NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F044456

Metagenome / Metatranscriptome Family F044456

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044456
Family Type Metagenome / Metatranscriptome
Number of Sequences 154
Average Sequence Length 44 residues
Representative Sequence GDEGGYVIETIITIFAIGFLGIALAIGGVCLMVWMALNED
Number of Associated Samples 106
Number of Associated Scaffolds 154

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 40.26 %
% of genes near scaffold ends (potentially truncated) 33.12 %
% of genes from short scaffolds (< 2000 bps) 83.77 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (53.896 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(18.831 % of family members)
Environment Ontology (ENVO) Unclassified
(59.740 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(67.532 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.94%    β-sheet: 0.00%    Coil/Unstructured: 47.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 154 Family Scaffolds
PF00182Glyco_hydro_19 35.06
PF00959Phage_lysozyme 12.34
PF04218CENP-B_N 5.19
PF00149Metallophos 1.30
PF13539Peptidase_M15_4 0.65
PF10926DUF2800 0.65
PF00271Helicase_C 0.65
PF04404ERF 0.65
PF09588YqaJ 0.65
PF13229Beta_helix 0.65
PF00476DNA_pol_A 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 154 Family Scaffolds
COG3179Chitinase, GH19 familyCarbohydrate transport and metabolism [G] 35.06
COG3979ChitodextrinaseCarbohydrate transport and metabolism [G] 35.06
COG0749DNA polymerase I, 3'-5' exonuclease and polymerase domainsReplication, recombination and repair [L] 0.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.29 %
UnclassifiedrootN/A35.71 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003277|JGI25908J49247_10065742All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage915Open in IMG/M
3300004112|Ga0065166_10206943All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage774Open in IMG/M
3300004123|Ga0066181_10159178All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage638Open in IMG/M
3300004240|Ga0007787_10084471All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1466Open in IMG/M
3300005581|Ga0049081_10010417All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3521Open in IMG/M
3300005581|Ga0049081_10096471Not Available1104Open in IMG/M
3300005581|Ga0049081_10110320Not Available1022Open in IMG/M
3300005581|Ga0049081_10197161All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage723Open in IMG/M
3300005581|Ga0049081_10219037All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage677Open in IMG/M
3300005581|Ga0049081_10225185All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage665Open in IMG/M
3300005581|Ga0049081_10232733All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage651Open in IMG/M
3300005582|Ga0049080_10048713All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1465Open in IMG/M
3300005582|Ga0049080_10136668Not Available824Open in IMG/M
3300005582|Ga0049080_10226137All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage614Open in IMG/M
3300005584|Ga0049082_10170074All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage752Open in IMG/M
3300005585|Ga0049084_10000423All Organisms → cellular organisms → Bacteria → Proteobacteria16629Open in IMG/M
3300005943|Ga0073926_10032725Not Available977Open in IMG/M
3300006037|Ga0075465_10152993Not Available526Open in IMG/M
3300006637|Ga0075461_10246879All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300006802|Ga0070749_10497473All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes664Open in IMG/M
3300006805|Ga0075464_10871637All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300006805|Ga0075464_11014705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
3300006920|Ga0070748_1322894All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage547Open in IMG/M
3300007276|Ga0070747_1272391All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage585Open in IMG/M
3300007540|Ga0099847_1014439All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2597Open in IMG/M
3300007540|Ga0099847_1035572All Organisms → Viruses → Predicted Viral1591Open in IMG/M
3300007542|Ga0099846_1276068All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes579Open in IMG/M
3300007622|Ga0102863_1234193Not Available539Open in IMG/M
3300007708|Ga0102859_1195386All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes601Open in IMG/M
3300007974|Ga0105747_1200032Not Available659Open in IMG/M
3300008107|Ga0114340_1079021All Organisms → Viruses → Predicted Viral1363Open in IMG/M
3300008261|Ga0114336_1034930All Organisms → cellular organisms → Bacteria → Proteobacteria2742Open in IMG/M
3300008266|Ga0114363_1044013Not Available1810Open in IMG/M
3300008266|Ga0114363_1136557All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage831Open in IMG/M
3300008266|Ga0114363_1168318Not Available709Open in IMG/M
3300008266|Ga0114363_1173040All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes693Open in IMG/M
3300008266|Ga0114363_1173891All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes690Open in IMG/M
3300008266|Ga0114363_1181641All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage666Open in IMG/M
3300008267|Ga0114364_1014838All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3414Open in IMG/M
3300008267|Ga0114364_1062399All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1286Open in IMG/M
3300008448|Ga0114876_1071703All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1471Open in IMG/M
3300008448|Ga0114876_1096768All Organisms → Viruses → Predicted Viral1186Open in IMG/M
3300008450|Ga0114880_1152508All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage830Open in IMG/M
3300008450|Ga0114880_1222853All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage612Open in IMG/M
3300009151|Ga0114962_10068958All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2270Open in IMG/M
3300009159|Ga0114978_10170688All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1389Open in IMG/M
3300009160|Ga0114981_10355611Not Available791Open in IMG/M
3300009160|Ga0114981_10572458All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300009163|Ga0114970_10505205All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes659Open in IMG/M
3300009164|Ga0114975_10225958Not Available1052Open in IMG/M
3300009164|Ga0114975_10363852Not Available793Open in IMG/M
3300009164|Ga0114975_10717512All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage527Open in IMG/M
3300009165|Ga0105102_10084563All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1464Open in IMG/M
3300009181|Ga0114969_10345627All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage865Open in IMG/M
3300009183|Ga0114974_10130236Not Available1591Open in IMG/M
3300009183|Ga0114974_10286442Not Available973Open in IMG/M
3300009184|Ga0114976_10088586All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1777Open in IMG/M
3300009184|Ga0114976_10271281Not Available915Open in IMG/M
3300009684|Ga0114958_10042083Not Available2491Open in IMG/M
3300010160|Ga0114967_10343544Not Available756Open in IMG/M
3300010233|Ga0136235_1013342All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2033Open in IMG/M
3300010368|Ga0129324_10412432Not Available521Open in IMG/M
3300011335|Ga0153698_1093Not Available37158Open in IMG/M
3300011335|Ga0153698_1107Not Available35604Open in IMG/M
3300011336|Ga0153703_1511All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage12798Open in IMG/M
3300011995|Ga0153800_1025972All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage609Open in IMG/M
3300012013|Ga0153805_1008737All Organisms → Viruses → Predicted Viral1754Open in IMG/M
3300012013|Ga0153805_1046572All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage736Open in IMG/M
3300012666|Ga0157498_1056195All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage604Open in IMG/M
3300013005|Ga0164292_10494931All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage802Open in IMG/M
3300013372|Ga0177922_10551278All Organisms → cellular organisms → Bacteria3107Open in IMG/M
3300013372|Ga0177922_10737900All Organisms → Viruses → Predicted Viral1112Open in IMG/M
3300013372|Ga0177922_10907554All Organisms → Viruses → Predicted Viral1374Open in IMG/M
3300015050|Ga0181338_1049937All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage611Open in IMG/M
3300015050|Ga0181338_1059111All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage553Open in IMG/M
3300017722|Ga0181347_1003039All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5615Open in IMG/M
3300017723|Ga0181362_1063301All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage757Open in IMG/M
3300017723|Ga0181362_1080183All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage659Open in IMG/M
3300017736|Ga0181365_1058810All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage955Open in IMG/M
3300017747|Ga0181352_1205320All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300017754|Ga0181344_1051660All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1226Open in IMG/M
3300017754|Ga0181344_1051906Not Available1223Open in IMG/M
3300017754|Ga0181344_1146119Not Available675Open in IMG/M
3300017774|Ga0181358_1102182Not Available1026Open in IMG/M
3300017774|Ga0181358_1119453Not Available927Open in IMG/M
3300017777|Ga0181357_1192950Not Available731Open in IMG/M
3300017778|Ga0181349_1290252All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes533Open in IMG/M
3300017784|Ga0181348_1188617Not Available747Open in IMG/M
3300017785|Ga0181355_1300946All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage602Open in IMG/M
3300019784|Ga0181359_1038196Not Available1859Open in IMG/M
3300020159|Ga0211734_10301003Not Available1652Open in IMG/M
3300020162|Ga0211735_10711020All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1204Open in IMG/M
3300020172|Ga0211729_10766908Not Available1548Open in IMG/M
3300020172|Ga0211729_10847180All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage554Open in IMG/M
3300021956|Ga0213922_1016955All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1900Open in IMG/M
3300021961|Ga0222714_10200153Not Available1154Open in IMG/M
3300021962|Ga0222713_10065013All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2722Open in IMG/M
3300021963|Ga0222712_10145062Not Available1608Open in IMG/M
3300021963|Ga0222712_10633772Not Available612Open in IMG/M
3300022179|Ga0181353_1062709All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage959Open in IMG/M
3300022190|Ga0181354_1093057All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage987Open in IMG/M
3300022190|Ga0181354_1193559Not Available610Open in IMG/M
3300022190|Ga0181354_1234695All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage530Open in IMG/M
3300022407|Ga0181351_1200228Not Available668Open in IMG/M
3300025543|Ga0208303_1030444Not Available1439Open in IMG/M
3300025645|Ga0208643_1075575All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage971Open in IMG/M
3300025896|Ga0208916_10321178Not Available675Open in IMG/M
3300027123|Ga0255090_1021956All Organisms → Viruses → Predicted Viral1105Open in IMG/M
3300027124|Ga0255116_1017729Not Available1055Open in IMG/M
3300027126|Ga0255098_1069540Not Available511Open in IMG/M
3300027132|Ga0255110_1004270All Organisms → Viruses → Predicted Viral2988Open in IMG/M
3300027329|Ga0255109_1034392Not Available1150Open in IMG/M
3300027375|Ga0255137_1049391Not Available783Open in IMG/M
3300027393|Ga0209867_1048087Not Available636Open in IMG/M
3300027547|Ga0209864_1018256Not Available815Open in IMG/M
3300027586|Ga0208966_1130470Not Available674Open in IMG/M
3300027608|Ga0208974_1032771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1559Open in IMG/M
3300027608|Ga0208974_1085431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage858Open in IMG/M
3300027608|Ga0208974_1088893All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage836Open in IMG/M
3300027659|Ga0208975_1008781All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3549Open in IMG/M
3300027659|Ga0208975_1073008Not Available1023Open in IMG/M
3300027733|Ga0209297_1000453All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage26559Open in IMG/M
3300027754|Ga0209596_1306567Not Available629Open in IMG/M
3300027763|Ga0209088_10096360Not Available1362Open in IMG/M
3300027785|Ga0209246_10279462All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage643Open in IMG/M
3300027785|Ga0209246_10335529All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage576Open in IMG/M
3300027797|Ga0209107_10008619All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5718Open in IMG/M
3300027798|Ga0209353_10048227All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1961Open in IMG/M
3300028025|Ga0247723_1032126All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1641Open in IMG/M
3300028113|Ga0255234_1153216Not Available606Open in IMG/M
3300031857|Ga0315909_10199957All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1584Open in IMG/M
3300031857|Ga0315909_10428184Not Available938Open in IMG/M
3300031885|Ga0315285_10501025All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage833Open in IMG/M
3300031952|Ga0315294_10811993All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage804Open in IMG/M
3300031963|Ga0315901_10386791Not Available1126Open in IMG/M
3300032046|Ga0315289_10354006All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1487Open in IMG/M
3300032092|Ga0315905_10182909All Organisms → Viruses → Predicted Viral2072Open in IMG/M
3300032092|Ga0315905_10554547Not Available1047Open in IMG/M
3300032093|Ga0315902_10037030Not Available5776Open in IMG/M
3300032093|Ga0315902_10481004Not Available1088Open in IMG/M
3300032093|Ga0315902_10555001All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage980Open in IMG/M
3300032093|Ga0315902_11311884All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage509Open in IMG/M
3300032116|Ga0315903_10105940All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2673Open in IMG/M
3300032116|Ga0315903_10678059Not Available775Open in IMG/M
3300032116|Ga0315903_11217316All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300033993|Ga0334994_0139046All Organisms → Viruses → Predicted Viral1379Open in IMG/M
3300033996|Ga0334979_0539548Not Available627Open in IMG/M
3300034012|Ga0334986_0296524All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage859Open in IMG/M
3300034022|Ga0335005_0004434All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10518Open in IMG/M
3300034061|Ga0334987_0235713All Organisms → Viruses → Predicted Viral1258Open in IMG/M
3300034062|Ga0334995_0049357All Organisms → Viruses → Predicted Viral3452Open in IMG/M
3300034062|Ga0334995_0076709Not Available2611Open in IMG/M
3300034101|Ga0335027_0270772All Organisms → Viruses → Predicted Viral1163Open in IMG/M
3300034102|Ga0335029_0053536All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2955Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake18.83%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic11.69%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake11.69%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous8.44%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater7.79%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater6.49%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton6.49%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.19%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater4.55%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.60%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.60%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.95%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater1.95%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand1.95%
Surface IceEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice1.30%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.30%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.65%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.65%
Freshwater, Surface IceEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice0.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.65%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.65%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.65%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004123Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (version 2)EnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005585Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRFEnvironmentalOpen in IMG/M
3300005943Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14EnvironmentalOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007622Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02EnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009684Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaGEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010233Filterable freshwater microbial communities from Conwy River, North Wales, UK. Fraction, filtered through 0.2 um filter. After WGA.EnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011335Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - GumanEnvironmentalOpen in IMG/M
3300011336Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - PaldangEnvironmentalOpen in IMG/M
3300011995Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012013Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface IceEnvironmentalOpen in IMG/M
3300012666Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2EnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300015050Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027123Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8dEnvironmentalOpen in IMG/M
3300027124Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8hEnvironmentalOpen in IMG/M
3300027126Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8dEnvironmentalOpen in IMG/M
3300027132Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8hEnvironmentalOpen in IMG/M
3300027329Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8hEnvironmentalOpen in IMG/M
3300027375Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8dEnvironmentalOpen in IMG/M
3300027393Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027547Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028113Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25908J49247_1006574223300003277Freshwater LakeMGDEGGFVIETIITIFAIGFLGITLAIGGVCLMVWMALNED*
Ga0065166_1020694343300004112Freshwater LakeMGDEGGFVIETIFTIFAIGFLGIALAIGGVCIMVWMALNED*
Ga0066181_1015917813300004123Freshwater LakeMELLSSRLGNAGCDVIETVITIFAIGFVGIALAIGSVCFMAWLALNES*
Ga0007787_1008447163300004240Freshwater LakeMELFSSGLGDEGGYVIETIITIFAIGFLGIALAIGGVCIMVWMALNED*
Ga0049081_1001041753300005581Freshwater LenticVIETIFTIFAIGFLGIALAIGGVCVMVWLALNED*
Ga0049081_1009647143300005581Freshwater LenticMELLYCGVGDAGGYVIETIFAVFAIGFLGVAVGVGVVCIMVWMALNED*
Ga0049081_1011032023300005581Freshwater LenticMGDEGGFVIETIITIFAIGFLGIALAIGGVCIMVWMALNED*
Ga0049081_1019716133300005581Freshwater LenticVIETILTIFAIGFLGIAVGVGVVCLMVWMALNED*
Ga0049081_1021903733300005581Freshwater LenticMLETIFAIFAIGFLGVAVGVGVVCIMVWMALNED*
Ga0049081_1022518533300005581Freshwater LenticMELFSGRVGNEGGYVIETIITIFAIGFLGIALAIGGVCLMVWMALNED*
Ga0049081_1023273333300005581Freshwater LenticMELFSGWVGNEGGYVIETIITIFAIGFLGIALAIGGVCLMVWMALNED*
Ga0049080_1004871333300005582Freshwater LenticVIETILAVFAVGFLGVAVGVGVVCLMVWMALNED*
Ga0049080_1013666833300005582Freshwater LenticGDEGGYVIETIITIFAIGFLGIALAIGGVCLMVWMALNED*
Ga0049080_1022613723300005582Freshwater LenticMGNEGGDVIETIITIFAIGFLGIALAIGGVCLMVWMALNEE*
Ga0049082_1017007433300005584Freshwater LenticMELFSIGLGDEGGYVIETVITIFALGFLGITLAISVICFMVWLALNES*
Ga0049084_10000423183300005585Freshwater LenticMIETILAVFAVGFLGVAVGIGVVCLMVWMALNED*
Ga0073926_1003272523300005943SandVRKCRYARQMELFSSRMGNEGRDVIETIFTIFALGFLGIALAVLFICFMVWLALNES*
Ga0075465_1015299313300006037AqueousRQVHQPCYARQMELLSSRVGNEGGHVIETVITIFAIGFLGIALAIGGVCIMVWMALNED*
Ga0075461_1024687923300006637AqueousMELLYCRMGDEGGFVIETVITIFAIGFLGIALAIGGVCIMVWMALNED*
Ga0070749_1049747333300006802AqueousMTETILAVFAIGFLGVAVGVGVVCLLVWMALNED*
Ga0075464_1087163723300006805AqueousMELLSSRVGNEGGHVIETVITIFAIGFLGIALAIGGVCIMVWM
Ga0075464_1101470523300006805AqueousMELFSSGLGNAGGDVIETIFTIFALGFLGIALAIGGVCIMVWMALNE
Ga0070748_132289413300006920AqueousVIETIFTIFALGFLGIALAIGVICLMVWMALNED*
Ga0070747_127239123300007276AqueousMIETILTIFAVGFFGVAVGVGTVCLLVWMALNED*
Ga0099847_101443923300007540AqueousVIETILAVFAVGFLGIAVGVGVICLMVWMALNED*
Ga0099847_103557243300007540AqueousMELLFVGVGNEGGDVIETILTIFAIGFLGIALAIGGVCIMVWLALNED*
Ga0099846_127606813300007542AqueousKKRRGKNWRRKMIETILAVFAIGFFGVAVGVGVVCLMVWMALNED*
Ga0102863_123419313300007622EstuarineGNEGGSVIETVITIFAIGFVGIALAIGSVCFMVWIALNES*
Ga0102859_119538613300007708EstuarineCGAFVIETIITIFAIGFLGIALAIGGVCLMVWMALNED*
Ga0105747_120003213300007974Estuary WaterKLCHYDTMELLSSRLGNEGGSVIETVLIIFGLGFLGIAIAISIICFMVWLALNES*
Ga0114340_107902163300008107Freshwater, PlanktonMIETIFTIFALGFLGIALAVLFICFMVWLALNES*
Ga0114336_103493033300008261Freshwater, PlanktonVIETIFTIFALGFLGIALAIGGVCIMVWLALNED*
Ga0114363_104401333300008266Freshwater, PlanktonMELFSSGLGNAGGDVIETIITIFALGFLGIALAIGGVCIMVWMALNED*
Ga0114363_113655723300008266Freshwater, PlanktonMIETILAVFAVGFLGVAVGIGVICLMVWMALNED*
Ga0114363_116831813300008266Freshwater, PlanktonSSGLGNAGGDVIETIFTIFALGFLGITLAVLCICFMVWLALNES*
Ga0114363_117304023300008266Freshwater, PlanktonMELFSSRMGNEGCDVIETIFTIFALGFLGIALAIGGVCIMVWLALNED*
Ga0114363_117389123300008266Freshwater, PlanktonMIEAILAVFAVGFLGVAVGVGVVCLMVWMALNED*
Ga0114363_118164123300008266Freshwater, PlanktonMIETIITIFALGFLGVAVGVGVVCLMVWMALNED*
Ga0114364_101483863300008267Freshwater, PlanktonMIETIFTIFAIGFLGIALAIGGVCIMVWMALNEE*
Ga0114364_106239913300008267Freshwater, PlanktonMELLSSRMGNAGCHVIETILVVFAVGFLGIALAIGGVCIMVWLALNED*
Ga0114876_107170323300008448Freshwater LakeMIETILAVFAVGFLGVAVGVGVVCVMVWLALNED*
Ga0114876_109676843300008448Freshwater LakeMELLFSGVGNAGGNVIETVITIFALGFLGIALAIGGVCIMVWMALNED*
Ga0114880_115250833300008450Freshwater LakeMIETIIIIFALGFLGIALAIGVVCVMVWMALNED*
Ga0114880_122285323300008450Freshwater LakeMELFSSRMGNEGCDVIETVITVFAIGFVGIALAIGSVCFMVWLALNES*
Ga0114962_1006895893300009151Freshwater LakeVIETILTIFALGFFGVAAGVGVICLMVWMALNED*
Ga0114978_1017068833300009159Freshwater LakeVIETIIAIFAVGFLGIAAGIGVVCLMVWMALNED*
Ga0114981_1035561123300009160Freshwater LakeKADGITFLQVGKCGAFVIETIITIFAIGFIGIALAIGGVCLMVWMALNED*
Ga0114981_1057245833300009160Freshwater LakeVIETILAVFAVGFLGIAVGIGVVCLMVWMALNED*
Ga0114970_1050520523300009163Freshwater LakeVIETIIAVFAVGFLGVAVGIGVVCLMVWMALNED*
Ga0114975_1022595833300009164Freshwater LakeLELLSGRVGNAGGYVIETIFAVFAIGFLGVAVGVGVVCIMVWMALNED*
Ga0114975_1036385213300009164Freshwater LakeVELFSSWLGDEGGDVIETIITIFALGFLGIALAIGGVCLMVWMALNED*
Ga0114975_1071751223300009164Freshwater LakeVIETIITIFALGFLGIALAIGGICLMVWMALNED*
Ga0105102_1008456333300009165Freshwater SedimentMIETILTIFAIGFLGIALAIGGVCIMVWLALNED*
Ga0114969_1034562733300009181Freshwater LakeMGNAGGYVIETIITIFALGFLGIALAIGGVCLMVWMALNED*
Ga0114974_1013023633300009183Freshwater LakeVIETIFAVFAIGFLGVAVGVGVVCIMVWMALNED*
Ga0114974_1028644233300009183Freshwater LakeFVIETVLIIFGLGFLGIAIAISIICFMIWLALNES*
Ga0114976_1008858633300009184Freshwater LakeMIETILAVFAVGFLGVAVGIAVVCLMVWMALNED*
Ga0114976_1027128133300009184Freshwater LakeVSETIFAVFAIGFLGVAVGVGVVCIMVWMALNED*
Ga0114958_1004208363300009684Freshwater LakeMIKTIFVVFAVGFFGVAAGVGVVCVMVWMALNED*
Ga0114967_1034354413300010160Freshwater LakeQPCYATALELLSSRMGNAGGYVIETIITIFALGFLGIALAIGGVCLMVWMALNED*
Ga0136235_101334253300010233FreshwaterVIETIIAVFAVGFLGIAVGIGVVCLMVWMALNED*
Ga0129324_1041243213300010368Freshwater To Marine Saline GradientIYGWRQVHQSCYARTLELLYCGVGDARCDVIETIFTIVAIGFLGIALAIGGVCIMVWMALNED*
Ga0153698_1093213300011335FreshwaterVIETILTIFAIGFLGIALAIGGVCIMVWLALNED*
Ga0153698_1107213300011335FreshwaterMELFSSGLGNAGGDVIETILAVFAVGFLGVAVGVGVICLMVWMALNED*
Ga0153703_1511303300011336FreshwaterMELLFIGLGNAGGYVIETIFAVFAIGFLGVAVGVGVVCIMVWMALNED*
Ga0153800_102597223300011995FreshwaterMELFSSGVGNAGGYVIETIITIFAIGFLGIALAIGGVCIMVWMALNED*
Ga0153805_100873713300012013Surface IceMLETIFAVFAIGFLGVAVGVGVVCIMVWMALNED*
Ga0153805_104657233300012013Surface IceMELLYCGVGNAGGYVIETIFAVFAIGFLGVAVGVGVVCIMVWMALNED*
Ga0157498_105619513300012666Freshwater, Surface IceMELFYCGVGNEGGYVIETVIAVFAIGFLGVAVGVGVVCIMVWMALNED*
Ga0164292_1049493123300013005FreshwaterMIETILAVFAVGFLGIAVGVGAVCLMVWMALNED*
Ga0177922_1055127883300013372FreshwaterMELFYCRLGDEGGYVIETIFAVFAIGFLGVAVGVGVVCIMVWMALNED*
Ga0177922_1073790043300013372FreshwaterVIETVIAVFAIGFLGVAVGVGVVCIMVWMALNED*
Ga0177922_1090755443300013372FreshwaterMELLFVGVGNEGGYVIETIFAVFAIGFLGVAVGVGVVCIMVWMALN
Ga0181338_104993733300015050Freshwater LakeVIETIIAVFAVGFLGIAVGVGVVCLMVWMALNED*
Ga0181338_105911123300015050Freshwater LakeMVETIFTVFAVGFLGVAVAIGGVCVMVWLALNED*
Ga0181347_100303933300017722Freshwater LakeMELFSSRMGNEGGHVIETIITIFALGFLGIALAIGGVCLMVWMALNED
Ga0181362_106330123300017723Freshwater LakeMELLYSRLGNEGGHVIETIITIFALGFLGIALAIGGVCLMVWMALNED
Ga0181362_108018323300017723Freshwater LakeMELLYCGVGDEGGYVIETIITILAIGFLGVAVGVGVVCIMVWMALNED
Ga0181365_105881023300017736Freshwater LakeMELLYCGVGNAGGYVIETIFAVFAIGFLGVAVGVGVVCIMVWMALNED
Ga0181352_120532023300017747Freshwater LakeMELFSSGLGNAGGDVIETIITIFALGFLGIALAIGGVCIMVWMALNED
Ga0181344_105166063300017754Freshwater LakeVFVIETIITIFAIGFLGIALAIGGVCIMVWMALNED
Ga0181344_105190633300017754Freshwater LakeGKCGVFVIETIITIFAIGFLGIALAIGGVCIMVWMALNED
Ga0181344_114611913300017754Freshwater LakeMELLFSRMGNEGGYVIETVLIIFGLGFVGIALAISVICFMVWLALNES
Ga0181358_110218233300017774Freshwater LakeLSSRLGNAGCDVIETVITIFAIGFVGISLAIGSVCFMVWLALNES
Ga0181358_111945333300017774Freshwater LakeRLGNAGCDVIETVITIFAIGFVGITLAIGSVCFMVWLALNES
Ga0181357_119295023300017777Freshwater LakeVRDEGGYVIETIITIFAIGFLGVAVGVGVVCIMVWMALNED
Ga0181349_129025213300017778Freshwater LakeAFVIETIITIFAIGFLGIALAIGGVCLMVWMALNED
Ga0181348_118861713300017784Freshwater LakeTHDRRQVHQPRYAGQVELFSSGLGNAGGYVIETVLIIFGLGFVGIALAMSVICFMVWLALNES
Ga0181355_130094623300017785Freshwater LakeMELFSSRLGNAGCDVIETVITIFAIGFVGITLAIGSVCFMVWLALNES
Ga0181359_103819643300019784Freshwater LakeMELFSSGLGDEGGYVIETIITIFAIGFLGIALAIGGVCIMVWMALNED
Ga0211734_1030100313300020159FreshwaterQVHQPGYARALELFLGRLGDEGCDVIETILTIFAIGFLGIALAIGGVCIMVWLALNED
Ga0211735_1071102043300020162FreshwaterVHQPGYARALELFPGRLGDEGCDVIETILTIFAIGFLGIALAIGGVCIMVWLALNED
Ga0211729_1076690823300020172FreshwaterMELLFIGLGDEGGDVIETIFTIFALGFLGIALAVLNICFMVWLALNES
Ga0211729_1084718023300020172FreshwaterMELLSSRVGNAGGHVIETIFTIFAIGFLGIALAIGGVCIMVWMALNED
Ga0213922_101695553300021956FreshwaterGDARRSVIETIITIFAIGFLGIALAIGGVCLMVWMALNED
Ga0222714_1020015333300021961Estuarine WaterMELLFVGLGNEGCDVIETIFTIFALGFLGIALAVFFICFMVWLALNES
Ga0222713_1006501333300021962Estuarine WaterMELLYCGVGNAGGDVIETIITIFALGFLGIALAIGGVCLMVWMALNED
Ga0222712_1014506233300021963Estuarine WaterMELFSSGVGNAGGHVIETIITIFAIGFLGIALAIGGVCIMVWMALNED
Ga0222712_1063377233300021963Estuarine WaterYVIETIFAVFAIGFLGVAVGVGVVCIMVWMALNED
Ga0181353_106270923300022179Freshwater LakeMGDEGGFVIETIFTIFAIGFLGIALAIGGVCIMVWMALNED
Ga0181354_109305713300022190Freshwater LakeMELLSSRLGNAGCDVIETVITIFAIGFVGIALAIG
Ga0181354_119355923300022190Freshwater LakeMELLYCRVGNEGGYVIETIITIFALGFLGIALAIGGVCLMVWMALNED
Ga0181354_123469533300022190Freshwater LakeVIETVIAVFAIGFLGVAVGVGVVCIMVWMALNDSPDRKST
Ga0181351_120022823300022407Freshwater LakeRQVHQPRYAGQVELFSSGLGNAGGYVIETVLIIFGLGFVGITLAISVICFMVWLALNES
Ga0208303_103044453300025543AqueousCVVIETILAVFAVGFLGIAVGVGVICLMVWMALNED
Ga0208643_107557543300025645AqueousMELFSSGLGNAGGYVIETIFTIFAIGFLGISLAIGGVCIMVWMALNED
Ga0208916_1032117823300025896AqueousMDVKMLETIFAIFAIGFLGVAVGVGVVCIMVWLALNED
Ga0255090_102195613300027123FreshwaterMELLFIGLGNAGGYVIETVLIIFGLGFLGIALAISVICFMVW
Ga0255116_101772913300027124FreshwaterQMELFFVGLGNEGGSVIETVITIFAIGFVGIALAIGSVCFMVWLALNES
Ga0255098_106954013300027126FreshwaterAGGYVIETVLIIFGLGFLGIALAISVICFMVWLALNES
Ga0255110_100427023300027132FreshwaterMELFFVGLGNEGGSVIETVITIFAIGFVGIALAIGSVCFMVWLALNES
Ga0255109_103439233300027329FreshwaterVRQSEYDYPMELLFVGLGNEGCSVIETVITIFAIGFLGVAVGVGVVCLMVWMALNES
Ga0255137_104939123300027375FreshwaterMELLFVGLGNEGCSVIETVITIFAIGFLGVAVGVGVVCLMVWMALNES
Ga0209867_104808713300027393SandQVRKCRYARQMELFSSRMGNEGRDVIETIFTIFALGFLGIALAVLFICFMVWLALNES
Ga0209864_101825623300027547SandMELFSSRMGNEGRDVIETIFTIFALGFLGIALAVLFICFMVWLALNES
Ga0208966_113047013300027586Freshwater LenticELLYCRMGDEGGFVIETIITIFAIGFLGIALAIGGVCLMVWMALNED
Ga0208974_103277153300027608Freshwater LenticGAFVIETIITIFAIGFLGIALAIGGVCLMVWMALNED
Ga0208974_108543123300027608Freshwater LenticMELFSGRVGNERGDVIETIITLFAIGFLGIALAIGGVCLMVWMALNED
Ga0208974_108889323300027608Freshwater LenticMELFSGRVGNEGGYVIETIITIFAIGFLGIALAIGGVCLMVWMALNED
Ga0208975_100878173300027659Freshwater LenticMELLYCGVGDAGGYVIETIFAVFAIGFLGVAVGVGVVCIMVWMALNED
Ga0208975_107300823300027659Freshwater LenticMGDEGGFVIETIITIFAIGFLGIALAIGGVCIMVWMALNED
Ga0209297_1000453253300027733Freshwater LakeMELLYSRMGNEGGYVIETIITIFALGFLGIALAIGGVCLIVWMALNES
Ga0209596_130656723300027754Freshwater LakeTALELLSSRMGNAGGYVIETIITIFALGFLGIALAIGGVCLIVWMALNES
Ga0209088_1009636023300027763Freshwater LakeMGNEGGDVIETIITIFALGFLGIALAIGGVCLMVWMALNED
Ga0209246_1027946213300027785Freshwater LakeMELLSSRLGNAGCDVIETVITIFAIGFVGIALAIGSVCFMVWLALNES
Ga0209246_1033552933300027785Freshwater LakeMELLFIGLGNAGGYVIETVIAVFAIGFLGVAVGVGVVCIMVWMALNED
Ga0209107_10008619113300027797Freshwater And SedimentQPCYARQMELLYCRMGNEGGDVIETIITIFAIGFLGIALAIGGVCLMVWMALNEE
Ga0209353_1004822783300027798Freshwater LakeMGDEGGFVIETIITIFAIGFLGITLAIGGVCLMVWMALNED
Ga0247723_103212633300028025Deep Subsurface SedimentEGGYVIETIITIFALGFLGIALAIGGVCIIVWMALNES
Ga0255234_115321623300028113FreshwaterGGYVIETVLIIFGLGFLGIALAISVICFMVWLALNES
Ga0315909_1019995723300031857FreshwaterMELLFVGVGNEGGDVIETVLIIFGLGFVGITLAISVICFMVWLALNES
Ga0315909_1042818423300031857FreshwaterARQMELLYSRMGNEGGDVIETVLIIFGLGFLGITLAISVICFMVWLALNES
Ga0315285_1050102533300031885SedimentMELFSGRVGNAGGDVIETIITIFAIGFLGIALAIGGVCLMVWMALNED
Ga0315294_1081199333300031952SedimentMGNAGGDVIETIITIFAIGFLGIALAIGGVCLMVWM
Ga0315901_1038679133300031963FreshwaterRQVHQCRYATTMELFSSGLGNAGGDVIETIITIFALGFLGIALAIGGVCIMVWMALNED
Ga0315289_1035400643300032046SedimentMELFSGRVGNEGGDVIEIIITVFAIGFLGIALAIGGVCLMVWMALNED
Ga0315905_1018290943300032092FreshwaterMELFSSRLGNAGCDVIETVITIFAIGFVGIALAIGSVCFMVWLALNES
Ga0315905_1055454753300032092FreshwaterMELFSRRMGNEGGHVIETVLIIFGLGFVGIALAMSVICFMVWLALNE
Ga0315902_1003703083300032093FreshwaterMELFSSRMGNEGCDVIETIFTIFALGFLGIALAIGGVCIMVWLALNED
Ga0315902_1048100413300032093FreshwaterQVQQPCYARTLELFSSGLGDEGCDVIETIFTIFALGFLGIALAIGGVCLMVWMALNED
Ga0315902_1055500113300032093FreshwaterMELFSSGLGDEGGDVIETIITIFAIGFLGIALAIGSVCFMVWLALNES
Ga0315902_1131188413300032093FreshwaterYCGVGNEGGYVIETIFTIFAIGFLGIALAIGGVCIMVWMALNEE
Ga0315903_1010594063300032116FreshwaterVQQPCYARTLELFSSGLGDEGCDVIETIFTIFALGFLGIALAIGGVCLMVWMALNED
Ga0315903_1067805923300032116FreshwaterMELLYCGVGNEGGYVIETIFTIFAIGFLGIALAIGGVCIMVWMALNEE
Ga0315903_1121731613300032116FreshwaterMELFSSGLGDEGCDVIETIFTIFALGFLGIALAIGGVCLMVW
Ga0334994_0139046_1218_13643300033993FreshwaterMELLYCGVGNAGGYVIETVIAVFAIGFLGVAVGVGVVCIMVWMALNED
Ga0334979_0539548_2_1333300033996FreshwaterSRVGNEGGHVIETVITIFAIGFLGIALAIGGVCIMVWMALNED
Ga0334986_0296524_348_4943300034012FreshwaterMELLYSRMGNAGGYVIETIITIFAIGFLGIALAIGGVCLMVWMALNED
Ga0335005_0004434_9707_98533300034022FreshwaterMELFYCGVGNAGGHVIETIFTIFAIGFLGIALAIGGVCIMVWMALNED
Ga0334987_0235713_720_8663300034061FreshwaterMELFSSGLGDEGGYVIETIITIFAIGFLGIALAIGGVCLMVWMALNEE
Ga0334995_0049357_1585_17103300034062FreshwaterMGDEGGFVIETIITIFAIGFLGIALAIGGVCLMVWMALNED
Ga0334995_0076709_1483_16293300034062FreshwaterMELFSSGLGNEGGYVIETIFTIFAIGFLGIALAIGGVCLMVWMALNEE
Ga0335027_0270772_868_9933300034101FreshwaterMGDEGGFVIETIITIFAIGFLGIALAIGGVCIMVWLALNED
Ga0335029_0053536_674_8203300034102FreshwaterMELLSSRVGNEGGHVIETVITIFAIGFLGIALAIGGVCIMVWMALNED


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.