NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F044520

Metagenome / Metatranscriptome Family F044520

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044520
Family Type Metagenome / Metatranscriptome
Number of Sequences 154
Average Sequence Length 46 residues
Representative Sequence FDPKERYKAGEIISHPEFGRGKIENVLRSSLLVRFPIGGLKSLMLR
Number of Associated Samples 135
Number of Associated Scaffolds 154

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.31 %
% of genes near scaffold ends (potentially truncated) 96.75 %
% of genes from short scaffolds (< 2000 bps) 95.45 %
Associated GOLD sequencing projects 133
AlphaFold2 3D model prediction Yes
3D model pTM-score0.67

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.351 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.688 % of family members)
Environment Ontology (ENVO) Unclassified
(20.779 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(35.714 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 32.43%    Coil/Unstructured: 67.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.67
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 154 Family Scaffolds
PF00072Response_reg 9.74
PF13432TPR_16 3.90
PF00158Sigma54_activat 3.25
PF02518HATPase_c 3.25
PF14559TPR_19 1.95
PF02954HTH_8 1.95
PF0563523S_rRNA_IVP 1.30
PF00206Lyase_1 0.65
PF13277YmdB 0.65
PF01609DDE_Tnp_1 0.65
PF13006Nterm_IS4 0.65
PF00512HisKA 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 154 Family Scaffolds
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.65
COG3293TransposaseMobilome: prophages, transposons [X] 0.65
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.65
COG5421TransposaseMobilome: prophages, transposons [X] 0.65
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.65
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.65

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.35 %
UnclassifiedrootN/A0.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908040|B4_c_ConsensusfromContig144951All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium929Open in IMG/M
2140918008|ConsensusfromContig97472All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium831Open in IMG/M
2189573004|GZGWRS401DSNDDAll Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300001213|JGIcombinedJ13530_103084540All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria712Open in IMG/M
3300001213|JGIcombinedJ13530_109938729All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria675Open in IMG/M
3300002568|C688J35102_119457650All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300004000|Ga0055458_10277388All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300004156|Ga0062589_100518360All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1010Open in IMG/M
3300004157|Ga0062590_100692054All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300005093|Ga0062594_101332152All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300005332|Ga0066388_103102457All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300005332|Ga0066388_107538124All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300005337|Ga0070682_101827876All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300005340|Ga0070689_100913471All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300005341|Ga0070691_10555486All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300005345|Ga0070692_11119556All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300005364|Ga0070673_102297643All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005434|Ga0070709_10185732All Organisms → cellular organisms → Bacteria1463Open in IMG/M
3300005451|Ga0066681_10426126All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300005564|Ga0070664_101764311All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300005577|Ga0068857_100985115All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300005578|Ga0068854_101864018All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005598|Ga0066706_10449109All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300005602|Ga0070762_10335148All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300005617|Ga0068859_101074681All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300005712|Ga0070764_10128902All Organisms → cellular organisms → Bacteria1375Open in IMG/M
3300005764|Ga0066903_103503045All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300005764|Ga0066903_108018140All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300005836|Ga0074470_10279252All Organisms → cellular organisms → Bacteria3519Open in IMG/M
3300005950|Ga0066787_10117293All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300005993|Ga0080027_10428121All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium535Open in IMG/M
3300006358|Ga0068871_101804520All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300006844|Ga0075428_100751446All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1038Open in IMG/M
3300006881|Ga0068865_100031508All Organisms → cellular organisms → Bacteria3536Open in IMG/M
3300007004|Ga0079218_10517230All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300009162|Ga0075423_12408891All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300009179|Ga0115028_10589684All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria828Open in IMG/M
3300010362|Ga0126377_12646294All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium577Open in IMG/M
3300010397|Ga0134124_10568389All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1106Open in IMG/M
3300010399|Ga0134127_10988892All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium901Open in IMG/M
3300010399|Ga0134127_13468997All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300010401|Ga0134121_11400621All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium710Open in IMG/M
3300010403|Ga0134123_10565204All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1085Open in IMG/M
3300010403|Ga0134123_12063396All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium630Open in IMG/M
3300010403|Ga0134123_12357111All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria597Open in IMG/M
3300011120|Ga0150983_11766581All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium642Open in IMG/M
3300011430|Ga0137423_1075101All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1003Open in IMG/M
3300012198|Ga0137364_11172168All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium576Open in IMG/M
3300012212|Ga0150985_103486577All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium654Open in IMG/M
3300012212|Ga0150985_110688842All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1018Open in IMG/M
3300012212|Ga0150985_112596134All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium678Open in IMG/M
3300012212|Ga0150985_118337206All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae985Open in IMG/M
3300012231|Ga0137465_1095002All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium893Open in IMG/M
3300012469|Ga0150984_113489311All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium598Open in IMG/M
3300012469|Ga0150984_114289580All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium641Open in IMG/M
3300012469|Ga0150984_118209106All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium621Open in IMG/M
3300012679|Ga0136616_10329211All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium695Open in IMG/M
3300012913|Ga0157298_10303251All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium567Open in IMG/M
3300012944|Ga0137410_11389803All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium610Open in IMG/M
3300012958|Ga0164299_10151961All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1282Open in IMG/M
3300012971|Ga0126369_11225623All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium840Open in IMG/M
3300014152|Ga0181533_1285865All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria603Open in IMG/M
3300014161|Ga0181529_10043169All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum3262Open in IMG/M
3300014166|Ga0134079_10459393All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium605Open in IMG/M
3300014494|Ga0182017_10562898All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium696Open in IMG/M
3300018057|Ga0187858_10610841All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium657Open in IMG/M
3300018058|Ga0187766_11256607All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium538Open in IMG/M
3300019788|Ga0182028_1412931All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1911Open in IMG/M
3300019788|Ga0182028_1453250All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1739Open in IMG/M
3300020070|Ga0206356_10313662All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium631Open in IMG/M
3300020076|Ga0206355_1272860All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium714Open in IMG/M
3300020080|Ga0206350_10149193All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium716Open in IMG/M
3300021403|Ga0210397_11057463All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium630Open in IMG/M
3300021478|Ga0210402_11827223All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300022467|Ga0224712_10633616All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium523Open in IMG/M
3300022708|Ga0242670_1039234All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium640Open in IMG/M
3300022886|Ga0247746_1220701All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria502Open in IMG/M
3300023263|Ga0247800_1110460All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria565Open in IMG/M
3300024219|Ga0247665_1014601All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium928Open in IMG/M
3300024224|Ga0247673_1032432All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium719Open in IMG/M
3300025322|Ga0209641_10513376All Organisms → cellular organisms → Bacteria → Proteobacteria847Open in IMG/M
3300025627|Ga0208220_1097431All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium794Open in IMG/M
3300025898|Ga0207692_10342059All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300025899|Ga0207642_11040478All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria528Open in IMG/M
3300025913|Ga0207695_11370915All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium587Open in IMG/M
3300025918|Ga0207662_10053248All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum2410Open in IMG/M
3300025934|Ga0207686_10654083All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium832Open in IMG/M
3300025942|Ga0207689_10040762All Organisms → cellular organisms → Bacteria → Proteobacteria3842Open in IMG/M
3300025972|Ga0207668_11340720All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium644Open in IMG/M
3300025981|Ga0207640_11758498All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium560Open in IMG/M
3300026035|Ga0207703_11412342All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria670Open in IMG/M
3300026035|Ga0207703_11627885All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium621Open in IMG/M
3300026078|Ga0207702_10799211All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium932Open in IMG/M
3300026078|Ga0207702_12029810All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium565Open in IMG/M
3300026078|Ga0207702_12387003All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300026095|Ga0207676_11020784All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium816Open in IMG/M
3300026486|Ga0256820_1032177All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria769Open in IMG/M
3300027884|Ga0209275_10426884All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium750Open in IMG/M
3300028381|Ga0268264_10217351All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1758Open in IMG/M
3300028577|Ga0265318_10370444All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria523Open in IMG/M
3300028653|Ga0265323_10100867All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia956Open in IMG/M
3300028666|Ga0265336_10187856All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium614Open in IMG/M
3300028739|Ga0302205_10158333All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium579Open in IMG/M
3300028819|Ga0307296_10342749All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium816Open in IMG/M
3300028869|Ga0302263_10438838All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300029987|Ga0311334_11153116All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria649Open in IMG/M
3300029989|Ga0311365_11962068All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria500Open in IMG/M
3300030000|Ga0311337_11272329All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria644Open in IMG/M
3300030002|Ga0311350_11043164All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria730Open in IMG/M
3300030014|Ga0302175_10177121All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium512Open in IMG/M
3300030114|Ga0311333_10512236All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria984Open in IMG/M
3300030294|Ga0311349_10112034All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum2544Open in IMG/M
3300030336|Ga0247826_10652685All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium812Open in IMG/M
3300031232|Ga0302323_102714549All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium566Open in IMG/M
3300031235|Ga0265330_10486979All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria524Open in IMG/M
3300031241|Ga0265325_10384216All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria617Open in IMG/M
3300031242|Ga0265329_10093389All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria955Open in IMG/M
3300031250|Ga0265331_10158442All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1026Open in IMG/M
3300031344|Ga0265316_10892817All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium621Open in IMG/M
3300031564|Ga0318573_10597285All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium594Open in IMG/M
3300031576|Ga0247727_10683756All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium754Open in IMG/M
3300031712|Ga0265342_10203494All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1074Open in IMG/M
3300031716|Ga0310813_11339631All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium663Open in IMG/M
3300031727|Ga0316576_10355270All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1090Open in IMG/M
3300031740|Ga0307468_101179238All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium689Open in IMG/M
3300031764|Ga0318535_10128649All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1122Open in IMG/M
3300031769|Ga0318526_10324303All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium630Open in IMG/M
3300031769|Ga0318526_10388195All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium571Open in IMG/M
3300031771|Ga0318546_10744892All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium690Open in IMG/M
3300031782|Ga0318552_10728125All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300031792|Ga0318529_10225457All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium871Open in IMG/M
3300031798|Ga0318523_10363689All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium720Open in IMG/M
3300031805|Ga0318497_10319094All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium866Open in IMG/M
3300031846|Ga0318512_10457559All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium645Open in IMG/M
3300031847|Ga0310907_10450650All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium680Open in IMG/M
3300031858|Ga0310892_10913059All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium615Open in IMG/M
3300031879|Ga0306919_10189699All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1522Open in IMG/M
3300031896|Ga0318551_10311484All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium887Open in IMG/M
3300031944|Ga0310884_10287421All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium912Open in IMG/M
3300031996|Ga0308176_11670256All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium679Open in IMG/M
3300032013|Ga0310906_11228782All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium546Open in IMG/M
3300032067|Ga0318524_10693109All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium537Open in IMG/M
3300032068|Ga0318553_10479283All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium652Open in IMG/M
3300032074|Ga0308173_10370730All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1252Open in IMG/M
3300032074|Ga0308173_12340834All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M
3300032075|Ga0310890_11570251All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium544Open in IMG/M
3300033414|Ga0316619_10824821All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria795Open in IMG/M
3300033433|Ga0326726_11072263All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria783Open in IMG/M
3300033487|Ga0316630_10102148All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1923Open in IMG/M
3300033743|Ga0334844_113616All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria536Open in IMG/M
3300033819|Ga0334816_108501All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium509Open in IMG/M
3300034195|Ga0370501_0135504All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria847Open in IMG/M
3300034195|Ga0370501_0324275All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium557Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.69%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen6.49%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere6.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.84%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.55%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.60%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.60%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.60%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.60%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere2.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.95%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.95%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.95%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.95%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.30%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland1.30%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.30%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.30%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil1.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.30%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.30%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.30%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.30%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.30%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.30%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.30%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.65%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.65%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.65%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.65%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.65%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.65%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.65%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.65%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.65%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.65%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.65%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.65%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.65%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.65%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.65%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908040Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4EnvironmentalOpen in IMG/M
2140918008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004000Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005950Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011430Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012231Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012679Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06)EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020076Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022708Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300023263Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6EnvironmentalOpen in IMG/M
3300024219Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06EnvironmentalOpen in IMG/M
3300024224Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025627Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026486Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PR6EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300028653Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaGHost-AssociatedOpen in IMG/M
3300028666Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaGHost-AssociatedOpen in IMG/M
3300028739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_3EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028869Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4EnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030014Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031242Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaGHost-AssociatedOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031727Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033743Peat soil microbial communities from Stordalen Mire, Sweden - 714 E1 5-9EnvironmentalOpen in IMG/M
3300033819Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-MEnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B4_c_050973902124908040SoilTFNPRERYKVGEVXWHPEFGRGXVETVXRSXXLVRXXXGGXKXVMLX
Bog_all_C_028843502140918008SoilTFNPRERYKVGEVIWHPEFGRGKVETVLRSSMLVRFASGGMKSVMLS
FG2_056563502189573004Grass SoilCSKTVNAVEAIKTFDPKNRYKVGEIIFHPEYGRGKIENVLRSSLLVRFPVGGLKSLMLL
JGIcombinedJ13530_10308454023300001213WetlandPFDARERYRVGEVISHPEFGRGKVETVLRSSLLVRFPTGGLKSLMLT*
JGIcombinedJ13530_10993872923300001213WetlandRERYKVGEAISHPDFGRGKVETVLRSSVLVRFANGGLKSLMLT*
C688J35102_11945765023300002568SoilERYRPGDVISHPDYGRGKVETVLRSSLLVRFPQGGLKSLILI*
Ga0055458_1027738823300004000Natural And Restored WetlandsARDRYKVGEVISHPDFGRGKVETVLRSSLLVRFLNGGLKLVMLT*
Ga0062589_10051836033300004156SoilEVAAAATVRVFDPKERYKAGEIIVHAEYGRGKIENVLRSSLLVRFSVGGLKSLMLQ*
Ga0062590_10069205433300004157SoilSAASVRVFDPKERYKAGEIIVHAEYGRGKIENVLRSSLLVRFPIGGLKSLMLV*
Ga0062594_10133215213300005093SoilVKNFDPKERYRPGDIISHLEYGRGKVETVLRSSLLVRFPNGGLKSLLLM*
Ga0066388_10310245733300005332Tropical Forest SoilRYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV*
Ga0066388_10753812413300005332Tropical Forest SoilFDPKERYKAGEIIAHAEFGRGKIENVLRSSLLVRFPVGGLKSLMLS*
Ga0070682_10182787623300005337Corn RhizosphereVRVFDPKERYKAGEIIVHAEYGRGKIENVLRSSLLVRFPIGGLKSLMLV*
Ga0070689_10091347113300005340Switchgrass RhizosphereRYRSGEIIVHPQFGRGKIETVLRSSLLVRFSAGGLKSVMLN*
Ga0070691_1055548613300005341Corn, Switchgrass And Miscanthus RhizosphereEELAAAPDVRLFDPRERYKAGEIISHPEYGRGKIQNVLRSSLLVRFSVGGLKSLMLR*
Ga0070692_1111955623300005345Corn, Switchgrass And Miscanthus RhizosphereAATVRVFDPKERYKAGEIIVHAEYGRGKIENVLRSSLLVRFPIGGLKSLMLV*
Ga0070673_10229764323300005364Switchgrass RhizosphereRVFDPKERYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV*
Ga0070709_1018573233300005434Corn, Switchgrass And Miscanthus RhizosphereAQEVNAAAEIKSFDPKQRYKVGDIIAHPEFGRGKIENVLRSSLLVRFPIGGLKSLMLT*
Ga0066681_1042612613300005451SoilSAATVRVFDPKERYKAGEIIVHPEFGRGKIENVLRSSLLIRFPIGGLKSLMLI*
Ga0070664_10176431123300005564Corn RhizosphereFDPKERYKAGEIIVHAEYGRGKIQNVLRSSLLVRFSVGGLKSLMLQ*
Ga0068857_10098511523300005577Corn RhizosphereKERYKAGEIIVHAEYGRGKIENVLRSSLLVRFPIGGLKSLMLM*
Ga0068854_10186401813300005578Corn RhizosphereVRSFNPKERYKAGEIISHPEYGRGKIENVLRASLLVRFSRAGLKPLMLQ*
Ga0066706_1044910913300005598SoilSAATVRVFDPKERYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLI*
Ga0070762_1033514833300005602SoilTVRVFDPKERYKAGEIIVHPEYGRGKIQNVLRSSLIVRFSAGGLKSLMLM*
Ga0068859_10107468133300005617Switchgrass RhizosphereGEIIVHAEFGRGKIENVLRSSLLVRFAIGGLKSLMLV*
Ga0070764_1012890213300005712SoilRLFDPRERYKAGEIISHPEYGRGKIQNVLRSSLLVRFSVGGLKSLMLR*
Ga0066903_10350304513300005764Tropical Forest SoilFDPKERYKAGEIIAHPEYGRGKIENVLRSSLLVRFPVGGLKSLMLS*
Ga0066903_10801814013300005764Tropical Forest SoilPKERYKAGEIIVHPDFGRGKVENVLRSSLLVRFSVGGLKSLMLV*
Ga0074470_1027925213300005836Sediment (Intertidal)IVHPEFGRGKIENVLRASLLVRFPIGGLKSLMLM*
Ga0066787_1011729313300005950SoilKERYKAGEIIVHPEYGRGKIQNVLRSSLIVRFSAGGLKSLMLM*
Ga0080027_1042812113300005993Prmafrost SoilEIISHAEYGRGKIENVLRSSLLVRFSVGGLKSLMLV*
Ga0068871_10180452023300006358Miscanthus RhizosphereKERYKAGEIIVHAEFGRGKIENVLRASLLVRFPIGGLKSLMLV*
Ga0075428_10075144633300006844Populus RhizosphereVAAAATVRVFDPKERYKAGEIIVHAEYGRGKIENVLRSSLLVRFSVGGLKSLMLQ*
Ga0068865_10003150833300006881Miscanthus RhizosphereKERYKAGEIIVHPEFGRGKIENVLRSSLLVRFPIGGLKSLMLT*
Ga0079218_1051723013300007004Agricultural SoilEEVSAATQVRVFDPKQRYKAGEIIVHPEYGRGKIENVLRSSLLVRFASGGLKSLMLV*
Ga0075423_1240889113300009162Populus RhizosphereKAGEIIVHAEYGRGKIQNVLRSSLLVRFSVGGLKSLMLQ*
Ga0115028_1058968413300009179WetlandAEVRPFDARERYKVGEAISHPDFGRGKVETVLRSSVLVRFANGGLKSLMLT*
Ga0126377_1264629423300010362Tropical Forest SoilGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLL*
Ga0134124_1056838913300010397Terrestrial SoilKQRYKAGDIIAHPEFGRGKVENVLRSSLLVRFGTGGIKSLMLV*
Ga0134127_1098889213300010399Terrestrial SoilERYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV*
Ga0134127_1346899713300010399Terrestrial SoilIISHLEYGRGKVETVLRSSLLVRFANGGLKSLMLM*
Ga0134121_1140062123300010401Terrestrial SoilGDIIAHPEFGRGKVENVLRSSLLVRFSIGGLKSLMLS*
Ga0134123_1056520433300010403Terrestrial SoilKAGEIIVHAEFGRGKIENVLRSSLLVRFAIGGLKSLMLV*
Ga0134123_1206339623300010403Terrestrial SoilRVFDPKERYKAGEIIVHAEFGRGKIENVLRSSLLVRFSIGGLKSLMLQ*
Ga0134123_1235711123300010403Terrestrial SoilGEEVAAAAQVRNFDPKERYKAGEIISHPEYGRGKIENVLRSSLLVRFSVGGLKSLMLL*
Ga0150983_1176658123300011120Forest SoilYKAGEIIAHPVYGRGKIENVLRSSLLVRFSAGGLKSLMLS*
Ga0137423_107510133300011430SoilANAADVKNFDPKERYRPGDVISHLEYGRGKVETVLRSSLLVRFANGGLKSLMLQ*
Ga0137364_1117216823300012198Vadose Zone SoilFDPKERYKAGEIIVHPEFGRGKIENVLRSSLLIRFPIGGLKSLMLI*
Ga0150985_10348657723300012212Avena Fatua RhizosphereERYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLL*
Ga0150985_11068884213300012212Avena Fatua RhizosphereVVTSAAVEVKSFDPKQRYRVGDIISHPEYGRGKIESVLRSSLLVRFAIGGLKSLMLT*
Ga0150985_11259613413300012212Avena Fatua RhizosphereEFDPKERYKAGEIIVHPEYGRGKIENVLRSSLLVRFPVGGLKSLMLS*
Ga0150985_11833720613300012212Avena Fatua RhizosphereLIVHPQFGRGKIETVLRSSLLVRFSAGGLKSVMLN*
Ga0137465_109500213300012231SoilATVRVFDPKERYKPGEIIVHAEYGRGKIENVLRSSLLVRFSVGGLKSLMLQ*
Ga0150984_11348931113300012469Avena Fatua RhizosphereVRSFNPKERYKAGEIISHPEYGRGKIENVLRSSLLVRFSRAGLKPLMLQ*
Ga0150984_11428958023300012469Avena Fatua RhizosphereRPGDIISHLEYGRGKVETVLRSSLLVRFPNGGLKSLMLM*
Ga0150984_11820910623300012469Avena Fatua RhizosphereAVEVKSFDPKQRYRVGDIISHPEYGRGKIESVLRSSLLVRFAIGGLKSLMLT*
Ga0136616_1032921113300012679Polar Desert SandYRSGDIISHLEFGRGKVETVLRSSLLVRFANGGLKSLMLV*
Ga0157298_1030325113300012913SoilEEIAAAANVRVFDPKERYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV*
Ga0137410_1138980313300012944Vadose Zone SoilKERYKAGEIIAHAEYGRGKIENVLRSSLLVRFPVGGLKSLMLV*
Ga0164299_1015196113300012958SoilEIIVHAEYGRGKIENVLRSSLLVRFPIGGLKSLMLV*
Ga0126369_1122562333300012971Tropical Forest SoilIDPKERYKAGEIIAHPDFGRGKIENVLRSSLLVRFPVGGLKSLMLI*
Ga0181533_128586523300014152BogRAFDARERYRVGEVIAHPEFGRGKVETVLRSSLLVRFPAGGLKSLMLT*
Ga0181529_1004316913300014161BogRYKVGEVISHPEFGRGKVETVLRSSMLVRFPNGGLKSLMLS*
Ga0134079_1045939313300014166Grasslands SoilRYTTEIKANEIILHPEHGRGKIENVLRSSLLVRFPIGGLKSLMLM*
Ga0182017_1056289823300014494FenVIWHPEFGRGKVETVLRSSMLVRFASGGMKSVMLS*
Ga0187858_1061084123300018057PeatlandADVRTFNPRERYKVGEVIWHPEFGRGKVETVLRSSMLVRFASGGMKSVMLG
Ga0187766_1125660713300018058Tropical PeatlandFDPKERYKAGQIIVHPEFGRGKIENVLRSSLLVRFPIGGLKSLMLI
Ga0182028_141293123300019788FenVRTFNPRERYKVGEVVWHPEFGRGKVETVLRSSMLVRFASGGMKSVMLS
Ga0182028_145325023300019788FenVGEVISHPEYGRGKVETVLRSSLLVRFPNGGLKSLMLS
Ga0206356_1031366223300020070Corn, Switchgrass And Miscanthus RhizosphereVAAADNVRVFDPRERYKAGEIISHPEFGRGKIENVLRSSLLVRFSNGGLKSVMLQ
Ga0206355_127286023300020076Corn, Switchgrass And Miscanthus RhizosphereDNVRVFDPRERYKAGEIISHPEFGRGKIENVLRSSLLVRFSNGGLKSVMLQ
Ga0206350_1014919323300020080Corn, Switchgrass And Miscanthus RhizosphereVRVFDPRERYKAGEIISHPEFGRGKIENVLRSSLLVRFSNGGLKSVMLQ
Ga0210397_1105746313300021403SoilGEIISHAEYGRGKVENVLRSSLLVRFSVGGLKSLMLM
Ga0210402_1182722313300021478SoilEEVASAADVRRFDPKERYKAGEIISHAEYGRGKVENVLRSSLLVRFSVGGLKSLMLS
Ga0224712_1063361623300022467Corn, Switchgrass And Miscanthus RhizosphereFDPKERYKAGEIISHPEFGRGKIENVLRSSLLVRFPIGGLKSLMLR
Ga0242670_103923423300022708SoilAGEIISHPEYGRGKIQNVLRSSLLVRFSVGGLKSLMLR
Ga0247746_122070123300022886SoilSVRVFDPKERYKAGEIIVHAEYGRGKIENVLRSSLLVRFPIGGLKSLMLV
Ga0247800_111046013300023263SoilASVRVFDPKERYKAGEIIVHAEYGRGKIENVLRSSLLVRFPIGGLKSLMLV
Ga0247665_101460113300024219SoilGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV
Ga0247673_103243223300024224SoilVFDPKERYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV
Ga0209641_1051337613300025322SoilAGEILSHPEFGRGKIENVLPRSLLVRFSAGLKTLKLS
Ga0208220_109743113300025627Arctic Peat SoilRYKAGEIIVHPEYGRGKIQNVLRSSLIVRFSAGGLKSLMLM
Ga0207692_1034205913300025898Corn, Switchgrass And Miscanthus RhizosphereDVKMFDPKERYKAGQIIVHPEYGRGKIENVLRSSLLVRFPVGGLKSLMLM
Ga0207642_1104047813300025899Miscanthus RhizosphereDVRSFNPKERYKAGEIISHPEYGRGKIENVLRSSLLVRFSRAGLKPLMLQ
Ga0207695_1137091513300025913Corn RhizosphereRKFDPKERYKAGEIISHAEYGRGKVENVLRSSLLVRFSVGGLKSLMLV
Ga0207662_1005324813300025918Switchgrass RhizosphereAATVRVFDPKERYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV
Ga0207686_1065408313300025934Miscanthus RhizosphereYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV
Ga0207689_1004076213300025942Miscanthus RhizosphereIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV
Ga0207668_1134072023300025972Switchgrass RhizosphereLGEEVSSAATVRVFDPKERYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV
Ga0207640_1175849823300025981Corn RhizosphereVRSFNPKERYKAGEIISHPEYGRGKIENVLRASLLVRFSRAGLKPLMLQ
Ga0207703_1141234213300026035Switchgrass RhizosphereKERYKAGEIIVHAEFGRGKIENVLRSSLLVRFSIGGLKSLMLQ
Ga0207703_1162788513300026035Switchgrass RhizosphereIIVHAEFGRGKIENVLRSSLLVRFSIGGLKSLMLQ
Ga0207702_1079921133300026078Corn RhizosphereETVRTFDPRERYKAGEIISHPEFGRGKIENVLRSSLLVRFPNGGLKSIMLM
Ga0207702_1202981023300026078Corn RhizospherePRERYKAGEIISHPEFGRGKIENVLRSSMLVRFSNGGLKSVMLQ
Ga0207702_1238700323300026078Corn RhizosphereGEIISHPEFGRGKIENVLRSSLLVRFSNGGLKSVMLQ
Ga0207676_1102078433300026095Switchgrass RhizosphereKERYKTGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV
Ga0256820_103217723300026486SedimentDRYKVGEILSHPEFGRGKVETVLRSSLLVRFPNGGLKSLMLT
Ga0209275_1042688413300027884SoilIIVHPEYGRGKIQNVLRSSLIVRFSAGGLKSLMLM
Ga0268264_1021735113300028381Switchgrass RhizosphereDPKERYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV
Ga0265318_1028939723300028577RhizosphereRALGREVAEAEHIRTFEARERYKVGEIISHPDYGRGKVETVLRSSMLVRFPTGGLKSLML
Ga0265318_1037044413300028577RhizosphereKERYKTGEIISHPEYGRGKIENVLRSSLLVRFSRSGLKPLTLL
Ga0265323_1010086713300028653RhizosphereVRTFNPRERYKVGEVIWHPEFGRGKVETVLRSSMLVRFASGGMKSVMLS
Ga0265336_1018785623300028666RhizosphereNAAAEVKSFDPKQRYKVGDIIAHSEYGRGKIENVLRSSLLVRFPIGGLKSLMLT
Ga0302205_1015833323300028739FenDVRTFNPRERYKVGEAIWHPTFGRGKVQTVLRSSMLVRFASGGMKSVMLS
Ga0307296_1034274933300028819SoilVFDPKERYKAGEIIVHPEFGRGKIENVLRSSLLVRFAVGGLKSLMLL
Ga0302263_1043883823300028869FenGEVIAHPDHGRGKVENVLRSSMLVRFPNSGLKSLMLN
Ga0311334_1115311613300029987FenRAFDARDRYKVGEVISHSEYGRGKVETVLRSSMLVRFPNGGLKSLMLN
Ga0311365_1196206813300029989FenDVISHPEYGRGKIQNVLRSSLLVRFSVGGLKSLMLR
Ga0311337_1127232923300030000FenTSQVRVFDARDRYKVGEIISHPTYGRGKVETVLRSSMLVRFPIGGLKSLMLN
Ga0311350_1104316413300030002FenYKVGEVIAHPDHGRGKVENVLRSSMLVRFPNSGLKSLMLN
Ga0302175_1017712113300030014FenTDVRTFNPRERYKVGEVIWHPEFGRGKVETVLRSSMLVRFANGGMKSVMLS
Ga0311333_1051223623300030114FenRELAESTNVRTFNARERYKVGEAISHPEFGRGKVETVLRSSLLVRFSNGGLKSLMLT
Ga0311349_1011203413300030294FenPRERYKAGEIISHPEYGRGKIQNVLRSSLLVRFSVGGLKSLMLR
Ga0247826_1065268513300030336SoilAATVRVFDPKERYKAGEIIVHAEYGRGKIENVLRSSLLVRFSVGGLKSLMLQ
Ga0302323_10271454913300031232FenGEVIWHPEFGRGKVETVLRSSMLVRFASGGMKSVMLS
Ga0265330_1048697923300031235RhizosphereIISHPEFGRGKVETVLRSSLLARFPSGGLKSLMLN
Ga0265325_1038421623300031241RhizosphereVGEIISHPDYGRGKVETVLRSSMLVRFPTGGLKSLMLS
Ga0265329_1009338933300031242RhizosphereADVRTFNPRERYKVGEVIWHPEFGRGKVQTVLRSSMLVRFASGGMKSVMLG
Ga0265331_1015844223300031250RhizosphereEVAETSQVRVFDARDRYKVGEVISHPDYGRGKVETVLRSSMLVRFPNGGLKSLMLN
Ga0265316_1089281723300031344RhizosphereASTEVRLFDPRERYKAGEIISHPEYGRGKIQNVLRSSLLVRFSVGGLKSLMLR
Ga0318573_1059728523300031564SoilEVAAAETVRLFDPKERYKAGEIIAHPEFGRGKIENVLRSSLLVRFPVGGLKSLMLL
Ga0247727_1068375613300031576BiofilmVKTFDPKQRYRSGDVISHATFGRGKVETVLRASLLVRFPHGGLKSLMLN
Ga0265342_1020349433300031712RhizosphereSFNPKERYKAGEIISHPEYGRGKIENVLRSSLLVRFSRSGLKPLTLL
Ga0310813_1133963123300031716SoilFDPKERYRPGDVISHVQFGRGKVETVLRSSVLVRFPNGGLKSLLLT
Ga0316576_1035527013300031727RhizosphereATAETVRPFDSRERYKVGEIISHPSYGRGKVENVLRSSMLVRFSSSGLKSLMLN
Ga0307468_10117923823300031740Hardwood Forest SoilKAGEIISHPEYGRGKVENVLRSSLLVRFSVGGLKSLMLL
Ga0318535_1012864913300031764SoilYKAGEIIVHAEYGRGKVENVLRSSLLVRFSVGGLKSLMLV
Ga0318526_1032430313300031769SoilYKAGEIISHPDFGRGKVENVLRSSLLVRFSVGGLKSLMLV
Ga0318526_1038819513300031769SoilAGEIIAHPEFGRGKIENVLRSSLLVRFPVGGLKSLMLL
Ga0318546_1074489223300031771SoilYKAGEIIAHPEYGRGKVENVLRSSLLVRFPAGGLKSLMLM
Ga0318552_1072812523300031782SoilISHPEFGRGKVENVLRSSLLVRFPQGGLKSLMLRD
Ga0318529_1022545713300031792SoilKERYKAGEIIAHPEFGRGKIENVLRSSLLVRFPVGGLKSLMLL
Ga0318523_1036368923300031798SoilPKERYKAGEIISHPDFGRGKVENVLRSSLLVRFSVGGLKSLMLV
Ga0318497_1031909433300031805SoilFDPKERYKAGEIIAHPEFGRGKIENVLRSSLLVRFPVGGLKSLMLL
Ga0318512_1045755923300031846SoilPKERYKAGEIISHPEYGRGKVENVLRSSLLVRFSVGGLKSLMLV
Ga0310907_1045065023300031847SoilRYKAGEIIVHAEFGRGKIENVLRSSLLVRFPIGGLKSLMLV
Ga0310892_1091305913300031858SoilVAAAATVRVFDPKERYKAGEIIVHAEYGRGKIENVLRASLLVRFSVGGLKSLMLQ
Ga0306919_1018969933300031879SoilKAGEIIAHPEFGRGKIENVLRSSLLVRFPVGGLKSIMLI
Ga0318551_1031148433300031896SoilAEEVAASDKVRVFDPKERYKAGEIISHPEFGRGKIENVLRSSLLVRFPNGGLKSIMLL
Ga0310884_1028742133300031944SoilEIIVHAEYGRGKIENVLRASLLVRFSVGGLKSLMLQ
Ga0308176_1167025623300031996SoilLASATTVRQFNPKERYKAGEIISHVEYGRGKIENVLRSSLLVRFSRAGLKPLTLY
Ga0310906_1122878213300032013SoilERYKAGEIIVHPEYGRGKIENVLRSSLLVRFPIGGLKSLMLN
Ga0318524_1069310913300032067SoilEEVAAAQNVRYFDPKERYKAGEIIAHPEFGRGKIENVLRSSLLVRFPIGGLKSLMLV
Ga0318553_1047928313300032068SoilPKERYKAGEIIVHAEYGRGKVENVLRSSLLVRFSVGGLKSLMLV
Ga0308173_1037073013300032074SoilGQIISHPEFGRGKIENVLRSSLLVRFPIGGLKSLMLM
Ga0308173_1234083413300032074SoilGEIISHPEYGRGKIQNVLRSSLLVRFSVGGLKSLMLR
Ga0310890_1157025123300032075SoilYKAGEIIVHAEYGRGKIENVLRSSLLVRFPIGGLKSLMLV
Ga0316619_1082482113300033414SoilEVRPFDARERYKVGETISHPEFGRGKVETVLRSSVLVRFANGGLKSLMLT
Ga0326726_1107226313300033433Peat SoilFDARDRYKVGEVLSHPEFGRGKVETVLRSSLLVRFPNGGLKSLMLT
Ga0316630_1010214813300033487SoilVFDARDRYKVGEVLSHPEFGRGKVETVLRSSLLVRFPNGGLKSLMLT
Ga0334844_113616_408_5363300033743SoilDRYKVGEILSHPIFGRGKVETVLRSSLLVRFPNGGLKSLMLN
Ga0334816_108501_2_1693300033819SoilLADVANVRSFNPRERYKVGEVIWHPEFGRGKVETVLRSSMLVRFASGGMKSVMLS
Ga0370501_0135504_2_1513300034195Untreated Peat SoilVRVFDARERYKVGEVISHPDYGRGKVENVLRSSMLVRFPNSGLKSLMLN
Ga0370501_0324275_388_5553300034195Untreated Peat SoilLAEVADVRTFNPRERYKVGEVIWHPEFGRGKVQTVLRSSMLVRFAAGGMKSVMLS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.