NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F044471

Metagenome / Metatranscriptome Family F044471

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044471
Family Type Metagenome / Metatranscriptome
Number of Sequences 154
Average Sequence Length 38 residues
Representative Sequence MPREYKPPSPRTISTFVYLAVLVIGVLLAYVAVRALFA
Number of Associated Samples 104
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 84.42 %
% of genes near scaffold ends (potentially truncated) 9.74 %
% of genes from short scaffolds (< 2000 bps) 77.27 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.104 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(21.429 % of family members)
Environment Ontology (ENVO) Unclassified
(31.818 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(31.169 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 42.42%    β-sheet: 0.00%    Coil/Unstructured: 57.58%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 153 Family Scaffolds
PF01042Ribonuc_L-PSP 63.40
PF00731AIRC 14.38
PF02843GARS_C 7.84
PF00206Lyase_1 4.58
PF132392TM 3.92
PF10397ADSL_C 2.61
PF02844GARS_N 0.65
PF12399BCA_ABC_TP_C 0.65
PF00275EPSP_synthase 0.65
PF00768Peptidase_S11 0.65
PF00465Fe-ADH 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 153 Family Scaffolds
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 63.40
COG0151Phosphoribosylamine-glycine ligaseNucleotide transport and metabolism [F] 8.50
COG03373-dehydroquinate synthetaseAmino acid transport and metabolism [E] 0.65
COG0371Glycerol dehydrogenase or related enzyme, iron-containing ADH familyEnergy production and conversion [C] 0.65
COG1454Alcohol dehydrogenase, class IVEnergy production and conversion [C] 0.65
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.65
COG1979Alcohol dehydrogenase YqhD, Fe-dependent ADH familyEnergy production and conversion [C] 0.65

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.10 %
UnclassifiedrootN/A3.90 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090008|P3_DRAFT_NODE_92193_len_1456_cov_19_109890All Organisms → cellular organisms → Bacteria1506Open in IMG/M
2088090008|P3_DRAFT_NODE_92193_len_1456_cov_19_109890All Organisms → cellular organisms → Bacteria1506Open in IMG/M
2124908041|P3_CLC_ConsensusfromContig47509All Organisms → cellular organisms → Bacteria1971Open in IMG/M
3300000506|Soeholt_1014197All Organisms → cellular organisms → Bacteria1635Open in IMG/M
3300001213|JGIcombinedJ13530_103093791All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300001870|JGI24129J20441_1005356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3932Open in IMG/M
3300002068|JGIcombinedJ21913_10042003All Organisms → cellular organisms → Bacteria2012Open in IMG/M
3300002071|JGIcombinedJ21915_10015396All Organisms → cellular organisms → Bacteria3454Open in IMG/M
3300002071|JGIcombinedJ21915_10180308All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300005938|Ga0066795_10100266All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300005947|Ga0066794_10075096All Organisms → cellular organisms → Bacteria1005Open in IMG/M
3300005947|Ga0066794_10205712All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300006102|Ga0075015_100163943All Organisms → cellular organisms → Bacteria1164Open in IMG/M
3300006619|Ga0075529_1004791All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300006864|Ga0066797_1215584All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300006949|Ga0075528_10015413All Organisms → cellular organisms → Bacteria1872Open in IMG/M
3300006949|Ga0075528_10064019All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300009029|Ga0066793_10317885All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300009029|Ga0066793_10899290All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300009078|Ga0105106_10333148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941097Open in IMG/M
3300009087|Ga0105107_11191819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094531Open in IMG/M
3300009120|Ga0117941_1008245All Organisms → cellular organisms → Bacteria3678Open in IMG/M
3300009120|Ga0117941_1012650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2254Open in IMG/M
3300009131|Ga0115027_11725018All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300009167|Ga0113563_13823423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094510Open in IMG/M
3300009171|Ga0105101_10551849All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300009502|Ga0114951_10108639All Organisms → cellular organisms → Bacteria1569Open in IMG/M
3300009607|Ga0123327_1122302All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300009652|Ga0123330_1346063All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300009868|Ga0130016_10006176All Organisms → cellular organisms → Bacteria21493Open in IMG/M
3300011997|Ga0120162_1016810All Organisms → cellular organisms → Bacteria2431Open in IMG/M
3300011997|Ga0120162_1121888All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300012411|Ga0153880_1033477All Organisms → cellular organisms → Bacteria657Open in IMG/M
(restricted) 3300013123|Ga0172368_10441551All Organisms → cellular organisms → Bacteria577Open in IMG/M
(restricted) 3300013137|Ga0172375_10968812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094508Open in IMG/M
(restricted) 3300013138|Ga0172371_10795391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300014256|Ga0075318_1004551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1680Open in IMG/M
3300014257|Ga0075319_1002751All Organisms → cellular organisms → Bacteria2256Open in IMG/M
3300014257|Ga0075319_1081025All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300014266|Ga0075359_1052439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094723Open in IMG/M
3300014272|Ga0075327_1193408All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300014307|Ga0075304_1011941All Organisms → cellular organisms → Bacteria1761Open in IMG/M
3300014312|Ga0075345_1164544All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300014316|Ga0075339_1075585All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300014319|Ga0075348_1195541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094557Open in IMG/M
3300014494|Ga0182017_10229444All Organisms → cellular organisms → Bacteria1178Open in IMG/M
3300014502|Ga0182021_10039819All Organisms → cellular organisms → Bacteria5511Open in IMG/M
3300017947|Ga0187785_10705797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094530Open in IMG/M
3300018060|Ga0187765_10216229All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300020163|Ga0194039_1071624All Organisms → cellular organisms → Bacteria1260Open in IMG/M
3300020163|Ga0194039_1308445All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300020228|Ga0194040_1068966All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300020228|Ga0194040_1084633All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300020228|Ga0194040_1106543All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300020228|Ga0194040_1240163All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300021072|Ga0194057_10152995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094823Open in IMG/M
3300021074|Ga0194044_10402107Not Available511Open in IMG/M
3300021074|Ga0194044_10413482Not Available502Open in IMG/M
3300021075|Ga0194063_10103932All Organisms → cellular organisms → Bacteria1257Open in IMG/M
3300021075|Ga0194063_10118887All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300021075|Ga0194063_10268811All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300021473|Ga0194043_1048908All Organisms → cellular organisms → Bacteria1662Open in IMG/M
3300021473|Ga0194043_1270685Not Available546Open in IMG/M
3300021605|Ga0194054_10041095All Organisms → cellular organisms → Bacteria1698Open in IMG/M
3300022555|Ga0212088_10177214All Organisms → cellular organisms → Bacteria1741Open in IMG/M
3300025443|Ga0208081_1002828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3479Open in IMG/M
3300025443|Ga0208081_1072212All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300025461|Ga0208851_1002252All Organisms → cellular organisms → Bacteria5801Open in IMG/M
3300025481|Ga0208079_1021036All Organisms → cellular organisms → Bacteria1954Open in IMG/M
3300025495|Ga0207932_1027049All Organisms → cellular organisms → Bacteria1485Open in IMG/M
3300025533|Ga0208584_1066256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria908Open in IMG/M
3300025575|Ga0209430_1017937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2666Open in IMG/M
3300025739|Ga0209745_1155988All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300025739|Ga0209745_1246347Not Available509Open in IMG/M
3300025764|Ga0209539_1135443All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300025764|Ga0209539_1330455All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300025846|Ga0209538_1331583All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300025854|Ga0209176_10126058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094623Open in IMG/M
3300025857|Ga0209014_10019593All Organisms → cellular organisms → Bacteria3289Open in IMG/M
3300025857|Ga0209014_10034448All Organisms → cellular organisms → Bacteria2302Open in IMG/M
3300025967|Ga0210136_1005569All Organisms → cellular organisms → Bacteria1334Open in IMG/M
3300026195|Ga0209312_1128840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094616Open in IMG/M
3300026271|Ga0209880_1003943All Organisms → cellular organisms → Bacteria4227Open in IMG/M
3300027051|Ga0209269_1000007All Organisms → cellular organisms → Bacteria550542Open in IMG/M
3300027818|Ga0209706_10113585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941344Open in IMG/M
3300027818|Ga0209706_10541662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094528Open in IMG/M
3300027841|Ga0209262_10017078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3037Open in IMG/M
3300027841|Ga0209262_10205574All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300027841|Ga0209262_10570859All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300027885|Ga0209450_10021262All Organisms → cellular organisms → Bacteria3681Open in IMG/M
3300027885|Ga0209450_10108479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1856Open in IMG/M
3300027897|Ga0209254_10044237All Organisms → cellular organisms → Bacteria3918Open in IMG/M
3300027897|Ga0209254_10058175All Organisms → cellular organisms → Bacteria → Proteobacteria3346Open in IMG/M
3300027899|Ga0209668_10230991All Organisms → cellular organisms → Bacteria1164Open in IMG/M
3300027899|Ga0209668_10662937All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300027899|Ga0209668_11009348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094561Open in IMG/M
3300027900|Ga0209253_10250116All Organisms → cellular organisms → Bacteria1395Open in IMG/M
3300027900|Ga0209253_10927441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094608Open in IMG/M
3300028176|Ga0268284_1007271All Organisms → cellular organisms → Bacteria3811Open in IMG/M
(restricted) 3300028581|Ga0247840_10001180All Organisms → cellular organisms → Bacteria52206Open in IMG/M
3300028732|Ga0302264_1010950All Organisms → cellular organisms → Bacteria2089Open in IMG/M
3300028733|Ga0302261_1040260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941092Open in IMG/M
3300028743|Ga0302262_10087949All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300028865|Ga0302291_10157925All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300029288|Ga0265297_10254122All Organisms → cellular organisms → Bacteria1248Open in IMG/M
3300030002|Ga0311350_10260275All Organisms → cellular organisms → Bacteria1546Open in IMG/M
3300030050|Ga0302255_1050994All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300030114|Ga0311333_10242732All Organisms → cellular organisms → Bacteria1415Open in IMG/M
3300031691|Ga0316579_10360541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094703Open in IMG/M
3300031746|Ga0315293_10151285All Organisms → cellular organisms → Bacteria1936Open in IMG/M
3300031834|Ga0315290_10069741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2901Open in IMG/M
3300031834|Ga0315290_10163513All Organisms → cellular organisms → Bacteria1920Open in IMG/M
3300031834|Ga0315290_10228466All Organisms → cellular organisms → Bacteria1621Open in IMG/M
3300031834|Ga0315290_10245692All Organisms → cellular organisms → Bacteria1561Open in IMG/M
3300031834|Ga0315290_10879907All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300031834|Ga0315290_10899273All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300031834|Ga0315290_11379945All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300031873|Ga0315297_10120031All Organisms → cellular organisms → Bacteria2106Open in IMG/M
3300031997|Ga0315278_10115854All Organisms → cellular organisms → Bacteria2714Open in IMG/M
3300031997|Ga0315278_10195073All Organisms → cellular organisms → Bacteria2083Open in IMG/M
3300031997|Ga0315278_12135173Not Available520Open in IMG/M
3300032018|Ga0315272_10002246All Organisms → cellular organisms → Bacteria9458Open in IMG/M
3300032018|Ga0315272_10043724All Organisms → cellular organisms → Bacteria2025Open in IMG/M
3300032018|Ga0315272_10203818All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300032018|Ga0315272_10463462All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300032018|Ga0315272_10591239All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300032143|Ga0315292_10262827All Organisms → cellular organisms → Bacteria1429Open in IMG/M
3300032143|Ga0315292_11284212All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300032156|Ga0315295_10049777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3925Open in IMG/M
3300032164|Ga0315283_10990193All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300032164|Ga0315283_11279194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria762Open in IMG/M
3300032173|Ga0315268_10081712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3044Open in IMG/M
3300032173|Ga0315268_10090474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2883Open in IMG/M
3300032173|Ga0315268_10104351All Organisms → cellular organisms → Bacteria2675Open in IMG/M
3300032173|Ga0315268_11052248All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria821Open in IMG/M
3300032177|Ga0315276_11193440All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria802Open in IMG/M
3300032275|Ga0315270_10598781All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300032342|Ga0315286_10388135All Organisms → cellular organisms → Bacteria1468Open in IMG/M
3300032397|Ga0315287_11195640All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300032397|Ga0315287_12115934All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300032397|Ga0315287_12909534Not Available504Open in IMG/M
3300032516|Ga0315273_11200732All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300032897|Ga0335071_10097762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2879Open in IMG/M
3300032897|Ga0335071_10417977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941294Open in IMG/M
3300032897|Ga0335071_10559839All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300033408|Ga0316605_11553292All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300033434|Ga0316613_10863834All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300033521|Ga0316616_101732303All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300034123|Ga0370479_0073596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094878Open in IMG/M
3300034126|Ga0370486_081959All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300034128|Ga0370490_0066826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0941175Open in IMG/M
3300034195|Ga0370501_0204303All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300034281|Ga0370481_0012307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA0942378Open in IMG/M
3300034281|Ga0370481_0118990All Organisms → cellular organisms → Bacteria899Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment21.43%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil14.29%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater9.74%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands6.49%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment5.84%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen4.55%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.90%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.90%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil3.90%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil3.25%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.60%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater1.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil1.95%
Anaerobic Biogas ReactorEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor1.95%
Lake SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment1.30%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.30%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.30%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.30%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil1.30%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.65%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion0.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.65%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.65%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.65%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.65%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.65%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.65%
Landfill LeachateEngineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate0.65%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.65%
Anaerobic DigesterEngineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Anaerobic Digester0.65%
Enrichment CultureEngineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture0.65%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3EnvironmentalOpen in IMG/M
2124908041Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3EnvironmentalOpen in IMG/M
3300000506Anaerobic digester microbial communities from Northern Denmark, sample from Soeholt sludgeEngineeredOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001870Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211EnvironmentalOpen in IMG/M
3300002068Barrow Graham LP Ref core NGADG0004-212 (Barrow Graham LP Ref core NGADG0004-212,NGADG0011-311, ASSEMBLY_DATE=20131010)EnvironmentalOpen in IMG/M
3300002071Barrow Graham LP Ref core NGADG0011-312 (Barrow Graham LP Ref core NGADG0011-312,NGADG0011-212, ASSEMBLY_DATE=20131010)EnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300005947Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006619Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-4BEnvironmentalOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300006949Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16BEnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009120Lake sediment microbial communities from Tanners Lake, St. Paul, MNEnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009502Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaGEnvironmentalOpen in IMG/M
3300009607Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNAEngineeredOpen in IMG/M
3300009652Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A C13 SIP DNAEngineeredOpen in IMG/M
3300009868Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plantEngineeredOpen in IMG/M
3300011997Permafrost microbial communities from Nunavut, Canada - A15_80cm_18MEnvironmentalOpen in IMG/M
3300012411Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013123 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11mEnvironmentalOpen in IMG/M
3300013137 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1mEnvironmentalOpen in IMG/M
3300013138 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12mEnvironmentalOpen in IMG/M
3300014256Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D2EnvironmentalOpen in IMG/M
3300014257Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D1EnvironmentalOpen in IMG/M
3300014266Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D1EnvironmentalOpen in IMG/M
3300014272Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1EnvironmentalOpen in IMG/M
3300014307Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1EnvironmentalOpen in IMG/M
3300014312Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1EnvironmentalOpen in IMG/M
3300014316Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1EnvironmentalOpen in IMG/M
3300014319Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1EnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300020163Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-8mEnvironmentalOpen in IMG/M
3300020228Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-10mEnvironmentalOpen in IMG/M
3300021072Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-15mEnvironmentalOpen in IMG/M
3300021074Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-17mEnvironmentalOpen in IMG/M
3300021075Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L373-20mEnvironmentalOpen in IMG/M
3300021473Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-15mEnvironmentalOpen in IMG/M
3300021605Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-10mEnvironmentalOpen in IMG/M
3300022555Alinen_combined assemblyEnvironmentalOpen in IMG/M
3300025443Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025461Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025481Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025495Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025533Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025575Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-33A (SPAdes)EnvironmentalOpen in IMG/M
3300025739Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312 (SPAdes)EnvironmentalOpen in IMG/M
3300025764Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes)EnvironmentalOpen in IMG/M
3300025846Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes)EnvironmentalOpen in IMG/M
3300025854Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes)EnvironmentalOpen in IMG/M
3300025857Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes)EnvironmentalOpen in IMG/M
3300025967Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026195Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA (SPAdes)EngineeredOpen in IMG/M
3300026271Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes)EnvironmentalOpen in IMG/M
3300027051Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaG (SPAdes)EngineeredOpen in IMG/M
3300027818Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027841Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300028176Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_40mEnvironmentalOpen in IMG/M
3300028581 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17mEnvironmentalOpen in IMG/M
3300028732Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_4EnvironmentalOpen in IMG/M
3300028733Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_4EnvironmentalOpen in IMG/M
3300028743Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4EnvironmentalOpen in IMG/M
3300028865Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_4EnvironmentalOpen in IMG/M
3300029288Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91EngineeredOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030050Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_4EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031691Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrAHost-AssociatedOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032018Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middleEnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033434Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_bEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300034123Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15EnvironmentalOpen in IMG/M
3300034126Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_16EnvironmentalOpen in IMG/M
3300034128Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16EnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M
3300034281Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
P3_DRAFT_001725002088090008SoilMPREYKPPSPRTISTFIYVAVLVIGVLLAFVAVRALFA
P3_DRAFT_001725102088090008SoilMPREYKPPSSRTISTFIYFAVLVIGVLLAFVAVRALFA
P3_CLC_013101202124908041SoilMPREYKPPSPRTISTFIYFAVLVIGVLLAFVAVRALFA
Soeholt_101419743300000506Anaerobic DigesterMPRNDRPPSPKTISGFLYVAVVLIAVALIYVAVRALLA*
JGIcombinedJ13530_10309379123300001213WetlandMSRKYKPPSPRSISTFIYFAVLTIGVLLAYVAVRALFA*
JGI24129J20441_100535673300001870Arctic Peat SoilMPREYKPPSPRTISTLIYFAVLVIGALLAFVAVRALFA*
JGIcombinedJ21913_1004200333300002068Arctic Peat SoilMPKDYRPPSARTISNFVYLAVLVIAILLAYVAVRSLFG*
JGIcombinedJ21915_1001539663300002071Arctic Peat SoilMPREYKPPSPRSISTFIYFAVLVIGVLLAFVALRALFA*
JGIcombinedJ21915_1018030823300002071Arctic Peat SoilMPREHKPPSPRTISTFIYLAVLVIGVLLVFVAVRALFA*
Ga0066795_1010026623300005938SoilMPREYKPPSPRTISTFIYFAVLVIGVLLAFVAVRALFA*
Ga0066794_1007509633300005947SoilMPREYKPPSPRTISTFIYFAVLVIGVFLAFVAVRALFA*
Ga0066794_1020571223300005947SoilMPREYKPPSPRTISTFIYVAVLVIGVLLAFVAVRALFA*
Ga0075015_10016394333300006102WatershedsMPRDHRPPNPRTISTFIYLVVLVMAVLIAYVAIRALFA*
Ga0075529_100479133300006619Arctic Peat SoilVPKDYRPPNPKTISSFVYLAVLVIGILLAYVAVRSLFG*
Ga0066797_121558423300006864SoilVPKDYRPPNPQTISSFVYLAVLVIGILLAYVAMRSLFG*
Ga0075528_1001541333300006949Arctic Peat SoilVPKDYRPPNPKTISSFVYLAVLVNGILLAYVAVRSLFG*
Ga0075528_1006401913300006949Arctic Peat SoilGSPMPREYKPPSPRTISTFIYFAVLVIGVFLAFVAVRALFA*
Ga0066793_1031788513300009029Prmafrost SoilRTRGSPMPREYKPPSPRTISTFIYVAVLVIGVLLAFVAVRALFA*
Ga0066793_1089929023300009029Prmafrost SoilMPREYKPPSPRTISTLIYFAVLVIGVLLAFVAVRALFA*
Ga0105106_1033314823300009078Freshwater SedimentVPRNDKPPSPRTISGFLYFAVLFIAVALAYVAVRALLA*
Ga0105107_1119181923300009087Freshwater SedimentVPRNDQPPSPKTISGFLYVAVLVIAVALAYVAVRALLA*
Ga0117941_100824563300009120Lake SedimentMPRNDQPPSPRTISGFLYVAVLLIAVALVYVAVRALLA*
Ga0117941_101265023300009120Lake SedimentVPRNDKPPSPRTISGFLYVTVLIIAVALAYVAVRALLA*
Ga0115027_1172501823300009131WetlandPRNDKPPSPRTISGFLYIAVLIIAVALAYVALRALLA*
Ga0113563_1382342313300009167Freshwater WetlandsVPRNDKPPSPRTISGFLYIAVLVIAVALAYVAVRALLA*
Ga0105101_1055184913300009171Freshwater SedimentRRVPRNDKPPSPRTISSFLYFAVLFIAVALAYVAVRALLA*
Ga0114951_1010863923300009502FreshwaterMPRDHRPPDPKTVSTYIYLAVLVMAVLIAYVAVRALFT*
Ga0123327_112230223300009607Anaerobic Biogas ReactorMPRDQKPPSPRTISGFLYVAVALIAVALACVAVRALLA*
Ga0123330_134606323300009652Anaerobic Biogas ReactorVPRDQKPPSPRTISGFLYVAVALIAVALACVAVRALLA*
Ga0130016_10006176153300009868WastewaterMPSNDKPPSPRTISGFLHVAVLAIAVALAYVAVRALVT*
Ga0120162_101681033300011997PermafrostMPREHKPPSPRTISTFVYFAVLVIGLLLAFVAVRALFA*
Ga0120162_112188823300011997PermafrostMPREYKPPSPRTISTFIYFAVLVIGVLLVFVAVRALFA*
Ga0153880_103347723300012411Freshwater SedimentMPRQYKPPSPRSISTFIYFAVLVIGVLLAFVAVRALFA*
(restricted) Ga0172368_1044155123300013123FreshwaterVPRNNQPPSPRTISGFLYIAVLLIAVALVYVAVRALFA*
(restricted) Ga0172375_1096881213300013137FreshwaterVPRNDQPPSPRTISGFLYIAVLLIAVALAYVAVRALLA*
(restricted) Ga0172371_1079539123300013138FreshwaterMPKDHRPPSPKTISSFVYLAVLAIAIILAYVAVRSLFS*
Ga0075318_100455143300014256Natural And Restored WetlandsMPRNDQPPSPKTISGFLYVAVLLIAVALVYVAVRALFA*
Ga0075319_100275133300014257Natural And Restored WetlandsVPRNDQPPSPRTISGFLYIAVLLIAAALVYVAVRALLA*
Ga0075319_108102523300014257Natural And Restored WetlandsVPRNDKPPSPRTISGFLYVAVLLIAVALAYVAVRALLA*
Ga0075359_105243923300014266Natural And Restored WetlandsVPRNDKPPSPRTISGFLYIAVLLIAVALAYVAVRALLA*
Ga0075327_119340823300014272Natural And Restored WetlandsVPRNDKPPSPKTISGFLYIAVLAIAVALVYVAVRALLA*
Ga0075304_101194133300014307Natural And Restored WetlandsMPRNDQPPSPRTVSGFLYIAVLVIAVALVYVAVRALFA*
Ga0075345_116454423300014312Natural And Restored WetlandsVPRNDQPPSPRTISGVLYVAVLLIAVALASVAVRSLLA*
Ga0075339_107558523300014316Natural And Restored WetlandsVPRNDKPPSPRTISGFLYFAVLLIAVALAYVAVRALLA*
Ga0075348_119554123300014319Natural And Restored WetlandsVPRNDQPPSPRTISGFLYFAVLFIAVALAYVAVRALLA*
Ga0182017_1022944433300014494FenVGRPPRRPPDPHTISRLLYVAVAIIALLLIYVAVRAALN*
Ga0182021_1003981923300014502FenMPKDYRPPSPKTISNFLYVVVLVIAILLAYVAVRSLFG*
Ga0187785_1070579723300017947Tropical PeatlandVPRNDKPPSPRTISGFLYVAVLLIAVALAYVAVRALLA
Ga0187765_1021622933300018060Tropical PeatlandVPRNDKPPSPRTISSFLYIVVLLIAIALAYVAVRALLA
Ga0194039_107162413300020163Anoxic Zone FreshwaterMPREYKPPSPRTISTFVYFVVLVIGVLLAYVAVRALFA
Ga0194039_130844523300020163Anoxic Zone FreshwaterMPPEYKPPSPRTISTFIYLAVLVIGVLLAFVALRALFA
Ga0194040_106896623300020228Anoxic Zone FreshwaterMPRDHKPPSPRTISTFVYLAVLVIGVLLALVALRALFA
Ga0194040_108463323300020228Anoxic Zone FreshwaterMPRQYKPPSPRSISTFIYFAVLVIGVLLAFVAVRALFA
Ga0194040_110654333300020228Anoxic Zone FreshwaterPPPEYKPPSPRTISTFIYLAVLVIGVLLAFVALRALFA
Ga0194040_124016313300020228Anoxic Zone FreshwaterRGSPMPREYKPPSPRTISTFVYFVVLVIGVLLAYVAVRALFA
Ga0194057_1015299523300021072Anoxic Zone FreshwaterMPRDYRPPSPKTVSTFVYLAVLVIAVLIAYVAIRALFT
Ga0194044_1040210723300021074Anoxic Zone FreshwaterMPREYKPPSPRTLSTFIYLAVLVIGVLLAYVAMRALFA
Ga0194044_1041348223300021074Anoxic Zone FreshwaterMPRDYRPPSPRTISMFIYLALLVIGVLLAYVAVRALFA
Ga0194063_1010393223300021075Anoxic Zone FreshwaterMPHDHRPPSPRTISTFIYLAVLVIGVLLAFVALRALFA
Ga0194063_1011888723300021075Anoxic Zone FreshwaterMPREYKPPSPRTISTFVYFAVLVIGVLLAYVAVRALFA
Ga0194063_1026881123300021075Anoxic Zone FreshwaterMPREHKPPSPRTISTFIYFAVLVIGVLLAFVAVRALFA
Ga0194043_104890843300021473Anoxic Zone FreshwaterMPRDYRPPNPKTVSTFVYLAVLMIAVLIAYVAIRALFT
Ga0194043_127068513300021473Anoxic Zone FreshwaterMPRDYKPPSPRTISTFVYFAVLVIGVLLAFVALRALFA
Ga0194054_1004109533300021605Anoxic Zone FreshwaterMPRDYKPPSPRTISMFIYLAVLVIGVLLAFVALRALFA
Ga0212088_1017721423300022555Freshwater Lake HypolimnionMPRDHRPPDPKTVSTYIYLAVLVMAVLIAYVAVRALFT
Ga0208081_100282843300025443Arctic Peat SoilVPKDYRPPNPKTIASFIYLAVLVIGILLAYVAVRSLFG
Ga0208081_107221223300025443Arctic Peat SoilATERRMPRNDQPPSPKTISGFLYVAVLLIAVALAYVAVRALFA
Ga0208851_100225243300025461Arctic Peat SoilMPRNDQPPSPKTISGFLYVAVLLIAVALAYVAVRALFA
Ga0208079_102103623300025481Arctic Peat SoilMPREYKPPSPRTISTLIYFAVLVIGALLAFVAVRALFA
Ga0207932_102704933300025495Arctic Peat SoilMSREYKPPSPRTISTFIYFAVLVIGVLLAFVAVRALFA
Ga0208584_106625633300025533Arctic Peat SoilMPREHKPPNPRTISTFIYLAVLVIGVLLVFVAVRALFA
Ga0209430_101793733300025575Arctic Peat SoilVPKDYRPPNPKTISSFVYLAVLVNGILLAYVAVRSLFG
Ga0209745_115598823300025739Arctic Peat SoilMPREYKPPNPRSISTFIYFAVLVIGVLLAFVALRALFA
Ga0209745_124634723300025739Arctic Peat SoilMPREHKPPSPRTISTFIYVAVFVIGVLLVFVAVRALFA
Ga0209539_113544323300025764Arctic Peat SoilMPREYKPPSPRTISTLIYFAVLVIGVLLAFVAVRALFA
Ga0209539_133045513300025764Arctic Peat SoilMRKDYRPPSPKTISNFLYVVVLVIAILLAYVALRSLFG
Ga0209538_133158323300025846Arctic Peat SoilRTRGSPMSREYKPPSPRTISTFIYFAVLVIGVLLAFVAVRALFA
Ga0209176_1012605823300025854Arctic Peat SoilVPKDYRPPNPKTISSFVYLAVLVIGILLAYVAVRSLFG
Ga0209014_1001959323300025857Arctic Peat SoilMPREYKPPSPRTISTFIYFAVLVIGVLLAFVALRALFG
Ga0209014_1003444843300025857Arctic Peat SoilVPKDNRPPSPKSISNFLYVAVLVIAILLAYVAVRSLFG
Ga0210136_100556923300025967Natural And Restored WetlandsVPRNDKPPSPRTISGFLYIAVLLIAVALAYVAVRALLA
Ga0209312_112884013300026195Anaerobic Biogas ReactorMPRDQKPPSPRTISGFLYVAVALIAVALACVAVRALLA
Ga0209880_100394363300026271SoilMPREYKPPSPRTISTFIYFAVLVIGVFLAFVAVRALFA
Ga0209269_1000007953300027051Enrichment CultureMPRDQKPPSPRTISGFLYVAVLLIAVALVYVAVRALLA
Ga0209706_1011358533300027818Freshwater SedimentVPRNDKPPSPRTISGFLYFAVLFIAVALAYVAVRALLA
Ga0209706_1054166223300027818Freshwater SedimentVPRNDQPPSPKTISGFLYVAVLVIAVALAYVAVRALLA
Ga0209262_1001707833300027841FreshwaterVPRNDKPPSPRTISGFLYVVVLLIAMALAYVAVRALLA
Ga0209262_1020557423300027841FreshwaterVSRNDKPPSPRTISGFLYFAVLFIAVALAYVAVRALLA
Ga0209262_1057085923300027841FreshwaterMPREYKPPSPKSISTFVYLAVLVIGVLLAFVAVRALFA
Ga0209450_1002126223300027885Freshwater Lake SedimentVPRNDKPPSPRTISGVLYAVVLLIAVALAYVAVRALLA
Ga0209450_1010847933300027885Freshwater Lake SedimentMPRQQKPPSLRTISDFICFAVLVIGVLLAFVAVRALFA
Ga0209254_1004423753300027897Freshwater Lake SedimentMPREHKPPSPRTISNFIYFAVLVIGVLLAFVAVRALFA
Ga0209254_1005817553300027897Freshwater Lake SedimentMPRNDRPPSPRTISGFLYIAVLVIAVALAYVAVRALLA
Ga0209668_1023099123300027899Freshwater Lake SedimentVPRNDKPPGPRTISGFLYVVVLLIAIALAYVAVRALLA
Ga0209668_1066293723300027899Freshwater Lake SedimentMPREHKPPNPRTISNFVYFAVLVIGVLLAFVAVRALFA
Ga0209668_1100934813300027899Freshwater Lake SedimentMPRNDQPPSPRTISGFLYVAVLLIAVALVYVAVRALLA
Ga0209253_1025011623300027900Freshwater Lake SedimentMPREHKPPSPRTISNFIYFAVLVIGILLAFVAVRALFA
Ga0209253_1092744123300027900Freshwater Lake SedimentVPRNDKPPSPRTISGFLYVVVLLIAIALAYVAVRALLA
Ga0268284_100727163300028176Saline WaterVPRDYRPPSPRTISAFIYLAVLAIAVILAYVAVRSLFS
(restricted) Ga0247840_10001180333300028581FreshwaterMPRDYKPPSPRTISMLIYLAVLVIGVLLAFVALRALFA
Ga0302264_101095023300028732FenMPRNQQPPSPRTISGVLYMVVLVIAVALAYVAVRALLG
Ga0302261_104026023300028733FenMPRNQQPPSPRTISGVVYMVVLVIAVALAYVAVRALLG
Ga0302262_1008794933300028743FenMPKDYRPPSPKTISNFLYVVVLVIAILLAYVALRSLFG
Ga0302291_1015792533300028865FenMPPEHRPPDPRTISTFVYLVVLVIAVLIAYVAVRALFA
Ga0265297_1025412213300029288Landfill LeachateMPREYKPPSPRTISTFVYLAVLVIGVLLAFVAVRALFA
Ga0311350_1026027523300030002FenMPRNQQPPSPRTISGVLYIVVLVIAVALAYVAVRALLG
Ga0302255_105099433300030050FenMPKDHRPPSPKTISNFLYVVVLVIAILLAYVALRSLFG
Ga0311333_1024273243300030114FenMPPEHRPPDPRTISTFVYLVVLVIAILVAYVAVRALFA
Ga0316579_1036054113300031691RhizosphereVPRNDKPPSPKTISGILYVAVLLIAAALVYVAVRALFA
Ga0315293_1015128533300031746SedimentMPRENKPPSPRTISTFIYFAVLVIGVLLAFVAVRALFA
Ga0315290_1006974133300031834SedimentMPREHKPPSPKSISTFVYFAVLVIGVLLAFVAVRALFA
Ga0315290_1016351323300031834SedimentMPREYKPPSPRTISTFVYFAVLVIGVLLAFVALRALFA
Ga0315290_1022846633300031834SedimentMPREYKPPSPRTISTFIYLAVLVIGVLLAFVALRALFA
Ga0315290_1024569223300031834SedimentVPKDHRPPSPKTISSFLYLAVLVIAISLAYVAVRSLFS
Ga0315290_1087990723300031834SedimentVPKDHRPPSPKTISTFVYLAVLVIAVILAYVAVRSLFS
Ga0315290_1089927323300031834SedimentVPKDYRPPSPKTISTFVYLAVLVIAILLAYVAVRSLFS
Ga0315290_1137994523300031834SedimentMPREYKPPSPRAISTFIYLAVLVIGVLLAYVALRALFA
Ga0315297_1012003123300031873SedimentMPREYKPPSPRTISMFIYLAVLVIGVLLAFVAVRALFA
Ga0315278_1011585433300031997SedimentMPREYKPPSPRTISTFVYLAVLVIGVLLAYVAVRALFA
Ga0315278_1019507323300031997SedimentVPKDYRPPSPRTISTFVYLAVLVIAILLAYVAVRSLFS
Ga0315278_1213517323300031997SedimentMPRDYKPPSPPTISTFVYLAVLVIGVLLAFVALRALLA
Ga0315272_1000224643300032018SedimentVPRNDKPPSPKTISGFLYIAVLLIAVALAYVAVRALLT
Ga0315272_1004372443300032018SedimentMPRNDQPPSPKTISGFLYVAVLLIAVAIAYVAVRALFA
Ga0315272_1020381823300032018SedimentMSREYKPPNPRTISTFVYLAVLVIGVLLALVALRALFA
Ga0315272_1046346223300032018SedimentMPREYKPPSPRSISTFVYFAVLVIGVLLAFVAVRALFA
Ga0315272_1059123923300032018SedimentVPKDYRPPSPRTISNFVYLAVLVIAILLAYVAVRSLFS
Ga0315292_1026282733300032143SedimentVPRSDKPPSPKTISGFLYVVVLLIAIALAYVAVRALLA
Ga0315292_1128421223300032143SedimentMPREYKPPSPRTISTFIYFAVLVIGVLLAFVALRALFA
Ga0315295_1004977753300032156SedimentMPRDHRPPSPRAISTFIYFAVLVIGMLLAFVAVRALFA
Ga0315283_1099019323300032164SedimentMPREYKPPSPRTISTFVYLAVLVIGLLLAYVAVRALFA
Ga0315283_1127919423300032164SedimentMARDHKPPSPKAISTVVYFAVLLIGLLLAFVAVRALFA
Ga0315268_1008171233300032173SedimentVPKDYRPPSPKSISNFLYVAVLVIAILLAYVAVRSLFG
Ga0315268_1009047443300032173SedimentMPRNDQPPGPKTISGFLYVAVLLIAVAIAYVAVRALFA
Ga0315268_1010435143300032173SedimentMPRDYRPPNPKTVSTFIYLAVLVMAVLIAYVAIRALFT
Ga0315268_1105224833300032173SedimentPSATDARGSPMPREYKPPSPKSISTFVYFAVLVIGVLLAFVAVRALFA
Ga0315276_1119344013300032177SedimentRSPMPREYKPPSPRTISTFIYFAVLVIGVLLAFVALRALFA
Ga0315270_1059878123300032275SedimentMPREYKPPSPKSISTFVYFAVLVIGVLLAFVAVRALFA
Ga0315286_1038813533300032342SedimentMPRDYKPPSPRTISTFIYLAMLVVGVLLAFVALQALFA
Ga0315287_1119564023300032397SedimentMPREYKPPGPRTMSTFIYLAVLVIGVLLAFVALRALFA
Ga0315287_1211593413300032397SedimentPSPSGTEPRGSTMPREYKPPSPRTISTFVYLAVLVIGLLLAYVAVRALFA
Ga0315287_1290953423300032397SedimentMPRDHRPPSPRTISTFVYLAVLVIGVLLAFVALRALLA
Ga0315273_1120073213300032516SedimentTHRTRGSLMPRENKPPSPRTISTFIYFAVLVIGVLLAFVAVRALFA
Ga0335071_1009776213300032897SoilVPRNDRPPSPKTISGFLYIAVLLIAIALAYVAVRALLA
Ga0335071_1041797723300032897SoilVPRNDKPPSPKTISGFLYIAVLLIAIALAYVAVRALLA
Ga0335071_1055983923300032897SoilVPRNDRPPSPKTISSFLYITVLLIAIALAYVAVRALLA
Ga0316605_1155329223300033408SoilVPRNDKPPSPRTISGFLYVTVLIIAVALAYVAVRALLA
Ga0316613_1086383423300033434SoilVPRNDKPPSPRTISGLLYLAVLIIAVALAYVAVRALLA
Ga0316616_10173230323300033521SoilVPRNDKPPSPRTISGFLYIAVLIIAVALAYVAVRALLA
Ga0370479_0073596_222_3383300034123Untreated Peat SoilMPRNDQPPSPRTISGFLYIVVLIIAVALAYVAVRALFA
Ga0370486_081959_449_5653300034126Untreated Peat SoilMPRNDQPPSPRTISGFLYVVVLIIAVALAYVAVRALFA
Ga0370490_0066826_776_8923300034128Untreated Peat SoilVPRNDKPPSPRTISGFLYIAVLAIAVALAYVAVRALLA
Ga0370501_0204303_100_2163300034195Untreated Peat SoilVPRNDRPPSPRTISGFLYVVVLIIAIALAYVAVRSLLA
Ga0370481_0012307_87_2033300034281Untreated Peat SoilMPRNDQPPSPRTISGFLYIVVLVIAVALAYVAVRALFA
Ga0370481_0118990_3_1073300034281Untreated Peat SoilMPREYKPPDPRTISTFVYLAVLVIAVLLAFVAVRA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.