Microbial Mat0.65%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000137Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample F_10_SI03_10EnvironmentalOpen in IMG/M
3300000148Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 100mEnvironmentalOpen in IMG/M
3300000152Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P12 500mEnvironmentalOpen in IMG/M
3300000179Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P16 500mEnvironmentalOpen in IMG/M
3300000222Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 500mEnvironmentalOpen in IMG/M
3300000225Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 120mEnvironmentalOpen in IMG/M
3300000248Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2009 P12 500mEnvironmentalOpen in IMG/M
3300000251Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P16 500mEnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001683Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assemblyEnvironmentalOpen in IMG/M
3300002484Marine viral communities from the Pacific Ocean - ETNP_2_130EnvironmentalOpen in IMG/M
3300002511Marine viral communities from the Pacific Ocean - ETNP_2_1000EnvironmentalOpen in IMG/M
3300002514Marine viral communities from the Pacific Ocean - ETNP_6_85EnvironmentalOpen in IMG/M
3300002760Marine viral communities from the Pacific Ocean - ETNP_6_1000EnvironmentalOpen in IMG/M
3300004110Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_100m_DNAEnvironmentalOpen in IMG/M
3300005399Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F14-07SV275EnvironmentalOpen in IMG/M
3300005521Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255EnvironmentalOpen in IMG/M
3300005593Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV86EnvironmentalOpen in IMG/M
3300005969Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_AEnvironmentalOpen in IMG/M
3300006306Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0500mEnvironmentalOpen in IMG/M
3300006315Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0770mEnvironmentalOpen in IMG/M
3300006325Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500mEnvironmentalOpen in IMG/M
3300006336Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500mEnvironmentalOpen in IMG/M
3300006339Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500mEnvironmentalOpen in IMG/M
3300006343Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0200mEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006900Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_AEnvironmentalOpen in IMG/M
3300006902Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_AEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300007291Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_AAIW_ad_750m_LV_AEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007514Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate aEnvironmentalOpen in IMG/M
3300007515Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate bEnvironmentalOpen in IMG/M
3300007756Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDBack_2015_DNA CLC_assemblyEnvironmentalOpen in IMG/M
3300007765Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 2.7-0.2um, replicate bEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300009173Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134EnvironmentalOpen in IMG/M
3300009376Combined Assembly of Gp0137079, Gp0137080EnvironmentalOpen in IMG/M
3300009409Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150EnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010934Microbial mat microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV9-P3EnvironmentalOpen in IMG/M
3300013098Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cmEnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017775Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17EnvironmentalOpen in IMG/M
3300020198Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65mEnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020375Marine microbial communities from Tara Oceans - TARA_B100000953 (ERX555974-ERR599132)EnvironmentalOpen in IMG/M
3300020398Marine microbial communities from Tara Oceans - TARA_B100000949 (ERX555993-ERR599072)EnvironmentalOpen in IMG/M
3300020407Marine microbial communities from Tara Oceans - TARA_B100001105 (ERX556033-ERR599115)EnvironmentalOpen in IMG/M
3300020427Marine microbial communities from Tara Oceans - TARA_B000000460 (ERX555922-ERR598960)EnvironmentalOpen in IMG/M
3300020443Marine microbial communities from Tara Oceans - TARA_B100001179 (ERX556000-ERR598944)EnvironmentalOpen in IMG/M
3300020447Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159)EnvironmentalOpen in IMG/M
3300021087Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021791Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmerEnvironmentalOpen in IMG/M
3300022043Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022176Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300024052 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024324 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_200_MGEnvironmentalOpen in IMG/M
3300024327 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_120_MGEnvironmentalOpen in IMG/M
3300024339 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_100_MGEnvironmentalOpen in IMG/M
3300024344Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300025045Marine viral communities from the Pacific Ocean - LP-46 (SPAdes)EnvironmentalOpen in IMG/M
3300025052Marine viral communities from the Pacific Ocean - LP-37 (SPAdes)EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025118Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025141Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025676Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026079Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_A (SPAdes)EnvironmentalOpen in IMG/M
3300026103Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 (SPAdes)EnvironmentalOpen in IMG/M
3300026115Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 (SPAdes)EnvironmentalOpen in IMG/M
3300026253Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A (SPAdes)EnvironmentalOpen in IMG/M
3300026263Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 (SPAdes)EnvironmentalOpen in IMG/M
3300026269Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 (SPAdes)EnvironmentalOpen in IMG/M
3300026279Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 (SPAdes)EnvironmentalOpen in IMG/M
3300027685Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Bottom_A/KNORR_S2/LV (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027844Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes)EnvironmentalOpen in IMG/M
3300028022Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750mEnvironmentalOpen in IMG/M
3300028488Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1320mEnvironmentalOpen in IMG/M
3300028489Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1000mEnvironmentalOpen in IMG/M
3300028535Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_500mEnvironmentalOpen in IMG/M
3300031510Marine microbial communities from water near the shore, Antarctic Ocean - #129EnvironmentalOpen in IMG/M
3300031596Marine microbial communities from Western Arctic Ocean, Canada - CB9_SCMEnvironmentalOpen in IMG/M
3300031598Marine microbial communities from water near the shore, Antarctic Ocean - #284EnvironmentalOpen in IMG/M
3300031612Marine microbial communities from water near the shore, Antarctic Ocean - #127EnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300031687Marine microbial communities from water near the shore, Antarctic Ocean - #125EnvironmentalOpen in IMG/M
3300031688Marine microbial communities from water near the shore, Antarctic Ocean - #177EnvironmentalOpen in IMG/M
3300031689Marine microbial communities from water near the shore, Antarctic Ocean - #280EnvironmentalOpen in IMG/M
3300031695Marine microbial communities from water near the shore, Antarctic Ocean - #233EnvironmentalOpen in IMG/M
3300031757Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315EnvironmentalOpen in IMG/M
3300031800Marine microbial communities from Western Arctic Ocean, Canada - CB6_Bottom_1051EnvironmentalOpen in IMG/M
3300031801Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986EnvironmentalOpen in IMG/M
3300031803Marine microbial communities from Western Arctic Ocean, Canada - CB27_AW_983EnvironmentalOpen in IMG/M
3300032032Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315EnvironmentalOpen in IMG/M
3300032048Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 32315EnvironmentalOpen in IMG/M
3300032278Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300032360Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915EnvironmentalOpen in IMG/M
3300032820Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300034655Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 494_2800EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
LP_F_10_SI03_10DRAFT_104187523300000137MarineMCAIRKDFISLINELDTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIIVSEEQKFSKTGDIESIFRQIKAQKTGD*
SI47jul10_100mDRAFT_104426013300000148MarineNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQRFNKLGDIESIFRQIKAQKTGD*
LPjun08P12500mDRAFT_102060633300000152MarineSFENVLMALTQSKMSGNVPDRNTKSEVNTLLGIVKTINDLNAKIVVTEKTEYRQGDIDNIFRQIKAQRSG*
LPjun08P12500mDRAFT_105413943300000152MarineDMLAKLSFENVLMALAESKFDGNIPDRNTKSEINTLLNVVKAINDLNSKIVLSEKTKYDSKGDIESIFKQIKAQRSD*
LPjun09P16500mDRAFT_101686713300000179MarineLSFENVLMALAESKFDGNIPDRNTKSEINTLLNVVKSINELNSKIVLSEKTKYDSKGDIESIFKQIKAQRSD*
LPjun09P16500mDRAFT_104594833300000179MarineFENVLMALTQSKMDGNIPDRNTKAEINSFLQIMKGLNELSSKVILSEKAEYTKEGDISNIFRQIKAQKTE*
LPjun09P12500mDRAFT_107728333300000222MarineTQSKMSGNVPDRNTKSEVNTLLGIVKTINDLNAKIVVTEKTEYRQGDIDNIFRQIKAQRSG*
SI34jun09_120mDRAFT_104447723300000225MarineSIDSGGNGKCPKYEEGAMCAIRKDFIALINELDTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQRFNKLGDIESIFRQIKAQKTGD*
LPfeb09P12500mDRAFT_100271853300000248MarineMYLMALTQAKMDGNVPDRNTKSEINTLLSVIKSINDLNTKVVVTQQTELDQKTGDISSIFKQIKAQGVLKEDG*
LPfeb09P12500mDRAFT_101636113300000248MarineVKLSFENVLMALTQAKMDGNIPDRNTKSEINSLLSIVKSINDLNSKITISEEKRYSKEGDIENIFRQIKSQRSE*
LPfeb09P12500mDRAFT_102538113300000248MarineMALTQSKMSGNVPDRNTKSEVNTLLGIVKTINDLNAKIVVTEKTEYRQGDIDNIFRQIKAQRSG*
LPjun08P16500mDRAFT_101992233300000251MarineLTQAKMDGNIPDRNTKSEINSLLNIVKSINDLNSKITISEEKRYTKEGDIENIFRQIKSQRTE*
JGI24006J15134_1018710423300001450MarineDMIAKLSFENVLMALTQAKMDGNIPDRNTKSEINTFLNIVKTLTDLSTKIMVTQTTAIDDKTGDITSIFKQIKAQKNDG*
GBIDBA_1011771623300001683Hydrothermal Vent PlumeMLDMIAKLSFENVLMALTQAKMDGNIPDRNTKSEINTFLNIVKSLTDLSTKIMITETKSVDDKTGDITSIFKQIKAQKNDG*
JGI25129J35166_107734223300002484MarineKDFIAMINELDTRNPAHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIEVSEEQKFNKKGDIESIFRQIKANRSGD*
JGI25131J35506_106559713300002511MarineVLMALTQAKMDGNIPDRNTKSEINSLLNIVKSINDLNSKITISEEKRYTKEGDIENIFRQIKSQRTE*
JGI25133J35611_1016742333300002514MarineLMALTQAKMDGNIPDRNTKSEINTLLAVVKSINDLNTKVVVTEQKTIDDKTGDISSIFRQIKAQKSGN*
JGI25136J39404_105991433300002760MarineLSFENVLMALTQAKMDGNIPDRNTKSEINSLLNIVKSINDLNSKITISEEKRYTKEGDIENIFRQIKSQRTE*
Ga0008648_1020345823300004110MarineQAKFDGNVPDRNSKSEINTLLNIVKSMNDLNSKITITEKKEFSKEGDISSIFRQIKAQKKDG*
Ga0066860_1010589223300005399MarineNIPDRNTKSEVNTLLKIISTISEISSKITISEEKTFNKMGDIESIFRQIKEKKALE*
Ga0066862_1030792413300005521MarineMIDMVAKLTFENVLMTLTQAKFDGNIPDRNSKSEINTLLNIVKSMNDLNSKITITEKKEFSKEGDISNIFRQIKAQKSGDD*
Ga0066837_1034722633300005593MarineSFENVLMALTQAKMDGNIPDRNTKSEIKTLLEIVKSINDLNSKIVVTEKQEYNKEGDIANIFRQIKAQKSGN*
Ga0066369_1010095713300005969MarineNIPDRNTKSEVNTLLKIISTIGEISSKITIKEEKTFNKTGDIESIFRQIKERKTFD*
Ga0068469_116976923300006306MarineMALAESKFDGNIPDRNTKSEINTLLNVVKSINELNSKIVLSEKTKYDSKGDIESIFKQIKAQRSD*
Ga0068487_103175253300006315MarineENVLMALTQAKMDGNIPDRNTKSEINTLLAVIKSINDLNTKVVVTQQTELDQKTGDISSIFKQIKAQRSVD*
Ga0068501_117074513300006325MarineGNIPDRNTKSEINTLLNVVKAINDLNSKIVISEKTRYDNKGDIESIFKQIKAQRSD*
Ga0068501_131467213300006325MarineRKPEDLKEMLDMLAKLSFENVLMALTQSKMDGNIPDRNTKAEINSFLQIMKGLNELNSKVILTEKAEYTKEGDISNIFRQIKAQKSE*
Ga0068502_147710823300006336MarineMLAKLSFENVLMALAESKFDGNIPDRNTKSEINTLLNVVKAINELNSKIVISEKTRYDNKGDIESIFKQIKAQRSD*
Ga0068502_155970413300006336MarineNPEDVKSMLDMLAKLSFENVLMALAESKFDGNIPDRNTKSEINTLLNVVKSINELNSKIVLSEKTKYDSKGDIESIFKQIKAQRSD*
Ga0068502_157680313300006336MarineAKLSFENVLMALTQAKMDGNIPDRNTKSEINTLLGIVKSINDLNSKIVVTERTEFDKTGDISNIFRQIKARKSGD*
Ga0068481_150600213300006339MarineMLDMLVKLSFENVLMALTQAKMDGNIPDRNTKSEINSLLNIVKSINDLNSKISITEEKRYSKEGDIENIFRQIKAQKSE*
Ga0099699_100886713300006343MarineGMMDMLAKLSFENVLMALTQSKMDGNIPDRNTKSEINTLLSIVKSINDLNSKIVVSEEAKFDKSGDIESIFRQIKAQKSGGDV*
Ga0075461_1005211323300006637AqueousFDGNIPDRNTKSEVNTLLKIIQTIGEISNKIVISEEQKFNKQGDIESIFRQIKAQKSGD*
Ga0075461_1016007313300006637AqueousVLMALTQAKFDGNVPDRNTKSEINTLLNIIKSINDLNNKIVVTEKTEFGKSGDISSIFRQIKAQRAVNDTRENNERTD*
Ga0098048_113027513300006752MarineRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISNKIVVSEEQKFSKTGDIESIFRQIKAHKTGD*
Ga0098044_109420323300006754MarineCAIRKDFVAMINELDTIDPKHVKTMLNMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVISEEQKFNKLGDIESIFRQIKEKKSS*
Ga0098044_120386623300006754MarineDMLAKLSFENVLMALTESKFDGNIPDRNSKSEINTLLKIISTIAEISGKIVVSEEKKLNKQGDIDSIFRQIKSHGIGG*
Ga0098044_124380713300006754MarineENVLMALTQAKLDGNIPDRNTKSEINTLLNVVKSINELNSKIVVTEKAEYTKEGDIANIFRQIKAQKSGE*
Ga0098054_118052213300006789MarineIDSGGNGKCPKYEEGAMCAIRKDFIALINELDTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISNKIVVSEEQKFSKTGDIESIFRQIKAHKTGD*
Ga0098054_133205013300006789MarineGGNGKCPKYEAGAMCAIRKDFVQLINELDTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIINTIGEISSKIVVSEEQRFNKQGDIESIFRQIKAQKASD*
Ga0098055_117465743300006793MarineAKMDGNIPDRNTKSEIKTLLDIVKSINDLNSKITITEQKEYNKEGDIANIFKQIKAQKSGK*
Ga0098055_117807623300006793MarineCAIRKDFVAMINELDTRDPKHVKTMLDMLAKLSFENVLMALYESKMDGNIPDRNTKSEVNTLLKIISTIGEISNKIEVSETTTLNKKGDIESIFRQIKANKKGD*
Ga0098055_123310113300006793MarineRNPEDLKAMIDMLAKISFENVLMALTQAKMDGNIPDRNTKSEIKTLLEIVKSINDLNSKITVTEQKEFNKEGDISNIFRQIKSQKSG*
Ga0098055_129832213300006793MarinePEDIKSMLDMLVKLSFENVLMALTQAKMDGNIPDRNTKSEINSLLSIVKSINDLNSKVTISEEKRYTKEGDIENIFRQIKAQRSE*
Ga0070749_1049500013300006802AqueousMCAIRKDFVELINQLDTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIIQTIGEISNKIVISEEQKFNKQGDIESIFRQIKAQKSGD*
Ga0075473_1008449213300006875AqueousRSIDTGGNGKCPKYEAGAMCAIRKDFIQLINELDTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEINTLLKIISTIGEISNKIVVSEEQRFNKQGDIESIFRQIKAQKSSD*
Ga0066376_1017547113300006900MarineIKAMLDMIAKISFENVLMALTQAKMDGNVPDRNTKSEINTLLAVIKSINDLNTKVIVTQQTELDQKTGDISSIFKQIKAQGVLRDGN*
Ga0066376_1049493213300006900MarineAIRKDFIALINELDTRNPEHVKTMLDMLAKLSFENVLMSLTEAKFDGNIPDRNSKSEINTLLKIISTIAEISNKIVISQETKINKQGDIDSIFRQIKSHGV*
Ga0066372_1054331633300006902MarineMLAKLSFENVLMALTQAKMDGNIPDRNTKSEVNTLLGIVKSINDLNAKIVVTEKTEYRQGDIENIFRQIKAQRSG*
Ga0098036_105604333300006929MarineALINELDTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQKFNKQGDIESIFRQIKAQKTVD*
Ga0066367_111697413300007291MarineNVLMALTQAKMDGNVPDRNTKSEINTLLSVIKSINDLNTKVVVTQQTELDQKTGDISSIFKQIKAQGVLKDDG*
Ga0070745_123222513300007344AqueousNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEINTLLKIISTIGEISNKIVVSEEQRFNKQGDIESIFRQIKAQKSSD*
Ga0075458_1028024813300007363AqueousAKLSFENVLMALTESKFDGNIPDRNTKSEINTLLKIISTIGEISNKIVVSEEQRFNKQGDIESIFRQIKAQKSSD*
Ga0105019_117373213300007513MarineAKISFENVLMALTQAKMDGNVPDRNTKSEINTLLSVIKSINDLNTKVVVTQQTALDEKTGDISSIFKQIKAQGVLKDDG*
Ga0105020_128440713300007514MarineLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISNKIVVSEEKRFNKTGDIESIFRQIKAQKTTSD*
Ga0105021_117692213300007515MarineFENVLMALTQAKMDGNIPDRNTKSEIKTLLEIVKSINDLNSKITVTEKQEYNKEGDIANIFRQIKAHKTGNGT*
Ga0105664_107129433300007756Background SeawaterAMIDMLAKLSFENVLMALTQAKMDGNIPDRNTKSEINTLLSIVKSINDLNSKIVVTERTEFDKTGDISNIFRQIKARKSGD*
Ga0105010_107717423300007765MarineEDIKSILDMLVKLSFENVLMALTQSKMDGNIPDRNTKSEINSLLSIVKSINDLNSKVTISEEKRYSKEGDIENIFRQIKSQRSE*
Ga0110931_119116423300007963MarineDRNSKSEINTLLNIVKSMNDLNSKITITEKKEFSKEGDISSIFRQIKAQKKDG*
Ga0098052_130109013300008050MarineENVLMALTQAKMDGNIPDRNTKSEIKTLLDIVKSINDLNSKITITEQKEYNKEGDIANIFKQIKAQKSGK*
Ga0115651_126185513300008952MarineLDMIAKISFENVLMALTQAKMDGNVPDRNTKSEINTLLSVIKSINDLNTKVVVTQQTALDEKTGDISSIFKQIKAQGVLKDDG*
Ga0114996_1072392223300009173MarineEGAMCAIRKDFIALINELDTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISNKIVVSEEQRFNKLGDIESIFRQIKAQKTGD*
Ga0118722_137425113300009376MarineLENVLMALTEAKMDGNIPDRNTKSEINTLLNIVKSISDLNSKIVMTEETKLNKKGDIESIFKQIKAQRTE*
Ga0114993_1047165113300009409MarineVYRSIDSGGNGKCPKYEEGAMCAIRKDFIALINELDTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISNKIVVSEEQRFNKLGDIESIFRQIKAQKTGD*
Ga0114932_1000179713300009481Deep SubsurfaceENVLMALTQSKLDGNIPDRNTKSEINTLLNVVKSINDLNSKIVVTEKAEYNKEGDIANIFRQIKAQKSGD*
Ga0115011_1180353523300009593MarineMALTQSKMDGNIPDRNTKSEVNTLLGIVKSINDLNSKIEITETTEYDKSGDIANIFRQIKAQKTDQSG*
Ga0114999_1068519213300009786MarineMALTQAKMDGNIPDRNTKSEINTFLNIVKTLTDLSTKIMVTQTTAIDDKTGDITSIFKQIKAQKNNG*
Ga0098056_109373543300010150MarineDMIAKLSFENVLMALTQSKMDGNIPDRNTKSEINTLLSVVKSINDLNSKIVVSEEAKFDKSGDIESIFRQIKAQKSGSV*
Ga0098056_120913323300010150MarineLCAIRKDFVAMINELDTRDPKHVKTMLDMLAKLSFENVLMALYESKMDGNIPDRNTKSEVNTLLKIISTIGEISNKIEVSETTTLNKKGDIESIFRQIKANKKGD*
Ga0098059_124540213300010153MarinePEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIIVSEEQKFSKTGDIESIFRQIKAHKTGD*
Ga0137844_108685713300010934Subsea Pool Microbial MatMINQLDTRDPKHVKTMLDMLAKLSFENVLMALYESKMDGNIPDRNTKSEVNTLLKIISTIGEISNKIEVSETTTLNKKGDIESIFRQIKANKKGE*
Ga0164320_1071379913300013098Marine SedimentNVLMTLTQAKFDGNVPDRNSKSEINTLLNIVKSMNDLNSKITITEKKEFSKEGDISSIFRQIKAQKKDG*
Ga0181397_105923723300017744SeawaterEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIIVSEEQKFSKTGDIESIFRQIKAQKTGD
Ga0181432_115198813300017775SeawaterVKAMLDMLVKLSFENVLMALTQSKMDGNIPDRNTKSEINSLLNIVKSINDLNSKISITEEKRYTKEGDIENIFRQIKAQKSE
Ga0194120_1013635423300020198Freshwater LakeVLMALTESKFDGNIPDRNTKSEINTLLKIIQTIGEISNKIVVSEEQRFNKQGDIESIFRQIKAQKTSD
Ga0194120_1056672623300020198Freshwater LakeVLMALTESKFDGNIPDRNTKSEINTLLKIISTIGEISSKIVVSEEKRFNRQGDIESIFRQIKAKKVE
Ga0194127_1087002813300020221Freshwater LakeCAIRKDFVALINELDTRNPEDVKVMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEINTLLKIISTIGEISSKIVVSEEKRFNRQGDIESIFRQIKAKKVE
Ga0211656_1023191913300020375MarineLMALTQAKMDGNVPDRNTKSEINTLLSVIKSINDLNTKVVVTQQTALDEKTGDISSIFKQIKAQGVLKEDG
Ga0211637_1007402413300020398MarineKLSFENVLMALTQSKMDGNIPDRNTKAEINSFLQIMKGLNDLSDKVVLSEKAEYTKEGDISNIFRQIKAQKT
Ga0211575_1043086613300020407MarineENVLMALTQSKMDGNIPDRNTKSEINSLLNIVKSINDLNSKITMTEEKRYTKEGDIENIFRQIKAQKSE
Ga0211603_1034232533300020427MarineKAMLDMIAKISFENVLMALTQAKMDGNVPDRNTKSEINTLLSVIKSINDLNTKVVVTQQTALDEKTGDISSIFKQIKAQGVLKDDG
Ga0211603_1043163033300020427MarineMLDMTAKLSFENVLMALTQAKMDGNIPDRNTKSEINTLLNVVKAINDLNTKVVVTEGQAFDEKTGDITSIFKQIKAQRST
Ga0211544_1005890013300020443MarineKMDGNIPDRNTKSEINTLLNVVKAINDLNTKVVVTEGQAFDEKTGDITSIFKQIKAQRST
Ga0211691_1011950843300020447MarineMIAKISFENVLMALTQAKMDGNVPDRNTKSEINTLLSVIKSINDLNTKVVVTQQTELDQKTGDISSIFKQIKAQGVLKDDG
Ga0211691_1042930113300020447MarineMLDMLVKLSFENVLMALTQAKMDGNIPDRNTKSEINSLLNIVKSINDLNSKISITEEKRYTKEGDIENIFRQIKAQKSE
Ga0206683_1048034213300021087SeawaterNVLMALTQSKLDGNIPDRNTKSEINTLLNIVKSINELNNKITITEQKEYDKEGDIANIFRQIKAQKSGD
Ga0206682_1031251123300021185SeawaterALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQRFNKLGDIESIFRQIKAQKTGD
Ga0226832_1010486613300021791Hydrothermal Vent FluidsIAKLSFENVLMALTQAKMDGNIPDRNTKSEINTLLNVVKAINDLNTKVVVTEGQEFDEKTGDITSIFKQIKAQRST
Ga0196909_10016113300022043AqueousSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIIQTIGEISNKIVISEEQKFNKQGDIESIFRQIKAQKSGD
Ga0212031_102860813300022176AqueousLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIIQTIGEISNKIVISEEQKFNKQGDIESIFRQIKAQKSGD
(restricted) Ga0233410_1006962813300023276SeawaterSGGNGKCPKYEEGAMCAIRKDFIALINELDTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQRFNKLGDIESIFRQIKAQKTGD
(restricted) Ga0255050_1015096923300024052SeawaterRKDFVALINDLDTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDMNTKSEVNTLLKIISTIGEISSKITISEEKTFNKMGDIESIFRQIKEKKSLD
(restricted) Ga0255039_1023059313300024062SeawaterKDFIALINELDTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQRFNKLGDIESIFRQIKAQKTGD
(restricted) Ga0233443_128952613300024324SeawaterYRSIDSGGNGKCPKYEEGAMCAIRKDFIALINELDTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQRFNKLGDIESIFRQIKAQKTGD
(restricted) Ga0233434_126119713300024327SeawaterRSIDSGGNGKCPKYEEGAMCAIRKDFIALINELDTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIIVSEEQKFSKTGDIESIFRQIKAQKTGD
(restricted) Ga0233445_117138413300024339SeawaterIPALCDQCVYRSIDSGGNGKCPKYEEGAMCAIRKDFIALINELDTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQRFNKLGDIESIFRQIKAQKTGD
Ga0209992_1043610913300024344Deep SubsurfaceDMLAKISFKNVLMALTQAKMDGNIPDRNTKSEIKTLLEIVKSINDLNSKITVTEQKEFNKEGDISNIFRQIKSQKSG
(restricted) Ga0255048_1032085533300024518SeawaterVLMALTEAKMDGNIPDRNTKSEINTLLNIVKSISDLNSKIVMTEETKLNKKGDIESIFKQIKAQRTE
Ga0207901_102788733300025045MarineYFEPEDIKSVLDMLVKLSFENVLMALTQAKMDGNIPDRNTKSEINSLLNIVKSINDLNSKITISEEKRYTKEGDIENIFRQIKSQRTE
Ga0207901_104712513300025045MarineLKSMMDMLAKLSFENVLMALTQAKMDGNIPDRNTKSEINSLLSIVKSINDLNSKITISEEKRYSKEGDIENIFRQIKSQRSE
Ga0207906_102610633300025052MarineSMMDMLAKLSFENVLMALTLSKMDGNIPDRNTKSEINTLLSIVKQINDLNDKIVVTEKTEYRQGDIENIFRQIKARKSE
Ga0207906_104021533300025052MarineNVLMALAESKFDGNIPDRNTKSEINTLLNVVKAINDLNSKIVLSEKTKYDSKGDIESIFKQIKAQRSD
Ga0208013_113062433300025103MarineGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQKFNKQGDIESIFRQIKAQKTVD
Ga0208790_120719313300025118MarineDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVISEEQKFNKLGDIESIFRQIKEKKSS
Ga0208919_101074553300025128MarineSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQKFNKQGDIESIFRQIKAQKTVD
Ga0209756_114596043300025141MarineKSMLDMIAKISFENVLMALTQAKMDGNIPDRNTKSEINTLLAVVKSINDLNTKVVVTEQKTIDDKTGDISSIFRQIKAQKSGN
Ga0209337_107648823300025168MarineLINELDTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQRFNKLGDIESIFRQIKAQKTGD
Ga0208004_103703823300025630AqueousLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIIQTIGEISNKIVISEEQKFNKQGDIESIFRQIKAQKSGD
Ga0208162_102240413300025674AqueousLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIIQTIGEISNKIVISEEQKFNKQGDIESIFRQIKAQKSGD
Ga0209657_115762613300025676MarineVPDRNSKSEINTLLNIVKSMNDLNSKITITEKKEFSKEGDIESIFRQIKAQKKDG
Ga0208784_112714413300025732AqueousMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEINTLLKIISTIGEISNKIVVSEEQRFNKQGDIESIFRQIKAQKSSD
Ga0208748_108704223300026079MarineVKFINELDTREPEDVKAMLDMLVKLSFENVLMALTQSKMDGNIPDRNTKSEVNTLLKIISTIGEISSKITIKEEKTFNKTGDIESIFRQIKERKTFD
Ga0208451_105284413300026103Marine OceanicIKAMLDMIAKISFENVLMALTQAKMDGNVPDRNTKSEINTLLAVIKSINDLNTKVVVTQQTALDEKTGDISTIFKQIKAQGVLKDDGI
Ga0208560_102719833300026115Marine OceanicMALTQAKMDGNVPDRNTKSEINTLLAVIKSINDLNTKVVVTQQTELDEKTGDISSIFKQIKAQGVLKDDG
Ga0208879_130366923300026253MarineCAIRKDFIALINELDTRNPEHVKTMLDMLAKLSFENVLMSLTEAKFDGNIPDRNSKSEINTLLKIISTIAEISNKIVISQETKINKQGDIDSIFRQIKSHGV
Ga0207992_117980013300026263MarineMIDMVAKLTFENVLMTLTQAKFDGNIPDRNSKSEINTLLNIVKSMNDLNSKITITEKKEFSKEGDISNIFRQIKAQKSGDD
Ga0208766_101942013300026269MarineAIRKDFVALINDLDTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVISEEQKFNKLGDIESIFRQIKEKKSS
Ga0208411_108323723300026279MarineAMCAIRKDFVALINDLDTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVISEEQKFNKLGDIESIFRQIKEKKSS
Ga0209554_103151733300027685MarineLAKLSFENVLMALTQAKMDGNIPDRNTKSEVNTLLSIVKSINDLNAKIVVTEKTEYRQGDIENIFRQIRAQSSA
Ga0209091_1014697323300027801MarineLMTLTQAKFDGNVPDRNSKSEINTLLNIVKSMNDLNSKITITEKKEFSKEGDISSIFRQIKAQKKDG
Ga0209090_1031846613300027813MarineFENVLMTLTQAKFDGNVPDRNSKSEINTLLNIVKSMNDLNSKITITEKKEFSKEGDISSIFRQIKAQKKDG
Ga0209501_1008522613300027844MarineVKAIVDMIAKLSFENVLMALTQAKMDGNIPDSNTKSEINTFLNIVKTLTDLSTKIMVTQTTAIDDKTGDITSIFKQIKAQKNNG
Ga0256382_103791823300028022SeawaterAKLSFENVLMALTQAKMDGNIPDRNTKSEVNTLLSIVKSINDLNSKIVVTEKTEYRQGDIENIFRQIKAQRTG
Ga0257113_114338133300028488MarineMDGNVPDRNTKSEINTLLSVIKSINDLNTKVVVTQQTELDEKTGDISTIFKQIRAQGVLKDDGS
Ga0257113_118116813300028488MarineELDTREPEDIKSMMDMLVKLSFENVLMALTQAKMDGNIPDRNTKSEINSLLNIVKSINDLNSKITISEEKRYSKEGDIENIFRQIKSQRSE
Ga0257112_1001248313300028489MarineLMALTQAKMDGNIPDRNTKSEINSLLNIVKSINDLNSKITISEEKRYTKEGDIENIFRQIKSQRTE
Ga0257111_109208413300028535MarineLTQAKMDGNIPDRNTKSEINSLLNIVKSINDLNSKVTISEEKRYSKEGDIENIFRQIKSQRTE
Ga0308010_106279423300031510MarineKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQRFNKLGDIESIFRQIKAQKTGD
Ga0302134_1038335523300031596MarineTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQRFNKLGDIESIFRQIKAQKTGD
Ga0308019_1002707813300031598MarineLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQRFNKLGDIESIFRQIKAQKTGD
Ga0308009_1004346513300031612MarineLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQRFNKLGDIESIFRQIKAQKTGD
Ga0307984_106633813300031658MarineESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQRFNKLGDIESIFRQIKAQKTGD
Ga0308008_101622113300031687MarineRNPEDLKGMIDMVAKLTFENVLMTLTQAKFDGNVPDRNSKSEINTLLNIVKSMNDLNSKITITEKKEFSKEGDISSIFRQIKAQKKDG
Ga0308011_1001278313300031688MarineNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQRFNKLGDIESIFRQIKAQKTGD
Ga0308017_100397313300031689MarineNVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQRFNKLGDIESIFRQIKAQKTGD
Ga0308016_1010980023300031695MarineTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQRFNKLGDIESIFRQIKAQKTGD
Ga0315328_1031515823300031757SeawaterCPKYEEGAMCAIRKDFIALINELDTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQRFNKLGDIESMFRQIKAQKTGD
Ga0310122_1019377533300031800MarineNVLMALTQAKMDGNVPDRNTKSEINTLLAVIKSINDLNTKVVVTQQTALDEKTGDISTIFKQIKAQGVLKDDGI
Ga0310121_1011599443300031801MarineDGNIPDRNTKSEINSLLNIVKSINDLNSKISITEEKRYTKEGDIENIFRQIKAQKTE
Ga0310120_1020065323300031803MarineLTQSKMDVNIPDRNTKAEINSFLQIMKGLNELSSKVILSEKAEYTKEGDISNIFRQIKAQKTE
Ga0315327_1058377723300032032SeawaterKLSFENVLMALTQAKMDGNIPDRNTKSEINTFLNIVKSLTELSTKIMITETKSVDDKTGDITSIFKQIKAQKNDG
Ga0315329_1006646813300032048SeawaterTQAKMDGNVPDRNTKSEINTLLSVIKSINDLNTKVVVTQQTELDQKTGDISSIFKQIKAQGVLKEDG
Ga0315329_1061012113300032048SeawaterKMDGNIPDRNTKSEINSLLNIVKSINDLNSKVTISEEKRYSKEGDIENIFRQIKSQRTE
Ga0310345_1033806713300032278SeawaterAKMDGNIPDRNTKSEVNTLLGIVKSINDLNSKIVVTEKTEYRQGDIENIFRQIKAQKSG
Ga0310345_1101800613300032278SeawaterPEDIKSILDMLVKLSFENVLMALTQAKMDGNIPDRNTKSEINSLLSIVKSINDLNSKVTISEEKRYSKEGDIENIFRQIKSQRSE
Ga0310345_1129145513300032278SeawaterAKLSFENVLMALTQAKMDGNIPDRNTKSEINTLLNVVKAINDLNTKVVVTEGQAFDEKTGDITSIFKQIKAQRST
Ga0310345_1194329913300032278SeawaterMALTLSKMDGNIPDRNTKSEINTLLSIVKQINDLNDKIVVTEKTEYRQGDIENIFRQIKARKSE
Ga0315334_1058695413300032360SeawaterNPEDVKAMLDMLAKLSFENVLMALAESKFDGNIPDRNTKSEINTLLNVVKAINELNSKIVISEKTRYDNKGDIESIFKQIKAQRTD
Ga0315334_1106152013300032360SeawaterLMALTQAKMDGNIPDRNTKSEVNTLLGIVKSINDLNSKIVVTEKTEYRQGDIENIFRQIKAQKSG
Ga0315334_1172844313300032360SeawaterLSFENVLMALTQAKMDGNIPDRNTKSEINSLLNIVKSINDLNSKITISEEKRYTKEGDIENIFRQIKSQRSE
Ga0310342_10053773413300032820SeawaterLTQAKMDGNIPDRNTKSEVNTLLGIVKSINDLNAKIVVTEKTEYRQGDIENIFRQIKAQRSG
Ga0310342_10075203613300032820SeawaterLDTREPEDIKSILDMLVKLSFENVLMALTQAKMDGNIPDRNTKSEINSLLSIVKSINDLNSKVTISEEKRYSKEGDIENIFRQIKSQRSE
Ga0310342_10092822713300032820SeawaterLMALTQAKMDGNIPDRNTKSEVNTLLGIVKSINDLNSKIVVTEKTEYRQGDIENIFRQIKAQRTG
Ga0326746_034981_351_5363300034655Filtered SeawaterESKFDGNIPDRNTKSEINTLLNVVKAINDLNSKIVISERTKYDNKGDIESIFKQIKAQRS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.