NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F044539

Metagenome / Metatranscriptome Family F044539

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044539
Family Type Metagenome / Metatranscriptome
Number of Sequences 154
Average Sequence Length 129 residues
Representative Sequence MLVDEIFALYLYRMSNRINQFYYKIVLAYVIFFRECLNEYGWGKKIESEGIRLENNPELKIDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIYDIPKHDQIDLTINLCHWLF
Number of Associated Samples 132
Number of Associated Scaffolds 154

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 38.31 %
% of genes near scaffold ends (potentially truncated) 40.91 %
% of genes from short scaffolds (< 2000 bps) 95.45 %
Associated GOLD sequencing projects 118
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.701 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(17.533 % of family members)
Environment Ontology (ENVO) Unclassified
(53.247 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(66.883 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 77.39%    β-sheet: 0.00%    Coil/Unstructured: 22.61%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 154 Family Scaffolds
PF13912zf-C2H2_6 8.44
PF00179UQ_con 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 154 Family Scaffolds
COG5078Ubiquitin-protein ligasePosttranslational modification, protein turnover, chaperones [O] 0.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000117|DelMOWin2010_c10180270All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium667Open in IMG/M
3300000136|KGI_S1_ANT02_95mDRAFT_c10065636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1034Open in IMG/M
3300001263|BBAY83_10038238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1587Open in IMG/M
3300002835|B570J40625_100226329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1985Open in IMG/M
3300002835|B570J40625_100462061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1207Open in IMG/M
3300004463|Ga0063356_101280241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1071Open in IMG/M
3300004870|Ga0071103_143138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani648Open in IMG/M
3300005043|Ga0071100_1015870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2083Open in IMG/M
3300005838|Ga0008649_10159699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani894Open in IMG/M
3300005941|Ga0070743_10044860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1512Open in IMG/M
3300005941|Ga0070743_10176399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani705Open in IMG/M
3300006029|Ga0075466_1147705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani607Open in IMG/M
3300006352|Ga0075448_10258665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani528Open in IMG/M
3300006641|Ga0075471_10120365All Organisms → Viruses → Predicted Viral1401Open in IMG/M
3300006641|Ga0075471_10633530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300006803|Ga0075467_10708428All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300006917|Ga0075472_10616603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300007231|Ga0075469_10071367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1005Open in IMG/M
3300007513|Ga0105019_1049793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2522Open in IMG/M
3300007513|Ga0105019_1242326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani837Open in IMG/M
3300007516|Ga0105050_10127838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1643Open in IMG/M
3300007651|Ga0102900_1023180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1288Open in IMG/M
3300007658|Ga0102898_1070604All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani796Open in IMG/M
3300007667|Ga0102910_1134161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani580Open in IMG/M
3300007864|Ga0105749_1035948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani958Open in IMG/M
3300008119|Ga0114354_1044114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1931Open in IMG/M
3300008259|Ga0114841_1112508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1156Open in IMG/M
3300008966|Ga0114357_1127813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1130Open in IMG/M
3300009002|Ga0102810_1029707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1805Open in IMG/M
3300009068|Ga0114973_10295449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani864Open in IMG/M
3300009071|Ga0115566_10105621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1805Open in IMG/M
3300009071|Ga0115566_10109531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1766Open in IMG/M
3300009080|Ga0102815_10274805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani930Open in IMG/M
3300009080|Ga0102815_10368217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani797Open in IMG/M
3300009182|Ga0114959_10585204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300009263|Ga0103872_1033094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani699Open in IMG/M
3300009265|Ga0103873_1043728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani843Open in IMG/M
3300009265|Ga0103873_1066657All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani712Open in IMG/M
3300009434|Ga0115562_1147335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani881Open in IMG/M
3300009436|Ga0115008_10075755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2542Open in IMG/M
3300009436|Ga0115008_10203171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1421Open in IMG/M
3300009436|Ga0115008_11035438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani614Open in IMG/M
3300009441|Ga0115007_10048672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2650Open in IMG/M
3300009442|Ga0115563_1208449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani747Open in IMG/M
3300009466|Ga0126448_1018003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1711Open in IMG/M
3300009495|Ga0115571_1055297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1824Open in IMG/M
3300009496|Ga0115570_10037869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2669Open in IMG/M
3300009497|Ga0115569_10070645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1845Open in IMG/M
3300009497|Ga0115569_10162572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1059Open in IMG/M
3300009538|Ga0129287_10065598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1532Open in IMG/M
3300009544|Ga0115006_10970391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani753Open in IMG/M
3300009544|Ga0115006_11436803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300009593|Ga0115011_11551885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani587Open in IMG/M
3300009785|Ga0115001_10223394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1212Open in IMG/M
3300010316|Ga0136655_1167991All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani654Open in IMG/M
3300010354|Ga0129333_10373073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1266Open in IMG/M
3300010368|Ga0129324_10177900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani873Open in IMG/M
3300012952|Ga0163180_11215335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani616Open in IMG/M
3300012954|Ga0163111_10181171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1806Open in IMG/M
3300012954|Ga0163111_12332147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300012970|Ga0129338_1390008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani591Open in IMG/M
3300013115|Ga0171651_1147413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani745Open in IMG/M
3300016882|Ga0186577_101843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1653Open in IMG/M
3300017710|Ga0181403_1052298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani854Open in IMG/M
3300017739|Ga0181433_1118503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300017748|Ga0181393_1117996All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani674Open in IMG/M
3300017783|Ga0181379_1102673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1046Open in IMG/M
3300017783|Ga0181379_1175121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum758Open in IMG/M
3300017818|Ga0181565_10590521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani713Open in IMG/M
3300018049|Ga0181572_10517337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani733Open in IMG/M
3300018410|Ga0181561_10244391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani856Open in IMG/M
3300018410|Ga0181561_10283917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani776Open in IMG/M
3300018415|Ga0181559_10377270All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani781Open in IMG/M
3300018420|Ga0181563_10475569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani705Open in IMG/M
3300018426|Ga0181566_10250637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1294Open in IMG/M
3300018692|Ga0192944_1015890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1027Open in IMG/M
3300018846|Ga0193253_1046888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1068Open in IMG/M
3300018928|Ga0193260_10094213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani649Open in IMG/M
3300018980|Ga0192961_10096596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani893Open in IMG/M
3300018982|Ga0192947_10019914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1785Open in IMG/M
3300019036|Ga0192945_10101132All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani907Open in IMG/M
3300019036|Ga0192945_10124225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani824Open in IMG/M
3300019048|Ga0192981_10049335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1515Open in IMG/M
3300019048|Ga0192981_10049343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1515Open in IMG/M
3300019050|Ga0192966_10303096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300019149|Ga0188870_10126076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani598Open in IMG/M
3300019153|Ga0192975_10268660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani577Open in IMG/M
3300019459|Ga0181562_10085814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1823Open in IMG/M
3300020205|Ga0211731_10402507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2067Open in IMG/M
3300020382|Ga0211686_10220236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani782Open in IMG/M
3300020410|Ga0211699_10190866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani780Open in IMG/M
3300020505|Ga0208088_1011323All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1236Open in IMG/M
3300021169|Ga0206687_1032788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1181Open in IMG/M
3300021345|Ga0206688_10534660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1372Open in IMG/M
3300021365|Ga0206123_10075087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1667Open in IMG/M
3300021950|Ga0063101_1045868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1123Open in IMG/M
3300021962|Ga0222713_10304285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1014Open in IMG/M
3300022752|Ga0214917_10300445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani714Open in IMG/M
3300023175|Ga0255777_10322597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani865Open in IMG/M
3300024343|Ga0244777_10875169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300024346|Ga0244775_10236968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1523Open in IMG/M
3300025699|Ga0209715_1218626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani582Open in IMG/M
3300025704|Ga0209602_1091247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1100Open in IMG/M
3300025732|Ga0208784_1215432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300025830|Ga0209832_1021115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2691Open in IMG/M
3300025869|Ga0209308_10299974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani671Open in IMG/M
3300025872|Ga0208783_10196026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium838Open in IMG/M
3300025892|Ga0209630_10408186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani585Open in IMG/M
3300025894|Ga0209335_10114266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1383Open in IMG/M
3300025897|Ga0209425_10096653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1766Open in IMG/M
3300027159|Ga0208020_1014690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1548Open in IMG/M
3300027188|Ga0208921_1024413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani919Open in IMG/M
3300027708|Ga0209188_1265868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani585Open in IMG/M
3300027753|Ga0208305_10235271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani652Open in IMG/M
3300027791|Ga0209830_10254178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium796Open in IMG/M
3300027810|Ga0209302_10085589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1611Open in IMG/M
3300027833|Ga0209092_10136751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1423Open in IMG/M
3300027906|Ga0209404_10684693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300027971|Ga0209401_1279101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani588Open in IMG/M
3300027976|Ga0209702_10352220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani589Open in IMG/M
3300027983|Ga0209284_10109775All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1463Open in IMG/M
3300028137|Ga0256412_1101801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1044Open in IMG/M
3300028412|Ga0306910_1011722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1652Open in IMG/M
3300030671|Ga0307403_10735629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300030699|Ga0307398_10073326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1588Open in IMG/M
3300030699|Ga0307398_10143327All Organisms → Viruses → Predicted Viral1226Open in IMG/M
3300030699|Ga0307398_10831102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300030709|Ga0307400_10366865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani915Open in IMG/M
3300030709|Ga0307400_10481119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum785Open in IMG/M
3300030774|Ga0074007_10683630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida549Open in IMG/M
3300031036|Ga0073978_1500206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani533Open in IMG/M
3300031569|Ga0307489_10372139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani944Open in IMG/M
3300031621|Ga0302114_10090593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1423Open in IMG/M
3300031622|Ga0302126_10087438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1234Open in IMG/M
3300031622|Ga0302126_10117194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1021Open in IMG/M
3300031658|Ga0307984_1165193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani614Open in IMG/M
3300031710|Ga0307386_10363405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani739Open in IMG/M
3300031734|Ga0307397_10496371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300031734|Ga0307397_10572737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300031743|Ga0307382_10538120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300032011|Ga0315316_11188746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani613Open in IMG/M
3300032470|Ga0314670_10194041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1015Open in IMG/M
3300032470|Ga0314670_10215271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum971Open in IMG/M
3300032481|Ga0314668_10117570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1279Open in IMG/M
3300032517|Ga0314688_10345060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani801Open in IMG/M
3300032519|Ga0314676_10074519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1584Open in IMG/M
3300032615|Ga0314674_10372014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani744Open in IMG/M
3300032617|Ga0314683_10094507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1643Open in IMG/M
3300032650|Ga0314673_10341521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani764Open in IMG/M
3300032732|Ga0314711_10639078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300032756|Ga0315742_13169974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida530Open in IMG/M
3300034068|Ga0334990_0116931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1447Open in IMG/M
3300034096|Ga0335025_0671064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300034168|Ga0335061_0617700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine17.53%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine9.09%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine7.79%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.49%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater5.84%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.84%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh5.84%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater3.25%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.60%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.60%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.95%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.95%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.95%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.95%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.95%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.95%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.95%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.95%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.30%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.30%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.65%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.65%
MarineEnvironmental → Aquatic → Marine → Oceanic → Abyssal Plane → Marine0.65%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.65%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.65%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.65%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.65%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.65%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.65%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.65%
Marine Subseafloor AquiferEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer0.65%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.65%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.65%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.65%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.65%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.65%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.65%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.65%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.65%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.65%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000136Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S1 sample ANT 02_9.5mEnvironmentalOpen in IMG/M
3300001263Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY83Host-AssociatedOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004870Mid-Atlantic Ridge North Pond Expedition - Sample Bottom Water CTD 2012EnvironmentalOpen in IMG/M
3300005043Mid-Atlantic Ridge North Pond Expedition - Sample 1382AEnvironmentalOpen in IMG/M
3300005838Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNAEnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006352Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNAEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300007651Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3EnvironmentalOpen in IMG/M
3300007658Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3EnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008259Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NAEnvironmentalOpen in IMG/M
3300008966Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-53-LTREnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009538Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2WEnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013115Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300016882Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with 33 psu seawater, 19 C, 33 psu salinity and 331 ?mol photons light - Strombidium rassoulzadegani ras09 (MMETSP0449_2)Host-AssociatedOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300020410Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148)EnvironmentalOpen in IMG/M
3300020505Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300023175Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaGEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025704Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025830Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300027159Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)EnvironmentalOpen in IMG/M
3300027188Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027971Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027976Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027983Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028412Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698 (v2)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030774Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031036Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M
3300034096Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098EnvironmentalOpen in IMG/M
3300034168Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOWin2010_1018027013300000117MarineRNYDCLTDRDRQDMLVDEIFALYLYRMSNRINKNYYRIVLAYVIFFRECLNEYGWGKKIESEGIKLESNLELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD*
KGI_S1_ANT02_95mDRAFT_1006563613300000136MarineMLVDEIFALYLYRMSNRINQFYYKIVLAYVIFFRECLNEYGWGKKIESEGIRLENNPELKMDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFQCQFTCSKLTMIA*
BBAY83_1003823823300001263Macroalgal SurfaceMSNRINQFYYKIVLAYVIFFRECLNEYGWGKKIESEGIRLETNPELKMDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFQCQFTCSKLTMIA*
B570J40625_10022632913300002835FreshwaterMLVDEIFALYLYRMSNRINQNYYKIVLAYVIFFRECLNEYGWGKKIESECIKLESNPELKSDIASKQFCLVNNAEHAPEICNEFVTVYMEYKKSIFDIAKHDQIDLTINLCHWLFQC*
B570J40625_10046206133300002835FreshwaterMLVDEIFALYLYRMSNRINQNYYKTVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEFKLDIETKLFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD*
Ga0063356_10128024133300004463Arabidopsis Thaliana RhizosphereMKVDEIFALYLYQISRKVNEVFYKTVLTYVILFRECLNDIGWGKRAESEDIKVETNSQYKHDMETKAFCLYNNAEHAPEICNEFVTVFMENKRGQCEISKPDQIDLTINLCHWLFENQFTCSKLTMIT*
Ga0071103_14313823300004870MarineMLVDEIFALYLYRMSNRINLTYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLENNPVLKIDIETKQFCLVNNAEHAPEICNEFVTVYMEYK
Ga0071100_101587023300005043Marine Subseafloor AquiferMSCLPPNANPSKWNRNYDNLTDKDRQEMLVDEIFALYLYRMSNRINQSYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLENNPELKLDIETRQFCLVNNAEHAPEICNEFVTVYMEYKKSIYDIPKHDQIDLTINLCHWLFECQFTCSKLTMIA*
Ga0008649_1015969913300005838MarineKDRQEMLVDEIFSLYLYRMSNRINQTYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLEGNPVLKIDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD*
Ga0070743_1004486023300005941EstuarineMMPANYAYSQLPSLTTLPPTANPSKWKRNYDNLSSQDRQEMLVDEIFALYLYRMSNRINQFYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLENNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFQCQFTCSKLTMIA*
Ga0070743_1017639913300005941EstuarineMLVDEIFALYLYRMSNRINKNYYRIVLAYVIFFRECLNEYGWGKKIESEGIKLESNLELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD*
Ga0075466_114770513300006029AqueousMLVDEIFALYLYRMSNRINQFYYKIVLAYVIFFRECLNEYGWGKKIESEGIRLENNPELKIDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIYDIPKHDQIDLTINLCHWLF*
Ga0075448_1025866513300006352MarinePQKWQRNYDNLSPGDRTDMLVDEIFALYLYRMSNRINQYYYKIVLAYVIFFRECLNEYGWGKKIESEGIRLDNNPDLKKDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIYDIPKHDQVDLTINLCHWLFQCQFTCSKLTMIA*
Ga0075471_1012036513300006641AqueousLPPNANPQRWKRNYDNLSIQDRQEMLVDEIFALYLYRMSCRINHSYYKIVLAYVIFFRECLNEYGWAKKIESESIRLENNPDMKMEIESKQFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD*
Ga0075471_1063353013300006641AqueousQNQSSELSMPKASYHTNLPANANQSKWKRNYDTLSIQDRQEMLVDEIFALYLYRMSNRINQYYYKIVLAYVIFFRECLNEYGWAKRIESEGIRLENNPDMKADIENKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD*
Ga0075467_1070842813300006803AqueousKWQRNYDNLTDKDRQEMLVDEIFALYLYRMSNRINQNYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLEGNPVLKIDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD*
Ga0075472_1061660313300006917AqueousRNYDNLSIQDRQEMLVDEIFALYLYRMSNRINQYYYKIVLAYVIFFRECLNEYGWAKRIESEGIRLENNPDMKADIENKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD*
Ga0075469_1007136713300007231AqueousMLVDEIFALYLYRMSNRINQFYYKIVLAYVIFFRECLNEYGWGKKIESEGIRLENNPELKIDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKN
Ga0105019_104979363300007513MarineVSNLPLGAKPEKWQRYYDNLTDKDRQDMLVDEIFALYLYRMSNRINQNYYRTVLAYVIFFRECLNEYGWGKKIESEAIRLDNNPELKMDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKSLIDIPKHDQIDLTINLCHWLFECQFTCSKLTMVA*
Ga0105019_124232613300007513MarineMQGGYQQEGLGDQYAAYNNYKVTLPATANPQKWQRNYDNLSPTDRTDMLVDEIFALYLYRMSNRINQYYYKIVLAYVVFFRECLNEYGWGKKIESEGIRLDNNPELKSDIENKQFCLVNNAEHAPEICNEFVTVYMEYKKNIYDIPKHDQVDLTINLCHWLFQCQFTCSKLTMIA*
Ga0105050_1012783823300007516FreshwaterMLVDEIFALYLYRMSNRINQFYYKIVLAYVIFFRECLNEYGWGKKIESEGIRLENNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIYDIPKHD*
Ga0102900_102318023300007651EstuarineMMPANYAYSQLPSLTTLPPTANPSKWKRNYDNLSSQDRQEMLVDEIFALYLYRMSNRINQFYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLENNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYK
Ga0102898_107060413300007658EstuarineYDNLSSQDRQEMLVDEIFALYLYRMSNRINQFYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLENNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFQCQFTCSKLTMIA*
Ga0102910_113416113300007667EstuarineLYRMSNRINQFYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLENNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFQCQFTCSKLTMIA*
Ga0105749_103594813300007864Estuary WaterLTDNDRQEMLVDEIFALYLYRMSNRINRSYYKTVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDIANKQFCLVNNAEHAPEICNEFVTVYMEYKKSIIDIPKHDQIDLTINLCHWLFQCQFTCSKLTMIG*
Ga0114354_104411413300008119Freshwater, PlanktonMQPAILNNQMNSGNDVPPIPNKSKWQRNYDLLNDSDRQEMLVDEIFALYLYRMSNRINQNYYRIVLAYVIFFRECLNEYGWGKKIESECIKLESNPELKNDITNKQFCLVNNAEHAPEICNEFVTVYMEYKKSIFDIAKHD*
Ga0114841_111250813300008259Freshwater, PlanktonMLVDEIFALYLYRMSNRINQNYYKIVLAYVIFFRECLNEYGWGKKIESECIKLESNPELKSDIASKQFCLVNNAEHAPEICNEFVTVYME
Ga0114357_112781323300008966Freshwater, PlanktonMNSGNDVPPIPNKSKWQRNYDLLNDSDRQEMLVDEIFALYLYRMSNRINQNYYRIVLAYVIFFRECLNEYGWGKKIESECIKLESNPELKNDITNKQFCLVNNAEHAPEICNEFVTVYMEYKKSIFDIAKHD*
Ga0102810_102970713300009002EstuarineMPDKLNGNAMGQIQDPQGYSTYAAQNQTSTLPLNANTKKWRRNYDNLSSADRNEMLVDEIFALYLYRMSNRINQFYYRIVLAYTIFFRECLNEYGWGKKIESEGIRLENNPELKVDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFQC*
Ga0114973_1029544923300009068Freshwater LakeMLVDEIFALYLYRMSNRINQNYYRIVLAYVIFFRECLNEYGWGKKIESECIKLESNPELKNDITNKQFCLVNNAEHAPEICNEFVTVYMEYKKSIFDIAKHD*
Ga0115566_1010562133300009071Pelagic MarineMLVDEIFALYLYRMSNRINQNYYKTVMAYVIFFRECLNEYGWGKKIESEGIRLDTNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIA*
Ga0115566_1010953113300009071Pelagic MarineMTGNGFPQMMAPVPGASVSNLPPSANPQKWKRNYDCLTDRDRQDMLVDEIFALYLYRMSNRINKNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLETNMELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIS*
Ga0102815_1027480523300009080EstuarineMNMYNNPAMASGGTTTQQLPPTANPKKWKRNYDCLTDRDRQDMLVDEIFALYLYRMSNRINQNYYRTVLAYVIFFRECLNEYGWGKKIESEGIKLESNIELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIS*
Ga0102815_1036821713300009080EstuarineHTNGASSNNGRKDGEAYDGDTAGSNMMPANYAYSQLPSLTTLPPTANPSKWKRNYDNLSSQDRQEMLVDEIFALYLYRMSNRINQFYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLENNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFQCQFTCSKLTMIA*
Ga0114959_1058520413300009182Freshwater LakeMNSGNEVPPIVNKSKWQRNYDLLNDSDRQEMLVDEIFALYLYRMSNRINQNYYRIVLAYVIFFRECLNEYGWGKKIESECIKLESNPELKNDITNKQFCLVNNAEHAPEICNEFVTVYMEYKKSIFDIAKHD*
Ga0103872_103309423300009263Surface Ocean WaterMLVDEIFALYLYRMSNRINQTYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLEGNPVLKIDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD*
Ga0103873_104372823300009265Surface Ocean WaterMLVDEIFALYLYRMSNRINQNYYKIVLAYVIFFRECLNEYGWGKKIESEGIRLESNVELKNDIEKKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIS*
Ga0103873_106665713300009265Surface Ocean WaterMLVDEIFALYLYRMSNRINQNYYRTVLAYVIFFRECLNEYGWGKKIESEGIKLESNLELKQDIEKKLFCSVNNAEHAPEICNEFVTVYMEYKKSIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIS*
Ga0115562_114733523300009434Pelagic MarineMGASVYPQSMMAPVQGSSISNLPPSANPAKWKRNYDCLTDRDRQDMLVDEIFALYLYRMSNRINKNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLESNMELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQVTCSRLTMIS*
Ga0115008_1007575553300009436MarineMLVDEIFALYLYRMSNRINQNYYRTVLAYVIFFRECLNEYGWGKKIESEAIRLDNNPELKMDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKSLIDIPKHDQIDLTINLCHWLFECQFTCSKLTMVA*
Ga0115008_1020317133300009436MarineLTDNDRQEMLVDEIFALYLYRMSNRINRSYYKTVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDIANKQFCLVNNAEHATEICNEFVTVYMEYKKSIIDIPKHDQIDLTINHCHWLFQC
Ga0115008_1103543813300009436MarineMGASVYPQSMMAPVQGSSISNLPPSANPAKWKRNYDCLTDRDRQDMLVDEIFALYLYRMSNRINKNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLESNMELKQDIERKLFCSVNNAEHAPEICNEFV
Ga0115007_1004867243300009441MarineVSNLPAGAKPEKWQRYYDNLTDKDRQDMLVDEIFALYLYRMSNRINQNYYRTVLAYVIFFRECLNEYGWGKKIESEAIRLDNNPEMKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKSLIDIPKHD*
Ga0115563_120844913300009442Pelagic MarineASVYPQSMMAPVQGSSISNLPPSANPAKWKRNYDCLTDRDRQDMLVDEIFALYLYRMSNRINKNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLESNMELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIS*
Ga0126448_101800313300009466Meromictic PondMSNRINYNYYKTVMAYVIFFRECLNEYGWGKKIESEGIRLDNNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD*
Ga0115571_105529713300009495Pelagic MarineMPGQMGASVYPQSMMAPVQGSSISNLPPSANPAKWKRNYDCLTDRDRQDMLVDEIFALYLYRMSNRINKNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLESNMELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIS*
Ga0115570_1003786933300009496Pelagic MarineMLVDEIFALYLYRMSNRINRSYYKTVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDIANKQFCLVNNAEHAPEICNEFVTVYMEYKKSIIDIPKHDQIDLTINLCHWLFQCQFTCSKLTMIG*VC*
Ga0115569_1007064523300009497Pelagic MarineMLGGMQPNGTNGAGSNPYAPSMMAPTHGNQISNLPPTANPAKWKRNYDCLTDRDRQDMLVDEIFALYLYRMSNRINKNYYRIVLAYVIFFRECLNEYGWGKKIESECIKLESNLELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIS*
Ga0115569_1016257223300009497Pelagic MarineLTDNDRQEMLVDEIFALYLYRMSNRINRSYYKTVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDIANKQFCLVNNAEHAPEICNEFVTVYMEYKKSIIDIPKHDQIDLTINLC
Ga0129287_1006559813300009538Beach Aquifer PorewaterMLVDEIFALYLYRMSNRINQFYYKIVLAYVVFFRECLNEYGWGKKIESEGIRLENNPELKMDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFQC*
Ga0115006_1097039113300009544MarineMLVDEIFALYLYRMSNRINQNYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLEGNPVLKIDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD*
Ga0115006_1143680313300009544MarineALYLYRMSNRINKNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLESNMELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIS*
Ga0115011_1155188513300009593MarineMGGNGYPQSMNAVPGASVSNLPPSANPQKWKRNYDCLTDRDRQDMLVDEIFALYLYRMSNRINKNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLETNMELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQF
Ga0115001_1022339423300009785MarineMLVDEIFALYLFRMSNRINQNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDVTVKQFCMVNNGEHAPEICNEFVTVYMEYKKSIIDIAKHDQIDLTINLCHWLF*
Ga0136655_116799113300010316Freshwater To Marine Saline GradientLTDKDRQEMLVDEIFALYLYRMSNRINQNYYKTVMAYVIFFRECLNEYGWGKKIESEGIKLESNLELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD*
Ga0129333_1037307313300010354Freshwater To Marine Saline GradientMEMLVDEILALYLYRMSNRINENYYKTVLFYVIFFRECLNEYGWGKKIESEGIKLDQNPDLKNDITTKLYCEHNNAEHAPEICNEFVTVYMEYKKAIYDIPKHDQIDLTINLCHWLFEC*
Ga0129324_1017790023300010368Freshwater To Marine Saline GradientMSNRINQNYYRTVLAYVIFFRECLNEYGWGKKIESEGIKLESNIELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIS*
Ga0163180_1121533513300012952SeawaterMAGMAPSRMTTLPPNANPTKWHRNYDNLTDKDRQEMLVDEIFSLYLYRMSNRINQTYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLEGNPVLKMDIETKQFCLVNNAEHAPEICNEFASELLSKYL*
Ga0163111_1018117123300012954Surface SeawaterMMPPSHGNQISNLPPSANPAKWKRNYDCLTDRDRQDMLVDEIFALYLYRMSNRINKNYYRIVLAYVIFFRECLNEYGWGKKIESEGIKLESNLELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIS*
Ga0163111_1233214713300012954Surface SeawaterDRQEMLVDEIFALYLYRMSNRINFNYYRIVLAYVIFFRECLNEYGWGKKIESESIKLESRPDLKQEIANKQFCLVNNAEHAPEICNELVTVYMEYKKSIFEIPKHDQIDLTINLCHWLFQCQFTCSKLSLIG*
Ga0129338_139000813300012970AqueousMMPANYAYSQLPSLTTLPPTANPSKWKRNYDNLSSQDRQEMLVDEIFALYLYRMSNRINQFYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLENNPELKLDIETKQFCLVNNAEHAPE
Ga0171651_114741333300013115MarineMLVDEIFALYLYRMSNRINQNYYRTVLAYVIFFRECLNEYGWGKKIESEAIRLDNNPELKMDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKSLIDIPKHDQIDLTINLCHWL
Ga0186577_10184333300016882Host-AssociatedMTPLPPTADPKKWRRNYDNLGDKDRQEMLVDEIFALYLYRMSNRVNQYYYKIVLAYVIFFRECLNEYGWGKKIESENINIDSNPELKQDIETKLFCLVNNAEHAPEICNEFVTVYMEYKKTIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIA
Ga0181403_105229823300017710SeawaterMSNRINKNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLETNMELKQDIERKFFCSMNNAEHAPEICNEFVTVYMEHKKNIFYIPKHNQIDLTINLCHWLFECQFTCSKLTMIS
Ga0181433_111850313300017739SeawaterMLVDEIFALYLYRMSNRINRTYYKTVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDIANKQFCLVNNAEHAPEICNEFVTVY
Ga0181393_111799613300017748SeawaterMLVDEIFALYLYRMSNRINQSYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLENNPELKSDIANKQFCLVNNAEHAPEICNEFVTVYMEYKKSIIDIAKHDQIDLTINLCHWLFQCQFTCSKLTMIG
Ga0181379_110267313300017783SeawaterTPNIPNLSDLPPMNGQGELPPTANKSKWQRNYDLLTDKDRQEMLVDEIFALYLYRMSNRINQSYYKIVLAYVIFFCECLNEYGWGKKIESEGIKLENNPELKSDIANKQFCLVNNAEHAPEICNEFVTVYMEYKKSIIDIAKHDQIDLTINLCHWLFQCQFTCSKLTMIG
Ga0181379_117512113300017783SeawaterVHEVTAQSKSKWQRNYDLLTDNDRQEMLVDEIFALYLYRMSNRINQNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDVANKQFCMVNNAEHAPEICNEFVTVYMEYKKSIIDIAKHD
Ga0181565_1059052113300017818Salt MarshMLVDEIFALYLYRMSNRINKNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLETNMELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFEC
Ga0181572_1051733713300018049Salt MarshMLVDEIFALYIYRMSNRINYNYYKTVMAYVIFFRECLNEYGWGKKIESEGIRLDNNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD
Ga0181561_1024439113300018410Salt MarshWQRNYDNLTDKDRQEMLVDEIFALYLYRMSNRINYNYYKTVMAYVIFFRECLNEYGWGKKIESEGIRLDNNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD
Ga0181561_1028391713300018410Salt MarshYLYRMSNRINQNYYKTVMAYVIFFRECLNEYGWGKKIESEGIRLDTNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIA
Ga0181559_1037727013300018415Salt MarshLPQNANPQRWQRNYDNLTDKDRQEMLVDEIFALYLYRMSNRINQNYYKTVMAYVIFFRECLNEYGWGKKIESEGIRLDTNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIA
Ga0181563_1047556913300018420Salt MarshMLVDEIFALYLYRMSNRINYNYYKTVMAYVIFFRECLNEYGWGKKIESEGIRLDNNPELKLDSETKQICLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD
Ga0181566_1025063723300018426Salt MarshMLVDEIFALYLYRMSNRINYNYYKTVMAYVIFFREWLNEYGWGKKIESEGIRLDNNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKK
Ga0192944_101589023300018692MarineMQGNAPPRDMQKEMTAQSKSKWQRNYDLLTDNDRQEMLVDEIFALYLFRMSNRINQNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDVANKQFCMVNNGEHAPEICNEFVTVYMEYKKSIIDIAKHDQIDLTINLCHWLF
Ga0193253_104688813300018846MarineMLCDEIFALYLYRMSNRINIQYYKIVLAYVIFFRECLNQYGWAKKIESEGIKIDCNPEMKLDIETKLFCLVNNAEHAPEICNEFVTVYMEYKKNVFYIPKYD
Ga0193260_1009421323300018928MarineMLVDEIFALYLYRMSNRINQNYYRTVLAYVIFFRECLNEYGWGKKIESEAIRLDNNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKSLIDIPKHD
Ga0192961_1009659613300018980MarineMGQGMPPVMNEMPAMAVQGELPPTANKSKWQRNYDLLTDNDRQEMLVDEIFALYLYRMSNRINRTYYKTVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDIANKQFCLVNNAEHAPEICNEFVTVYMEYKKSIIDIPKHDQIDLTINLCHWLFQCQFTCSKLTMIG
Ga0192947_1001991433300018982MarineMQGNAPPRDMQKEMTAQSKSKWQRNYDLLTDNDRQEMLVDEIFALYLFRMSNRINQNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDVANKQFCMVNNGEHAPEICNEFVTVYMEYKKSIIDIAKHD
Ga0192945_1010113223300019036MarineMMPNQYGPPMMDALNGQVCELPPSANKSKWQRNYDLLTDKDRQEMLVDEIFALYLYRMSNRINQTYYKTVLAYVIFFRECLNEYGWGKKIESEGIKLENNPELKSNIANKQFCLVNNAEHAPEICNEFVTVYMEYKKSIIDIAKHDQIDLTINLCHWLFQCQFTCSKLTMIG
Ga0192945_1012422513300019036MarineMPAMAVQGELPPTANKSKWQRNYDLLTDNDRQEMLVDEIFALYLYRMSNRINRTYYKTVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDIANKQFCLVNNAEHAPEICNEFVTVYMEYKKSIIDIPKHDQIDLTINLCHWLFQCQFTCSKLTMIG
Ga0192981_1004933523300019048MarineMLVDEIFALYLYRMSNRINQNYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLEGNPVLKIDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD
Ga0192981_1004934323300019048MarineLSTLPPSANPIKWTRNYDNLTDKDRQEMLVDEIFALYLYRMSNRINQNYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLEGNPVLKIDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD
Ga0192966_1030309613300019050MarineAKWKRNYDCLTDRDRQDMLVDEIFALYLYRMSNRINKNYYRIVLAYVIFFRECLNEYGWGKKIESEGIKLESNLELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFEC
Ga0188870_1012607613300019149Freshwater LakeMLVDEIFALYLYRMSNRINQNYYKTVLAYVVFFRECLNEYGWGKKIESEGIRLDNNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIIDIPKHDQIDLTINLCHWLFEC
Ga0192975_1026866013300019153MarineDRQEMLVDEIFALYLYRMSNRINRTYYKTVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDIANKQFCLVNNAEHAPEICNEFVTVYMEYKKSIIDIPKHDQIDLTINLCHWLFQCQFTCSKLTMIG
Ga0181562_1008581423300019459Salt MarshMLVDEIFALYLYRMSNRINYNYYKTVMAYVIFFRECLNEYGWGKKIESEGIRLDNNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD
Ga0211731_1040250713300020205FreshwaterMQPAILNNQMNSGNDVPPIPNKSKWQRNYDLLNDSDRQEMLVDEIFALYLYRMSNRINQNYYRIVLAYVIFFRECLNEYGWGKKIESECIKLESNPELKNDITNKQFCLVNNAEHAPEICNEFVTVYMEYKKSIFDIAKHD
Ga0211686_1022023613300020382MarineMMGGMPPAGTNGVGSNPYAPIMMPPSHGNQISNLPPSANPAKWKRNYDCLTDRDRQDMLVDEIFALYLYRMSNRINKNYYRIVLAYVIFFRECLNEYGWGKKIESEGIKLESNLELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFEC
Ga0211699_1019086613300020410MarinePPSNIPGMGPAMPPLHDLPHMNGSGELPPTANKSKWQRNYDLLTDKDRQEMLVDEIFALYLYRMSNRINQNYYRIVLAYVIFFRECLNEYGWGKKIESEGIKLENNPELKSDIANKQFCLVNNAEHAPEICNEFVTVYMEYKKSIIDIAKHDQIDLTINLCHWLFQCQFTCSKLTMIG
Ga0208088_101132333300020505FreshwaterMLVDEIFALYLYRMSNRINQNYYKTVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEFKLDIETKLFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD
Ga0206687_103278813300021169SeawaterMLVDEIFALYLYRMSNRINHTYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLENNPVLKIDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIA
Ga0206688_1053466033300021345SeawaterMLVDETFALYLYRMSNRINQNYYKTVLAYVVFFRECLNEYGWGKKIESEGIRLDNNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIIDIPKHD
Ga0206123_1007508713300021365SeawaterMLVDEIFALYLYRMSNRINKNYYRIVLAYVIFFRECLNEYGWGKKIESEGIKLESNLELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD
Ga0063101_104586833300021950MarineMLVDEIFALYLYRMSNRINQNYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLEGNPVLKIDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFD
Ga0222713_1030428513300021962Estuarine WaterMLVDEIFALYLYRMSNRINQNYYRTVLAYVIFFRECLNEYGWGKKIESEGIKLESNVELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIS
Ga0214917_1030044523300022752FreshwaterMLVDEIFALYLYRMSNRINQNYYRIVLAYVIFFRECLNEYGWGKKIESECIKLESNPELKNDITNKQFCLVNNAEHAPEICNEFVTVYMEYKKTIFDIAKHD
Ga0255777_1032259733300023175Salt MarshMLVDEIFALYLYRMSNRINKNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLETNMELKQDIERKLFCSVNNAEHAPEICNEFVTV
Ga0244777_1087516923300024343EstuarineDEIFALYLYRMSNRINQFYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLENNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFQCQFTCSKLTMIA
Ga0244775_1023696813300024346EstuarineMMPANYAYSQLPSLTTLPPTANPSKWKRNYDNLSSQDRQEMLVDEIFALYLYRMSNRINQFYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLENNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFQCQFTCSKLTMIA
Ga0209715_121862613300025699Pelagic MarineNRINKNYYRIVLAYVIFFRECLNEYGWGKKIESECIKLESNLELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMISXRHVGLIKPNYYPATFSSYP
Ga0209602_109124713300025704Pelagic MarineLTDNDRQEMLVDEIFALYLYRMSNRINRSYYKTVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDIANKQFCLVNNAEHAPEICNEFVTVYMEYKKSIIDIPKHDQIDLTINLCHWLFQCQFTCSKLTMIG
Ga0208784_121543213300025732AqueousANANQSKWKRNYDNLSIQDRQEMLVDEIFALYLYRMSNRINQYYYKIVLAYVIFFRECLNEYGWAKRIESEGIRLENNPDMKADIENKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD
Ga0209832_102111543300025830Pelagic MarineMLVDEIFALYLYRMSNRINRSYYKTVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDIANKQFCLVNNAEHAPEICNEFVTVYMEYKKSIIDIPKHDQIDLTINLCHWLFQCQFTCSKLTMIGXVC
Ga0209308_1029997413300025869Pelagic MarineKRNYDCLTDRDRQDMLVDEIFALYLYRMSNRINKNYYRIVLAYVIFFRECLNEYGWGKKIESEGIKLESNLELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD
Ga0208783_1019602623300025872AqueousLPPNANPQRWKRNYDNLSIQDRQEMLVDEIFALYLYRMSCRINHSYYKIVLAYVIFFRECLNEYGWAKKIESESIRLENNPDMKMEIESKQFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD
Ga0209630_1040818613300025892Pelagic MarineNRINKNYYRIVLAYVIFFRECLNEYGWGKKIESEGIKLESNLELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD
Ga0209335_1011426613300025894Pelagic MarineLPQNANPQRWQRNYDNLTDKDRQEMLVDEIFALYLYRMSNRINQNYYKTVMAYVIFFRECLNEYGWGKKIESEGIRLDTNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTM
Ga0209425_1009665313300025897Pelagic MarineMMAPVPGASVSNLPPSANPQKWKRNYDCLTDRDRQDMLVDEIFALYLYRMSNRINKNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLETNMELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIS
Ga0208020_101469013300027159EstuarineMPDKLNGNAMGQIQDPQGYSTYAAQNQTSTLPLNANTKKWRRNYDNLSSADRNEMLVDEIFALYLYRMSNRINQFYYRIVLAYTIFFRECLNEYGWGKKIESEGIRLENNPELKVDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFQC
Ga0208921_102441313300027188EstuarineMMPANYAYSQLPSLTTLPPTANPSKWKRNYDNLSSQDRQEMLVDEIFALYLYRMSNRINQFYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLENNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFQCQFTCSKLTM
Ga0209188_126586823300027708Freshwater LakeMNSGNEVPPIVNKSKWQRNYDLLNDSDRQEMLVDEIFALYLYRMSNRINQNYYRIVLAYVIFFRECLNEYGWGKKIESECIKLESNPELKNDITNKQFCLVNNAEHAPEICNEFVTVYMEYKKSIFD
Ga0208305_1023527113300027753EstuarineMMPANYAYSQLPSLTTLPPTANPSKWKRNYDNLSSQDRQEMLVDEIFALYLYRMSNRINQFYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLENNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYME
Ga0209830_1025417813300027791MarineMLVDEIFALYLFRMSNRINQNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDVTVKQFCMVNNGEHAPEICNEFVTVYMEYKKSIIDIAKHDQID
Ga0209302_1008558923300027810MarineVTVSNLPAGAKPEKWQRYYDNLTDKDRQDMLVDEIFALYLYRMSNRINQNYYRTVLAYVIFFRECLNEYGWGKKIESEAIRLDNNPEMKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKSLIDIPKHD
Ga0209092_1013675113300027833MarineMLVDEIFALYLYRMSNRINQNYYRTVLAYVIFFRECLNEYGWGKKIESEAIRLDNNPELKMDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKSLIDIPKHDQIDLTINLCHWLFECQFTCSKLTMVAXESEDVRFKXYDL
Ga0209404_1068469313300027906MarineMRVDEIFALYLYRMSNRINQNYYKTVLAYVIFFRECLNEYGWGKKIESEGIKLDNNPEMKHDIEHKQFCLENNAEHAPEICNEFVTVYMEYKKSIIDIPKHD
Ga0209401_127910123300027971Freshwater LakeMLVDEIFALYLYRMSNRINQNYYRIVLAYVIFFRECLNEYGWGKKIESECIKLESNPELKNDITNKQFCLVNNAEHAPEICNEFVTVYMEYKKSIFDIAKHD
Ga0209702_1035222013300027976FreshwaterEMLVDEIFALYLYRMSNRINQFYYKIVLAYVIFFRECLNEYGWGKKIESEGIRLENNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIYDIPKHD
Ga0209284_1010977513300027983FreshwaterMLVDEIFALYLYRMSNRINQFYYKIVLAYVIFFRECLNEYGWGKKIESEGIRLENNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIYDIPKHD
Ga0256412_110180123300028137SeawaterMLVDEIFALYLYRMSNRINKNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLETNMELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIS
Ga0306910_101172213300028412Saline LakeMLVDEIFALYLYRMSNRINQFYYKIVLAYVIFFRECLNEYGWGKKIESEGIRLENNPELKMDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFQCQFTCSKLTMIA
Ga0307403_1073562913300030671MarineMLVDEIFALYLYRMSNRINKQYYKIVLAYVIFYRECLNKYGWAKKAECEGTKFVEKEELFCSANNAEHAPEICNEFVTVFMEYKKNVYDIPKYDQIDLTINLCHWLFECQFTCSKLSMI
Ga0307398_1007332633300030699MarineMQGNAPPRDMQKEMTAQSKSKWQRNYDLLTDNDRQEMLVDEIFALYLFRMSNRINQNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDVANKQFCMVNNGEHAPEICNEFVTVYMEYKKSIIDIAK
Ga0307398_1014332713300030699MarineVDEIFALYLYRMSNRINHFYYKIVLAYVIFFRECLNEYGWGKKIESEGIRLENNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKN
Ga0307398_1083110213300030699MarineMLVDEIFALYLYRMSNRINQFYYKIVLACVIFFRECLNEYGWGKKIESEGIRLENNPELKMDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD
Ga0307400_1036686523300030709MarineMMGGMQPTGTNGAISNPYAPSMMAPTHGNQISNLPPTANPAKWKRNYDCLTDRDRQDMLVDEIFALYLYRMSNRINKNYYRIVLAYVIFFRECLNEYGWGKKIESEGIKLESNLELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD
Ga0307400_1048111913300030709MarineMQKEMTAQSKSKWQRNYDLLTDNDRQEMLVDEIFALYLFRMSNRINQNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDVANKQFCMVNNGEHAPEICNEFVTVYMEYKKSIIDIAKHDQIDLTINLCHWLF
Ga0074007_1068363013300030774SoilRNYDNLTDKDRSEILVDEIFALFLYRISLKVNEVYYKIVLIYVILFRECLNEIGWSKRIESEGIKIAENAQLKNDSETKQFCLSNNAEHAPEICNEFVTVFMDNKRGQFEITKIDQIDLTINLCHWLFEN
Ga0073978_150020613300031036MarineGSNQFPPYGQQPKVDDFKMNIPVTTLPASANPQKWQRNYDNLSPGDRTDMLVDEIFALYLYRMSNRINQYYYKIVLAYVIFFRECLNEYGWGKKIESEGIRLDNNPDLKKDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIYDIPKHDQVDLTINLCHWLFQCQFTCSKLTMIA
Ga0307489_1037213913300031569Sackhole BrineMSTLPPTANPSKWNRNYDNLSTRDRQEMLVDEIFALYLYRMANRINQFYYRIVLAYVIFFRECLNEYGWGKKIESEGIRLENNPDLKQDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNILDIPKHDQIDLTINLCHWLF
Ga0302114_1009059313300031621MarineMLVDEIFALYLYRMSNRINKNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLESNMELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIS
Ga0302126_1008743813300031622MarineMLVDEIFALYLYRMSNRINQNYYRTVLAYVIFFRECLNEYGWGKKIESEAIRLDNNPELKMDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKSLVDIPKHD
Ga0302126_1011719413300031622MarineMAPQMMQQAPVSNLPQSAKPEKWQRFYDNLTDKDRQDMLVDEIFALYLYRMSNRINQNYYKTVLAYVVFFRECLNEYGWGKKIESEGIRLDNNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIIDIPKHD
Ga0307984_116519313300031658MarineDKDRQDMLVDEIFALYLYRMSNRINQNYYKTVLAYVVFFRECLNEYGWGKKIESEGIRLDNNPELKLDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIIDIPKHD
Ga0307386_1036340523300031710MarineMLVDEIFALYLYRMSNRINQNYYKTVLAYVIFFRECLNEYGWGKKIESEGIRLEGNPVLKIDIETKQFCLVNNAEHAPEICNEFVTVYMEYKKNIFDI
Ga0307397_1049637113300031734MarineWQRNYDLLTDNDRQEMLVDEIFALYLYRMSNRINRTYYKTVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDIANKQFCLVNNAEHAPEICNEFVTVYMEYKKSIIDIPKHDQIDLTINLCHWLFQCQFTCSKLTMIG
Ga0307397_1057273713300031734MarineNQISNLPPSANPAKWKRNYDCLTDRDRQDMLVDEIFALYLYRMSNRINKNYYRIVLAYVIFFRECLNEYGWGKKIESEGIKLESNLELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFEC
Ga0307382_1053812013300031743MarineMQGNAPPRDMQKEMTAQSKSKWQRNYDLLTDNDRQEMLVDEIFALYLFRMSNRINLNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDVANKQFCMVNNGEHAPEICNEFVTVYMEYKKSIIDIAKHD
Ga0315316_1118874613300032011SeawaterDRDRQDMLVDEIFALYLYRMSNRINKNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLETNMELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIS
Ga0314670_1019404143300032470SeawaterMPGQMGASVYPQSMMAPVQGSSISNLPPSANPAKWKRNYDCLTDRDRQDMLVDEIFALYLYRMSNRINKNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLESNMELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIS
Ga0314670_1021527113300032470SeawaterMTAQSKSKWQRNYDLLTDNDRQEMLVDEIFALYLFRMSNRINQNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDVANKQFCMVNNGEHAPEICNEFVTVYMEYKKSIIDIAKHD
Ga0314668_1011757023300032481SeawaterMTAQSKSKWQRNYDLLTDNDRQEMLVDEIFALYLFRMSNRINQNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDVANKQFCMVNNGEHAPEICNEFVTVYMEYKKSIIDIAKHDQIDLTINLCHWLFQCQFTCSKLTMIG
Ga0314688_1034506023300032517SeawaterMGASVYPQSMMAPVQGSSISNLPPSANPAKWKRNYDCLTDRDRQDMLVDEIFALYLYRMSNRINKNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLESNMELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIS
Ga0314676_1007451913300032519SeawaterMMAPVQGSSISNLPPSANPAKWKRNYDCLTDRDRQDMLVDEIFALYLYRMSNRINKNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLESNMELKQDIERKLFCSVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIS
Ga0314674_1037201423300032615SeawaterMTAQSKSKWQRNYDLLTDNDRQEMLVDEIFALYLFRMSNRINQNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDVANKQFCMVNNGEHAPEICNEFVTVYMEYKKSIIDIAKHDQIDLTINLCHWLFQCQFTCSKLT
Ga0314683_1009450713300032617SeawaterMTAQSKSKWQRNYDLLTDNDRQEMLVDEIFALYLFRMSNRINQNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDVANKQFCMVNNGEHAPEICNEFVTVYMEYKKSIIDIAKHDQIDLTINLCHWLFQCQF
Ga0314673_1034152123300032650SeawaterMTAQSKSKWQRNYDLLTDNDRQEMLVDEIFALYLFRMSNRINQNYYKIVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEMKNDVANKQFCMVNNGEHAPEICNEFVTVYMEYKKSIIDIAKHDQIDLTINLCHWLFQCQFTCSKLTMIGXI
Ga0314711_1063907823300032732SeawaterMLVDEIFALYLFRTSQRVNEDFYKIVLAYVIFFRECLNEIGWNKRLESENIDLNKEPSLAEAVNTQQFCLVNTAEHAPEICNEFVTVYVDQNKHLYEIQRPD
Ga0315742_1316997413300032756Forest SoilSFYLYQLSRKVNEVFYRTVLTYVILFRECLNEIGWNKKMESEDIKLENNPQYKADMDSKQYCLTNNAEHAPEICNEFVTVFMENKRGQCEISKPDQIDLTINLCHWLFENQFTCSKLTMI
Ga0334990_0116931_1192_14463300034068FreshwaterMLVDEIFALYLYRMSNRINQNYYKTVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEFKLDIETKLFCLVNNAEHAPEICNEFV
Ga0335025_0671064_185_5023300034096FreshwaterRMSNRINQNYYKIVLAYVIFFRECLNEYGWGKKIESECIKLESNPELKSDIASKQFCLVNNAEHAPEICNEFVTVYMEYKKSIFDIAKHDQIDLTINLCHWLFQC
Ga0335061_0617700_39_3083300034168FreshwaterMSNRINQNYYKTVLAYVIFFRECLNEYGWGKKIESEGIKLENNPEFKLDIETKLFCLVNNAEHAPEICNEFVTVYMEYKKNIFDIPKHD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.