NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F044406

Metagenome / Metatranscriptome Family F044406

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044406
Family Type Metagenome / Metatranscriptome
Number of Sequences 154
Average Sequence Length 42 residues
Representative Sequence MLPVAEMLPLAAAGWAFLVWLFGGGLGLALVVFIVLKLLGK
Number of Associated Samples 105
Number of Associated Scaffolds 154

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 75.50 %
% of genes near scaffold ends (potentially truncated) 18.18 %
% of genes from short scaffolds (< 2000 bps) 85.71 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (59.091 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere
(9.091 % of family members)
Environment Ontology (ENVO) Unclassified
(29.221 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(52.597 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.17%    β-sheet: 0.00%    Coil/Unstructured: 47.83%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 154 Family Scaffolds
PF01343Peptidase_S49 11.69
PF11897DUF3417 3.90
PF00005ABC_tran 2.60
PF06170DUF983 2.60
PF02548Pantoate_transf 1.95
PF07609DUF1572 1.30
PF14559TPR_19 1.30
PF00111Fer2 1.30
PF01408GFO_IDH_MocA 1.30
PF07589PEP-CTERM 1.30
PF04367DUF502 0.65
PF12796Ank_2 0.65
PF13302Acetyltransf_3 0.65
PF13377Peripla_BP_3 0.65
PF00067p450 0.65
PF13810DUF4185 0.65
PF16542PNKP_ligase 0.65
PF00677Lum_binding 0.65
PF01479S4 0.65
PF13560HTH_31 0.65
PF02321OEP 0.65
PF01368DHH 0.65
PF00126HTH_1 0.65
PF01906YbjQ_1 0.65
PF01844HNH 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 154 Family Scaffolds
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 23.38
COG5349Uncharacterized conserved protein, DUF983 familyFunction unknown [S] 2.60
COG0413Ketopantoate hydroxymethyltransferaseCoenzyme transport and metabolism [H] 1.95
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.30
COG0307Riboflavin synthase alpha chainCoenzyme transport and metabolism [H] 0.65
COG0393Uncharacterized pentameric protein YbjQ, UPF0145 familyFunction unknown [S] 0.65
COG2124Cytochrome P450Defense mechanisms [V] 0.65
COG2928Uncharacterized membrane proteinFunction unknown [S] 0.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms59.09 %
UnclassifiedrootN/A40.91 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908004|PBDC3_FIDWTPW02P9HH9Not Available506Open in IMG/M
2124908004|PBDC3_FIDWTPW02RBNCBNot Available508Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101557883All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium971Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104716560All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium593Open in IMG/M
3300001537|A2065W1_10019867All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium2066Open in IMG/M
3300001538|A10PFW1_11742787All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300004114|Ga0062593_100128399All Organisms → cellular organisms → Bacteria1867Open in IMG/M
3300004114|Ga0062593_100458812All Organisms → cellular organisms → Bacteria1164Open in IMG/M
3300004114|Ga0062593_100470493All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300004114|Ga0062593_103195845Not Available525Open in IMG/M
3300004156|Ga0062589_101721952All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae626Open in IMG/M
3300004157|Ga0062590_101221509All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae734Open in IMG/M
3300004480|Ga0062592_102303906Not Available538Open in IMG/M
3300005175|Ga0066673_10117961All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1445Open in IMG/M
3300005187|Ga0066675_10890392Not Available673Open in IMG/M
3300005329|Ga0070683_100367624All Organisms → cellular organisms → Bacteria1370Open in IMG/M
3300005331|Ga0070670_100927492All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium790Open in IMG/M
3300005335|Ga0070666_10922751All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae646Open in IMG/M
3300005336|Ga0070680_100884590Not Available770Open in IMG/M
3300005345|Ga0070692_10818884All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300005355|Ga0070671_100351872All Organisms → cellular organisms → Bacteria1257Open in IMG/M
3300005356|Ga0070674_101982155Not Available530Open in IMG/M
3300005367|Ga0070667_101590021Not Available614Open in IMG/M
3300005435|Ga0070714_100345615All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1396Open in IMG/M
3300005435|Ga0070714_100789354Not Available919Open in IMG/M
3300005455|Ga0070663_101038251Not Available714Open in IMG/M
3300005548|Ga0070665_101531904Not Available675Open in IMG/M
3300005719|Ga0068861_102392345Not Available531Open in IMG/M
3300005842|Ga0068858_101679248Not Available627Open in IMG/M
3300005844|Ga0068862_100511395Not Available1141Open in IMG/M
3300005944|Ga0066788_10090303All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae752Open in IMG/M
3300005993|Ga0080027_10273187All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae669Open in IMG/M
3300006046|Ga0066652_100791556All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium906Open in IMG/M
3300006755|Ga0079222_11553283All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300006844|Ga0075428_100381484All Organisms → cellular organisms → Bacteria1511Open in IMG/M
3300006854|Ga0075425_100501410All Organisms → cellular organisms → Bacteria1398Open in IMG/M
3300006871|Ga0075434_102665082Not Available500Open in IMG/M
3300006876|Ga0079217_10263543All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium929Open in IMG/M
3300006876|Ga0079217_10342365Not Available852Open in IMG/M
3300006894|Ga0079215_11619183Not Available515Open in IMG/M
3300007004|Ga0079218_10451693All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300007004|Ga0079218_11864643Not Available678Open in IMG/M
3300007521|Ga0105044_11306581Not Available531Open in IMG/M
3300009012|Ga0066710_104696477All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300009083|Ga0105047_10019166All Organisms → cellular organisms → Bacteria10572Open in IMG/M
3300009083|Ga0105047_10061732All Organisms → cellular organisms → Bacteria5058Open in IMG/M
3300009093|Ga0105240_11194374Not Available806Open in IMG/M
3300009098|Ga0105245_12311717All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae591Open in IMG/M
3300009098|Ga0105245_12986938All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae524Open in IMG/M
3300009100|Ga0075418_11129223All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae849Open in IMG/M
3300009137|Ga0066709_100353281All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2021Open in IMG/M
3300009137|Ga0066709_100832128All Organisms → cellular organisms → Bacteria1340Open in IMG/M
3300009137|Ga0066709_102399108Not Available717Open in IMG/M
3300009137|Ga0066709_102509853Not Available695Open in IMG/M
3300009148|Ga0105243_11832353Not Available638Open in IMG/M
3300009156|Ga0111538_11107604All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300009156|Ga0111538_11221102Not Available950Open in IMG/M
3300009177|Ga0105248_12007592Not Available657Open in IMG/M
3300009177|Ga0105248_12691291Not Available567Open in IMG/M
3300009553|Ga0105249_12552956All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300009840|Ga0126313_10913273All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae717Open in IMG/M
3300009840|Ga0126313_11206067Not Available624Open in IMG/M
3300010039|Ga0126309_10731280All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium639Open in IMG/M
3300010040|Ga0126308_10871097Not Available626Open in IMG/M
3300010042|Ga0126314_11158242All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae577Open in IMG/M
3300010044|Ga0126310_11186684Not Available612Open in IMG/M
3300010154|Ga0127503_10103380All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae645Open in IMG/M
3300011333|Ga0127502_10808150Not Available1007Open in IMG/M
3300011415|Ga0137325_1050268Not Available887Open in IMG/M
3300011423|Ga0137436_1099163Not Available768Open in IMG/M
3300012046|Ga0136634_10447716All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300012212|Ga0150985_100711759Not Available644Open in IMG/M
3300012212|Ga0150985_101952382All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium567Open in IMG/M
3300012212|Ga0150985_105170740Not Available1022Open in IMG/M
3300012212|Ga0150985_106248819Not Available844Open in IMG/M
3300012212|Ga0150985_109660248Not Available681Open in IMG/M
3300012212|Ga0150985_112254734Not Available1348Open in IMG/M
3300012212|Ga0150985_112425817All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae540Open in IMG/M
3300012212|Ga0150985_115142399All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300012212|Ga0150985_115299278All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae649Open in IMG/M
3300012212|Ga0150985_117661426Not Available560Open in IMG/M
3300012212|Ga0150985_119603664All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae588Open in IMG/M
3300012212|Ga0150985_119974272All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae576Open in IMG/M
3300012212|Ga0150985_120260800All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae584Open in IMG/M
3300012212|Ga0150985_121478069Not Available696Open in IMG/M
3300012469|Ga0150984_103184736All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae912Open in IMG/M
3300012469|Ga0150984_104431712All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae649Open in IMG/M
3300012469|Ga0150984_106949142All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae608Open in IMG/M
3300012469|Ga0150984_107964910All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula517Open in IMG/M
3300012469|Ga0150984_110338792All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium582Open in IMG/M
3300012469|Ga0150984_112553553Not Available617Open in IMG/M
3300012469|Ga0150984_116416842All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae542Open in IMG/M
3300012469|Ga0150984_117489912All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae656Open in IMG/M
3300012469|Ga0150984_118188329All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae707Open in IMG/M
3300012469|Ga0150984_119618526Not Available1473Open in IMG/M
3300012469|Ga0150984_122808644All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae825Open in IMG/M
3300012532|Ga0137373_11137599All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae556Open in IMG/M
3300012956|Ga0154020_10033970All Organisms → cellular organisms → Bacteria5475Open in IMG/M
3300013296|Ga0157374_11926782All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300013307|Ga0157372_10144692All Organisms → cellular organisms → Bacteria2741Open in IMG/M
3300013308|Ga0157375_12312490All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae641Open in IMG/M
3300014501|Ga0182024_10098844All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia4258Open in IMG/M
3300015052|Ga0137411_1218376Not Available667Open in IMG/M
3300015360|Ga0163144_10004866All Organisms → cellular organisms → Bacteria30086Open in IMG/M
3300015360|Ga0163144_10046667All Organisms → cellular organisms → Bacteria7794Open in IMG/M
3300015360|Ga0163144_10407890All Organisms → cellular organisms → Bacteria1615Open in IMG/M
3300015371|Ga0132258_10505316All Organisms → cellular organisms → Bacteria3024Open in IMG/M
3300015371|Ga0132258_12451952All Organisms → cellular organisms → Bacteria1306Open in IMG/M
3300015371|Ga0132258_13236535Not Available1122Open in IMG/M
3300015371|Ga0132258_13798228Not Available1029Open in IMG/M
3300017658|Ga0182738_1035532All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae3344Open in IMG/M
3300018073|Ga0184624_10218018Not Available853Open in IMG/M
3300018422|Ga0190265_13406247Not Available530Open in IMG/M
3300018432|Ga0190275_11799338All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300018476|Ga0190274_10607709All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1121Open in IMG/M
3300018482|Ga0066669_10567485All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium991Open in IMG/M
3300018890|Ga0193595_1000020All Organisms → cellular organisms → Bacteria62687Open in IMG/M
3300019362|Ga0173479_10568849All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae586Open in IMG/M
3300020005|Ga0193697_1007905All Organisms → cellular organisms → Bacteria2590Open in IMG/M
3300020180|Ga0163155_10377943All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes633Open in IMG/M
3300021344|Ga0193719_10006559All Organisms → cellular organisms → Bacteria4798Open in IMG/M
3300022756|Ga0222622_10362802Not Available1012Open in IMG/M
3300022756|Ga0222622_11253259Not Available546Open in IMG/M
3300023272|Ga0247760_1187582Not Available532Open in IMG/M
3300025893|Ga0207682_10062637All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium1560Open in IMG/M
3300025903|Ga0207680_10465687All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300025908|Ga0207643_10335934All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae946Open in IMG/M
3300025913|Ga0207695_11431407Not Available571Open in IMG/M
3300025917|Ga0207660_10529094Not Available958Open in IMG/M
3300025925|Ga0207650_10782800All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium808Open in IMG/M
3300025929|Ga0207664_10304413All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1403Open in IMG/M
3300025931|Ga0207644_11828705Not Available508Open in IMG/M
3300025935|Ga0207709_10684868All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae819Open in IMG/M
3300025937|Ga0207669_11053990All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium685Open in IMG/M
3300026088|Ga0207641_10815446All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium924Open in IMG/M
3300026089|Ga0207648_11932187Not Available552Open in IMG/M
3300026536|Ga0209058_1345247Not Available515Open in IMG/M
3300027637|Ga0209818_1096329Not Available778Open in IMG/M
3300027907|Ga0207428_10982214Not Available594Open in IMG/M
3300027909|Ga0209382_10202544All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum2274Open in IMG/M
3300028380|Ga0268265_10673062All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → environmental samples → uncultured Phycisphaerae bacterium997Open in IMG/M
3300031022|Ga0138301_1367601Not Available502Open in IMG/M
3300031093|Ga0308197_10408754All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae533Open in IMG/M
3300031938|Ga0308175_100008858All Organisms → cellular organisms → Bacteria7433Open in IMG/M
3300031995|Ga0307409_100844315All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium926Open in IMG/M
3300031995|Ga0307409_102703324Not Available524Open in IMG/M
3300032002|Ga0307416_100086088All Organisms → cellular organisms → Bacteria2678Open in IMG/M
3300032069|Ga0315282_10039400All Organisms → cellular organisms → Bacteria5571Open in IMG/M
3300032420|Ga0335397_10039259All Organisms → cellular organisms → Bacteria5315Open in IMG/M
3300034384|Ga0372946_0287489Not Available797Open in IMG/M
3300034384|Ga0372946_0509491Not Available584Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere9.09%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere7.79%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.19%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.55%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.90%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.25%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.25%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat2.60%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater2.60%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.95%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.95%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.95%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.30%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.30%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.30%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.30%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.30%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.30%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.30%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.30%
Poplar Biomass BioreactorEngineered → Solid Waste → Wood → Composting → Bioreactor → Poplar Biomass Bioreactor1.30%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.65%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.65%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.65%
CompostEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Compost0.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.65%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.65%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.65%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.65%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.65%
Active SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908004Poplar biomass bioreactor microbial communities from Brookhaven National Lab, NY - total biomass decay communityEngineeredOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001537Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007521Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009083Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly)EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011333Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011415Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300012046Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012956Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MGEngineeredOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015360Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017658Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 5th pass 30_C BE-Lig MG (version 2)EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300018890Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, bundles v1EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020180Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.SP4.G1EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023272Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L171-409R-4EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031022Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032069Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032420Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly)EnvironmentalOpen in IMG/M
3300034384Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
PBDC3_014676502124908004Poplar Biomass BioreactorMLATALPVAAAGWAFLVWLFGGGFGLALVVFFVLKFWAGNADRR
PBDC3_047657202124908004Poplar Biomass BioreactorMLATALPVAAAGWAFLVWLFGGGFGLALVVFFVLKVLGRYADRR
INPhiseqgaiiFebDRAFT_10155788323300000364SoilMEPLVMAIPLAAAGWAFLVWLCGGGFGLALVVFVVLKMLGK*
INPhiseqgaiiFebDRAFT_10471656013300000364SoilMETLAMMLPAAAAGWAFLVWLCGGGFGLALLVFIVLKILGR*
A2065W1_1001986743300001537PermafrostMSSELLAVMFPMAAAGPAFLVWLCGGGFGLAVVVFIVLKLFGK*
A10PFW1_1174278733300001538PermafrostDSAKGETMSSELLAVMFPMAAAGPAFLVWLCGGGFGLAVVVFIVLKLFGK*
Ga0062593_10012839933300004114SoilMEPLMTAIPLAAAGWAFLVWLFGGGFGLAIAVFIVLKLLGK*
Ga0062593_10045881213300004114SoilMMELATIFPLAAAGWAFLVWLFGGGFGLAILVFIVLKVLGR*
Ga0062593_10047049323300004114SoilMELATIVPLAAAGWAFLVWLFGGGFGLAILVFIVLKMLGK*
Ga0062593_10319584513300004114SoilMLELATIIPLAAAGWAFLVWLFGGGFGLAVLVFIVLKLLGR*
Ga0062589_10172195213300004156SoilPAGLTCGSREREETMEPLMTAIPLAAAGWAFLVWLFGGGFGLAIAVFIVLKLLGK*
Ga0062590_10122150913300004157SoilGVGPTKERKPMEPLMTAIPLAAAGWAFLVWLFGGGFGLAIAVFIVLKLLGK*
Ga0062592_10230390613300004480SoilMLELATVLPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR*
Ga0066673_1011796113300005175SoilMELATIFPLAAAGWAFLVWLCGGGFGLALLVFIVLKMLGR*
Ga0066675_1089039223300005187SoilMLDLATVLPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR*
Ga0070683_10036762413300005329Corn RhizosphereMLPVAEMLPLAAAGWAFLVWLCGGGVGLALVVFIVLKVLGK*
Ga0070670_10092749213300005331Switchgrass RhizosphereMETLALMMPLAAAGWAALVWLFGGGFGLALVVFIVLKLFGR*
Ga0070666_1092275113300005335Switchgrass RhizosphereEAAIMIPMAAAGWAFILTWLFGGGIGLFLLLFVVLKMLGK*
Ga0070680_10088459023300005336Corn RhizosphereMLIPMLPAAAAGWAGLVWLLGGGLPLAIIVFIVLKMMGR*
Ga0070692_1081888413300005345Corn, Switchgrass And Miscanthus RhizosphereMLELATILPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR*
Ga0070671_10035187223300005355Switchgrass RhizosphereMLIETALPMAAAGWAFLVWLFGGGLGMALVVFVVLKMLGR*
Ga0070674_10198215523300005356Miscanthus RhizosphereMTVDMILPMAAAGWAFLVWLFGGGFGLALLVFIVLKMFGK*
Ga0070667_10159002123300005367Switchgrass RhizosphereMENLALMMPLAAAGWAFLVWLFGGGFGLALVVFIVLKLFGR*
Ga0070714_10034561513300005435Agricultural SoilMIELATMLPLAAAGWAFLVWLFGGGFGLALVVFIVLKLLGD*
Ga0070714_10078935423300005435Agricultural SoilMVETVAMVVPVAAAGWAFLTWIFSGSIGLALVVFIVLKAMGR*
Ga0070663_10103825123300005455Corn RhizosphereVVPVAEMMPLAAAGWAFLVWLCGGGVGLAVVVFIVLKLLGK*
Ga0070665_10153190423300005548Switchgrass RhizosphereMMLELLPVAAAGWAFLVWLFGGGLGFALVVFVVLKMIGK*
Ga0068861_10239234523300005719Switchgrass RhizosphereMELATIVPLAAAGWAFLVWLFGGGFGLALVVFIVLKMLGK*
Ga0068858_10167924823300005842Switchgrass RhizosphereMETLAMMVPMAAAGWAFLVWLCGGGFGLALLVFIVLKVLGR*
Ga0068862_10051139523300005844Switchgrass RhizosphereMLPVAEMLPLAAAGWAFLVWLCGGGFGLAILVFIVLKMMGK*
Ga0066788_1009030323300005944SoilMMTPFATMFPMAAAGWAFLVWLCGGGFGLALVVFVVLKLLGR*
Ga0080027_1027318723300005993Prmafrost SoilMELVATMFPVAAAGWAFLVWLGGGGFGLALVVFVVLKLLGR*
Ga0066652_10079155633300006046SoilMYDLATMLPVAAAGWAFLVWLCGGGFGLAILVFIVLKMLGR*
Ga0079222_1155328313300006755Agricultural SoilMEDLVVPVAEMMPLGGGQAFLVWLCGGGVGLTVIVFIVLKLLGK*
Ga0075428_10038148423300006844Populus RhizosphereMIEIMTMLPLAAAGWAFLVWLFGGGLGLALIVFIVMKIVGH*
Ga0075425_10050141023300006854Populus RhizosphereMSELATILPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR*
Ga0075434_10266508213300006871Populus RhizosphereMLELAAVLPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR*
Ga0079217_1026354323300006876Agricultural SoilMELIVQSIPLAAAGWAFLVWLFGGGVGLALAVFLVLKLLGK*
Ga0079217_1034236533300006876Agricultural SoilMLPVAEILPLAAAGWAFLVWLFGGGLGLALVVFIVLKLLGK*
Ga0079215_1161918323300006894Agricultural SoilMELIVQSIPLAAAGWAFLVWLFGGGLGLALAVFLVLKLLGK*
Ga0079218_1045169323300007004Agricultural SoilMIEIMTMMPLAAAGWAFLVWLFGGGLGLALIVFLVMKLMGQ*
Ga0079218_1186464333300007004Agricultural SoilAEILPLAAAGWAFLVWLFGGGLGLALVVFIVLKLLGK*
Ga0105044_1130658123300007521FreshwaterLEDNMLLTLIPVAAAGWAFLVWLVGGGFGLALLVFLGLKLLGK*
Ga0066710_10469647723300009012Grasslands SoilMLELATIAPLAAAGWAFLTYLFTGSVGLALLVFIVLKIVGR
Ga0105047_1001916623300009083FreshwaterMLDILALTIPLAAAGYALLVWLFGGGLGLALVVFVLMKMLGK*
Ga0105047_1006173223300009083FreshwaterMLEVIHPTLEAAAAGWAFLVWLFGGGFTLAIIVFVVMKMMGK*
Ga0105240_1119437423300009093Corn RhizosphereMVETVAMIAPVAAAGWAFLTWILSGSFGLAIVVFIFLKVLGR*
Ga0105245_1231171723300009098Miscanthus RhizosphereMLEMLPVAAAGWAFLVWLFGGGLGLALVVFVVLKLLGQ*
Ga0105245_1298693823300009098Miscanthus RhizosphereLPMAAAGWAFLVWLFGGGLGMALVVCVVLKMLGR*
Ga0075418_1112922323300009100Populus RhizosphereMMLEMLPVAAAGWAFLVWLFGGGLGLALVVFVVLKLLGQ*
Ga0066709_10035328123300009137Grasslands SoilMLPLAALGWAFLVWLFGGGLGLAVVVFIVLKLMGK*
Ga0066709_10083212823300009137Grasslands SoilMLELATIAPLAAAGWAFLTYLFTGSVGLALLVFIVLKIVGR*
Ga0066709_10239910813300009137Grasslands SoilMVPVAEVLPLAAAGWAFLVWLFGGGLGLAVVVFIVLKLLGK*
Ga0066709_10250985323300009137Grasslands SoilMTPELMLPVAAAGWAFLAWLFGGGFGLAVVVFIVLKMLGR*
Ga0105243_1183235313300009148Miscanthus RhizosphereMMPLAAAGWAFLVWLCGGGVGLAVVVFIVLKLLGK*
Ga0111538_1110760423300009156Populus RhizosphereMLPLAAAGWAFLVWLCGGGFGLAILVFIVLKMMGK*
Ga0111538_1122110223300009156Populus RhizosphereMIEVMTMVPLAAAGWAFLVWLFGGGLGIAFIVFIVMKMLGH*
Ga0105248_1200759223300009177Switchgrass RhizosphereMFTEMLPMAAAGWAFLVWLFGGGFGLALVVFIVLKALGR*
Ga0105248_1269129123300009177Switchgrass RhizosphereMETLALMMPLAAAGWAFLVWLFGGGFGLARVVVIVLKLFGR*
Ga0105249_1255295623300009553Switchgrass RhizosphereVPLAAAGWAFLVWLFGGGFGLAILVFIVLKMLGK*
Ga0126313_1091327323300009840Serpentine SoilMMLELLPVAAAGWAFLVWLFGGGLGLALVVFVVMKLIGH*
Ga0126313_1120606713300009840Serpentine SoilMMPLAAAGWAFLVWLCGGGVGLAIVVFIVLKLLGK*
Ga0126309_1073128023300010039Serpentine SoilMAIPLAAAGWAFLVWLCGGGFGLALVVFIVLKMFGK*
Ga0126308_1087109713300010040Serpentine SoilMNIMFVTEMLPLAAAGLAFLVWLFGGGLGFALVVFIVLKMLGK*
Ga0126314_1115824223300010042Serpentine SoilMITMLPAAAAGWAFLVWLFGGGFGLALVVFIVLKMLGK*
Ga0126310_1118668423300010044Serpentine SoilMILPVAAAGWAFLVWLFGGGFGLALVVFIVLKMLGR*
Ga0127503_1010338013300010154SoilARDNQENAMETLAMILPMAAAGWAFLVWLCGGGFGLALLVFIVLKVLGR*
Ga0127502_1080815023300011333SoilMLEVATLIPLAAAGWAFLVWLFGGGLGLALIVFVALKLMGK*
Ga0137325_105026823300011415SoilMMELATVLPMAAAGWAFLVWLLGGGLGLAIVVFIVLKMLGR*
Ga0137436_109916323300011423SoilMMEIMTMMPLAAAGWAFLVWLFGGGLGLALIVFLGMKMLGK*
Ga0136634_1044771623300012046Polar Desert SandGDRKMELATLLPVAAAGWAFLVWLLGGGLGLALLVFIVLKVIGR*
Ga0150985_10071175913300012212Avena Fatua RhizosphereMLELATLFPLAAAGWAFLVWLFGGGFGLAVLVFIVLKVLGR*
Ga0150985_10195238213300012212Avena Fatua RhizosphereRLVYERRSCMETLATILPLAAAGWAFLVWLFGGGFGLALVVFVVLKMLGK*
Ga0150985_10517074013300012212Avena Fatua RhizosphereMVPMLSEMMILGAAGWAFLVWLCGGGFGLAILVFIVLKVLGK*
Ga0150985_10624881923300012212Avena Fatua RhizosphereMLPVAEVLPLAAAGWAFLVWLCGGGFGLAVVVFIVLKLMGK*
Ga0150985_10966024823300012212Avena Fatua RhizosphereMIIEMVPFAAAGWAFLVWLFGGGFGLALVVFLVLKMMGR*
Ga0150985_11225473413300012212Avena Fatua RhizosphereMVPMVAEMAILGAAGWAFLVWLCGGGFGLAIVVFIVLKLLGK*
Ga0150985_11242581713300012212Avena Fatua RhizosphereQRSRAMENLALMMPLAAAGWAFLVWLFGGGFGLALVVFIVLKLFGR*
Ga0150985_11514239913300012212Avena Fatua RhizosphereMITTMLPAAAAGWAFLVWLFGGGFGLAVVVFIVLKMLGR*
Ga0150985_11529927823300012212Avena Fatua RhizosphereRALPQRSRAMENLALMMPLAAAGWAFLVWLFGGGFGLALVVFIVLKLFGR*
Ga0150985_11766142623300012212Avena Fatua RhizosphereMVPMVAEMAILGAAGWAFLVWLCGGGFGLAVVVFIVLKLLGK*
Ga0150985_11960366413300012212Avena Fatua RhizosphereMETLAMIFPMAAAGWAFLVWLCGGGFGLALLVFIVLKVLGR*
Ga0150985_11997427213300012212Avena Fatua RhizosphereRHTPERKDHVMMLELLPVAAAGWAFLVWLFGGGLGLALVVFVVLKLIGQ*
Ga0150985_12026080023300012212Avena Fatua RhizosphereMETLAMMIPMAAAGWAFLVWLCGGGFGLALLVFIVLKVLGR*
Ga0150985_12147806923300012212Avena Fatua RhizosphereMLELATILPMAAAGWAFLVWLFGGGFGLAILVFIVLKALGR*
Ga0150984_10318473623300012469Avena Fatua RhizosphereRTQMETLAMIFPMAAAGWAFLVWLCGGGFGLPLLVFIVLKVLGR*
Ga0150984_10443171213300012469Avena Fatua RhizosphereRALPQRRRAMENLALMMPLAAAGWAFLVWLFGGGFGLALVVFIVLKLFGR*
Ga0150984_10635611723300012469Avena Fatua RhizosphereDVCSSDLNHMLEAAIMIPMAAAGWAFILTWLFGGGIGLFLLLFVVLKMLGK*
Ga0150984_10694914223300012469Avena Fatua RhizosphereKRALPQRSRAMENLALMMPLAAAGWAFLVWLFGGGFGLALVVFIVLKLFGR*
Ga0150984_10796491013300012469Avena Fatua RhizosphereMQELAMMYPMAAAGWAFLVWLFGGGIGAALVVFVLLKMLGK*
Ga0150984_11033879223300012469Avena Fatua RhizosphereMLELATMVPMAAAGWAFLVWLFGGGFGLALIVFIVLKMIGR*
Ga0150984_11255355323300012469Avena Fatua RhizosphereMFPMAAAGWAFLVWLFGGGFGLALLVFIVLKMMGR*
Ga0150984_11641684213300012469Avena Fatua RhizosphereALPQRSRAMENLALMMPLAAAGWAFLVWLFGGGFGLALVVFIVLKLFGR*
Ga0150984_11748991223300012469Avena Fatua RhizosphereMLELATILPMAAAGWAFLVWLFGGGFGLAVVVFIVLKMLGR*
Ga0150984_11818832923300012469Avena Fatua RhizosphereMATEMLPLAAAGWAFLVWLFGGGFGLALVVFVVLKMLGR*
Ga0150984_11961852613300012469Avena Fatua RhizosphereMVPMLSEMMILGAAGWAFLVWLCGGGVGLAILVFIVLKVLGK*
Ga0150984_12280864413300012469Avena Fatua RhizosphereMMLELLPVAAAGWAFLVWLFGGGLGLALVVFVVLKLIGQ*
Ga0137373_1113759913300012532Vadose Zone SoilMVTTMLPAAAAGWAFLVWLFGGGFGLALVVFIVLKMLGR*
Ga0154020_1003397043300012956Active SludgeMMMAELIPLAAAGWAFLAWLLGGGLGLAILVFIVLKLLGK*
Ga0157374_1192678213300013296Miscanthus RhizosphereMLPVAEMLPLAAAGWAFLVWLFGGGLGMALVVFVVLKMLGR*
Ga0157372_1014469233300013307Corn RhizosphereMVETVAMIAPVAAAGWAFLTWILSGSFGLALVVFVFLKMLGR*
Ga0157375_1231249023300013308Miscanthus RhizosphereQQMLITDMLPLAAAGWAFLVWLFGGGFGLAVLVFIVLKMLGR*
Ga0182024_1009884423300014501PermafrostMMTLALILPVAAAGWAFLYWLFGGGLGGAFAIFIVLKLLGK*
Ga0137411_121837613300015052Vadose Zone SoilFMLELATVLPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR*
Ga0163144_10004866143300015360Freshwater Microbial MatMVPMIAEVLPLAAAGWAFLVWLVGGGFGLAIIVFILLKVLGK*
Ga0163144_1004666763300015360Freshwater Microbial MatMLIPLIPVAAAGYAFLVWLFGGGFALALVVFVALKVLGK*
Ga0163144_1040789023300015360Freshwater Microbial MatMIDLLANIYPMAAGGWALLVWLAGGGFGLAILVFIILKVMGK*
Ga0132258_1050531623300015371Arabidopsis RhizosphereMHELAIIFPLAAAGWAFLVWLFGGGFGLALVVFVALKVLGR*
Ga0132258_1245195223300015371Arabidopsis RhizosphereMVPVAEMLPLAAAGWAFLVWLCGGGFGLAVVVFIVLKLMGK*
Ga0132258_1323653523300015371Arabidopsis RhizosphereMVPVAEILPLAAAGWAFLVWLCGGGFGLAVVVFIVLKLMGK*
Ga0132258_1379822823300015371Arabidopsis RhizosphereMLPVAEMLPLAAAGWAFLVWLCGGGVGLALVVFIVLKALGK*
Ga0182738_103553223300017658CompostMPPLELMLPLAAAGWAFLVWLCGGGLGLAILVFIVLKVLGH
Ga0184624_1021801813300018073Groundwater SedimentVVPVAEMMPLAAAGWAFLVWLCGGGVGLAVVVFIVLKLLGK
Ga0190265_1340624723300018422SoilMLELAAILPMAAAGWAFLVWLLGGGLGLAIVVFIVLKMLGR
Ga0190275_1179933823300018432SoilMLPVAEMLPLAAAGWAFLVWLFGGGLGLALVVFIVLKLLGK
Ga0190274_1060770913300018476SoilMETLALTMPLAAGGWAFLVWLFGGGLGLALVVFVVLKLFGR
Ga0066669_1056748523300018482Grasslands SoilMLEIATIFPLAAAGWAFLVWLFGGGFGLALLVFIVLKVLGR
Ga0193595_100002063300018890SoilMVELAMLFPMAALGWAFLVWLFGGGLGLAVLVFIVMKVLGH
Ga0173479_1056884923300019362SoilHSDGLGVGPTKERKPMEPLMTAIPLAAAGWAFLVWLFGGGFGLAIAVFIVLKLLGK
Ga0193697_100790523300020005SoilMLPVAEMLPLAAAGWAFLVWLCGGGFGLAILVFIVLKMMGK
Ga0163155_1037794323300020180Freshwater Microbial MatIYPMAAGGWALLVWLAGGGFGLAILVFIILKVMGK
Ga0193719_1000655953300021344SoilMLELATVLPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGR
Ga0222622_1036280213300022756Groundwater SedimentVAEMLPLAAAGWAFLVWLCGGGFGLAILVFIVLKMMGK
Ga0222622_1125325923300022756Groundwater SedimentMLPVAEMLPLAAAGWAFLVWLCGGGVGLALLVFIVLKMIGK
Ga0247760_118758223300023272Plant LitterMIETLALTLPVAAAGWAFLVWLFGGGFGLALLVFIVLKVLGK
Ga0207682_1006263723300025893Miscanthus RhizosphereMEPLMTAIPLAAAGWAFLVWLFGGGFGLAIAVFIVLKLLGK
Ga0207680_1046568723300025903Switchgrass RhizosphereMLPVAEMLPLAAAGWAFLVWLCGGGVGLALVVFIVLKVLGK
Ga0207643_1033593413300025908Miscanthus RhizosphereMLELATVLPMAAAGWAFLVWLFGGGLGLAIVVFIVLKMLGH
Ga0207695_1143140713300025913Corn RhizosphereMVETVAMIAPVAAAGWAFLTWILSGSFGLAIVVFIFLKVLGR
Ga0207660_1052909423300025917Corn RhizosphereMLIPMLPAAAAGWAGLVWLLGGGLPLAIIVFIVLKMMGR
Ga0207650_1078280013300025925Switchgrass RhizosphereMETLALMMPLAAAGWAALVWLFGGGFGLALVVFIVLKLFGR
Ga0207664_1030441323300025929Agricultural SoilMIELATMLPLAAAGWAFLVWLFGGGFGLALVVFIVLKLLGD
Ga0207644_1182870513300025931Switchgrass RhizosphereMLELATLFPLAAAGWAFLVWLFGGGFGLAVLVFIVLKVLGR
Ga0207709_1068486823300025935Miscanthus RhizosphereMLIETALPMAAAGWAFLVWLFGGGLGMALVVFVVLKMLGR
Ga0207669_1105399023300025937Miscanthus RhizosphereMLEAAIMIPMAAAGWAFILTWLFGGGIGLFLLLFVVLKMLGK
Ga0207641_1081544613300026088Switchgrass RhizosphereMETLAMMVPMAAAGWAFLVWLCGGGFGLALLVFIVLKVLGR
Ga0207648_1193218713300026089Miscanthus RhizosphereMLIETALPMAAAGWAFLVWLFGGGLGMALVVFVVLKMLGA
Ga0209058_134524723300026536SoilVVLIADMLPLAALGWAFLVWLFGGGLGLAVVVFIVLKLMGK
Ga0209818_109632913300027637Agricultural SoilMLPVAEILPLAAAGWAFLVWLFGGGLGLALVVFIVLKLLGK
Ga0207428_1098221423300027907Populus RhizosphereLPVAEMLPLAAAGWAFLVWLCGGGFGLAILVFIVLKMMGK
Ga0209382_1020254423300027909Populus RhizosphereMIEIMTMLPLAAAGWAFLVWLFGGGLGLALIVFIVMKIVGH
Ga0268265_1067306213300028380Switchgrass RhizosphereVTLALGYPLAAAGWAFMVWLFGGGLGLALLVFVVLKIL
Ga0138301_136760123300031022SoilMSLAEILPLAAAGWAFLVWLSGGGLGLALLVFVVLEVLGR
Ga0308197_1040875423300031093SoilLEAAIMIPMAAAGWAFILTWLFGGGIGLFLLLFVVLKMLGK
Ga0308175_10000885823300031938SoilMTGLEIIPLAAAGWAFLTWLFTGSIGLALLVFIVLKLIGR
Ga0307409_10084431523300031995RhizosphereMELFAQSIPLAAAGWAFLVWLFGGGLGLAVAVFVVMKLLGK
Ga0307409_10270332423300031995RhizosphereMDLLAQSIPLAAAGWAFLVWLFGGGLGLAVAVFVVLKLLGK
Ga0307416_10008608833300032002RhizosphereMDLLAQSIPLAAAGWAFLVWLFGGGLGLAVAVFVVLKLMGK
Ga0315282_1003940063300032069SedimentMLAVLSTIILAAAGWAFLVWLCGGGVGLAILVFIVLKVLGH
Ga0308173_1038253423300032074SoilMLIPMLPAAAAGWAGLVWLLGGGLPLAIIVFVVLKMMGR
Ga0308173_1108341713300032074SoilTVEAPMVPMLAEMMIVGAAGWAFLVWLCGGGFGLAILVFIVLKVLGK
Ga0335397_1003925953300032420FreshwaterMLDILALTIPLAAAGYALLVWLFGGGLGLALVVFVLMKMLGK
Ga0372946_0287489_428_5533300034384SoilMFLVAEMLPLAAAGWAFLVWLFGGGLGLAALVFIVLKMLGK
Ga0372946_0509491_67_1743300034384SoilMIPLAAAGWAFLVWLFGGGLGLAVVVFIVLKLLGK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.