Basic Information | |
---|---|
Family ID | F044376 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 154 |
Average Sequence Length | 45 residues |
Representative Sequence | MDSIKLWARNGEAVRQAIELGELVHMETASEELTDEFLLFAI |
Number of Associated Samples | 124 |
Number of Associated Scaffolds | 154 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 95.45 % |
% of genes near scaffold ends (potentially truncated) | 87.66 % |
% of genes from short scaffolds (< 2000 bps) | 92.86 % |
Associated GOLD sequencing projects | 118 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.25 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (62.987 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.026 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.623 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.260 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.29% β-sheet: 0.00% Coil/Unstructured: 85.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 154 Family Scaffolds |
---|---|---|
PF01609 | DDE_Tnp_1 | 2.60 |
PF07592 | DDE_Tnp_ISAZ013 | 2.60 |
PF13359 | DDE_Tnp_4 | 1.30 |
PF13565 | HTH_32 | 1.30 |
PF02371 | Transposase_20 | 1.30 |
PF00589 | Phage_integrase | 1.30 |
PF00239 | Resolvase | 1.30 |
PF13613 | HTH_Tnp_4 | 1.30 |
PF13358 | DDE_3 | 1.30 |
PF00501 | AMP-binding | 0.65 |
PF01144 | CoA_trans | 0.65 |
PF00534 | Glycos_transf_1 | 0.65 |
PF01113 | DapB_N | 0.65 |
PF13592 | HTH_33 | 0.65 |
PF12680 | SnoaL_2 | 0.65 |
PF00856 | SET | 0.65 |
PF00903 | Glyoxalase | 0.65 |
PF00310 | GATase_2 | 0.65 |
PF00578 | AhpC-TSA | 0.65 |
PF01522 | Polysacc_deac_1 | 0.65 |
PF14246 | TetR_C_7 | 0.65 |
PF13586 | DDE_Tnp_1_2 | 0.65 |
PF04168 | Alpha-E | 0.65 |
PF00665 | rve | 0.65 |
PF04191 | PEMT | 0.65 |
PF00230 | MIP | 0.65 |
PF04986 | Y2_Tnp | 0.65 |
PF02954 | HTH_8 | 0.65 |
PF00211 | Guanylate_cyc | 0.65 |
PF03476 | MOSC_N | 0.65 |
PF14742 | GDE_N_bis | 0.65 |
PF00076 | RRM_1 | 0.65 |
PF01695 | IstB_IS21 | 0.65 |
PF13546 | DDE_5 | 0.65 |
PF01381 | HTH_3 | 0.65 |
PF12836 | HHH_3 | 0.65 |
PF03968 | LptD_N | 0.65 |
PF12762 | DDE_Tnp_IS1595 | 0.65 |
PF01610 | DDE_Tnp_ISL3 | 0.65 |
PF00462 | Glutaredoxin | 0.65 |
PF02810 | SEC-C | 0.65 |
PF12697 | Abhydrolase_6 | 0.65 |
PF07690 | MFS_1 | 0.65 |
PF01875 | Memo | 0.65 |
PF04185 | Phosphoesterase | 0.65 |
PF12759 | HTH_Tnp_IS1 | 0.65 |
PF13419 | HAD_2 | 0.65 |
PF13495 | Phage_int_SAM_4 | 0.65 |
PF00072 | Response_reg | 0.65 |
PF13267 | DUF4058 | 0.65 |
COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
---|---|---|---|
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.60 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.60 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.60 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.60 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.60 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.60 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.30 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.30 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.30 |
COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 0.65 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.65 |
COG2307 | Uncharacterized conserved protein, Alpha-E superfamily | Function unknown [S] | 0.65 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.65 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.65 |
COG3217 | N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domain | Defense mechanisms [V] | 0.65 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.65 |
COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 0.65 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.65 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
COG1355 | Predicted class III extradiol dioxygenase, MEMO1 family | General function prediction only [R] | 0.65 |
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.65 |
COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 0.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 62.99 % |
Unclassified | root | N/A | 37.01 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000597|AF_2010_repII_A1DRAFT_10174373 | Not Available | 510 | Open in IMG/M |
3300000955|JGI1027J12803_104995975 | Not Available | 688 | Open in IMG/M |
3300003995|Ga0055438_10236141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
3300004281|Ga0066397_10076355 | Not Available | 660 | Open in IMG/M |
3300005175|Ga0066673_10842274 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300005184|Ga0066671_10904595 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300005332|Ga0066388_106041830 | Not Available | 611 | Open in IMG/M |
3300005451|Ga0066681_10382036 | Not Available | 866 | Open in IMG/M |
3300005555|Ga0066692_10889636 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300005556|Ga0066707_10303703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
3300005559|Ga0066700_10441138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
3300005576|Ga0066708_10792096 | Not Available | 595 | Open in IMG/M |
3300005586|Ga0066691_10065031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1987 | Open in IMG/M |
3300005719|Ga0068861_101446058 | Not Available | 673 | Open in IMG/M |
3300005764|Ga0066903_103361893 | Not Available | 864 | Open in IMG/M |
3300005764|Ga0066903_106211750 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300005764|Ga0066903_106395338 | Not Available | 614 | Open in IMG/M |
3300005764|Ga0066903_106876925 | Not Available | 591 | Open in IMG/M |
3300006800|Ga0066660_10355073 | Not Available | 1192 | Open in IMG/M |
3300006846|Ga0075430_100407262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
3300006846|Ga0075430_101585838 | Not Available | 538 | Open in IMG/M |
3300006853|Ga0075420_100607735 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 944 | Open in IMG/M |
3300006865|Ga0073934_10493314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
3300006969|Ga0075419_10033080 | All Organisms → cellular organisms → Bacteria | 3212 | Open in IMG/M |
3300006969|Ga0075419_10551086 | Not Available | 806 | Open in IMG/M |
3300009012|Ga0066710_100903563 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1359 | Open in IMG/M |
3300009038|Ga0099829_10304981 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1306 | Open in IMG/M |
3300009038|Ga0099829_10740610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
3300009038|Ga0099829_11673430 | Not Available | 524 | Open in IMG/M |
3300009088|Ga0099830_11882202 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 500 | Open in IMG/M |
3300009090|Ga0099827_10535859 | Not Available | 1007 | Open in IMG/M |
3300009137|Ga0066709_103747102 | Not Available | 552 | Open in IMG/M |
3300009147|Ga0114129_10613475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1408 | Open in IMG/M |
3300009147|Ga0114129_13032893 | Not Available | 551 | Open in IMG/M |
3300009162|Ga0075423_11154519 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300009168|Ga0105104_10120026 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
3300009792|Ga0126374_10785115 | Not Available | 726 | Open in IMG/M |
3300009801|Ga0105056_1033076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
3300009809|Ga0105089_1051932 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 638 | Open in IMG/M |
3300009811|Ga0105084_1097929 | Not Available | 552 | Open in IMG/M |
3300009813|Ga0105057_1072981 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 598 | Open in IMG/M |
3300009821|Ga0105064_1109811 | Not Available | 570 | Open in IMG/M |
3300009837|Ga0105058_1032234 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1136 | Open in IMG/M |
3300010046|Ga0126384_10929495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
3300010046|Ga0126384_12420426 | Not Available | 509 | Open in IMG/M |
3300010047|Ga0126382_10144067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae | 1621 | Open in IMG/M |
3300010047|Ga0126382_10479610 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 994 | Open in IMG/M |
3300010047|Ga0126382_10686336 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300010047|Ga0126382_11782347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 578 | Open in IMG/M |
3300010303|Ga0134082_10022916 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2317 | Open in IMG/M |
3300010304|Ga0134088_10032600 | Not Available | 2354 | Open in IMG/M |
3300010333|Ga0134080_10339394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
3300010359|Ga0126376_10118387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2061 | Open in IMG/M |
3300010359|Ga0126376_10208427 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
3300010359|Ga0126376_11422957 | Not Available | 719 | Open in IMG/M |
3300010359|Ga0126376_12986178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
3300010360|Ga0126372_12420709 | Not Available | 576 | Open in IMG/M |
3300010362|Ga0126377_12579469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300010362|Ga0126377_13031831 | Not Available | 542 | Open in IMG/M |
3300010366|Ga0126379_11608285 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300010366|Ga0126379_13072090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 559 | Open in IMG/M |
3300010366|Ga0126379_13324886 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300011270|Ga0137391_10825026 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium SCN 62-11 | 763 | Open in IMG/M |
3300011271|Ga0137393_11681476 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300012188|Ga0136618_10453555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
3300012203|Ga0137399_10238134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1489 | Open in IMG/M |
3300012205|Ga0137362_11243009 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 629 | Open in IMG/M |
3300012207|Ga0137381_10962853 | Not Available | 737 | Open in IMG/M |
3300012209|Ga0137379_11602999 | Not Available | 550 | Open in IMG/M |
3300012212|Ga0150985_115111463 | Not Available | 865 | Open in IMG/M |
3300012349|Ga0137387_10803624 | Not Available | 680 | Open in IMG/M |
3300012349|Ga0137387_11321218 | Not Available | 503 | Open in IMG/M |
3300012356|Ga0137371_10352220 | Not Available | 1144 | Open in IMG/M |
3300012359|Ga0137385_11642511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus | 507 | Open in IMG/M |
3300012361|Ga0137360_10196143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → environmental samples → uncultured Chloroflexia bacterium | 1632 | Open in IMG/M |
3300012361|Ga0137360_10295304 | Not Available | 1344 | Open in IMG/M |
3300012361|Ga0137360_11896504 | Not Available | 502 | Open in IMG/M |
3300012362|Ga0137361_10063618 | All Organisms → cellular organisms → Bacteria | 3096 | Open in IMG/M |
3300012362|Ga0137361_10400139 | Not Available | 1261 | Open in IMG/M |
3300012362|Ga0137361_11308836 | Not Available | 649 | Open in IMG/M |
3300012363|Ga0137390_10327428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1513 | Open in IMG/M |
3300012378|Ga0134025_1246812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 650 | Open in IMG/M |
3300012477|Ga0157336_1014487 | Not Available | 649 | Open in IMG/M |
3300012500|Ga0157314_1054618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300012510|Ga0157316_1026643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 672 | Open in IMG/M |
3300012679|Ga0136616_10546178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300012680|Ga0136612_10350251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
3300012684|Ga0136614_10691119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
3300012685|Ga0137397_10374537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
3300012922|Ga0137394_11383802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 565 | Open in IMG/M |
3300012948|Ga0126375_11112778 | Not Available | 651 | Open in IMG/M |
3300012971|Ga0126369_10814326 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1017 | Open in IMG/M |
3300014154|Ga0134075_10051181 | All Organisms → cellular organisms → Bacteria | 1706 | Open in IMG/M |
3300015053|Ga0137405_1430673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2450 | Open in IMG/M |
3300015054|Ga0137420_1340125 | Not Available | 2042 | Open in IMG/M |
3300016341|Ga0182035_10656898 | Not Available | 910 | Open in IMG/M |
3300016357|Ga0182032_10555662 | Not Available | 950 | Open in IMG/M |
3300016357|Ga0182032_11837996 | Not Available | 530 | Open in IMG/M |
3300016422|Ga0182039_12017339 | Not Available | 531 | Open in IMG/M |
3300016445|Ga0182038_10861932 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 797 | Open in IMG/M |
3300017789|Ga0136617_10133763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2126 | Open in IMG/M |
3300017997|Ga0184610_1164643 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 732 | Open in IMG/M |
3300018028|Ga0184608_10290330 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300018066|Ga0184617_1183491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
3300018077|Ga0184633_10262792 | Not Available | 885 | Open in IMG/M |
3300018078|Ga0184612_10056810 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium F11 | 2039 | Open in IMG/M |
3300018468|Ga0066662_10378400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1233 | Open in IMG/M |
3300018481|Ga0190271_12896881 | Not Available | 576 | Open in IMG/M |
3300019249|Ga0184648_1224132 | Not Available | 639 | Open in IMG/M |
3300019789|Ga0137408_1045137 | Not Available | 1407 | Open in IMG/M |
3300019878|Ga0193715_1013609 | All Organisms → cellular organisms → Bacteria | 1752 | Open in IMG/M |
3300020084|Ga0194110_10516755 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 776 | Open in IMG/M |
3300021073|Ga0210378_10198088 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300021086|Ga0179596_10331078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
3300025149|Ga0209827_10807066 | Not Available | 1156 | Open in IMG/M |
3300025157|Ga0209399_10043333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1865 | Open in IMG/M |
3300025792|Ga0210143_1024586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1050 | Open in IMG/M |
3300026297|Ga0209237_1062936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1786 | Open in IMG/M |
3300026312|Ga0209153_1208244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Thiothrix → Thiothrix nivea | 675 | Open in IMG/M |
3300026333|Ga0209158_1257182 | Not Available | 598 | Open in IMG/M |
3300026360|Ga0257173_1065669 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300026552|Ga0209577_10333049 | Not Available | 1123 | Open in IMG/M |
3300027577|Ga0209874_1018714 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1985 | Open in IMG/M |
3300027655|Ga0209388_1016092 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
3300027655|Ga0209388_1037637 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1392 | Open in IMG/M |
3300027862|Ga0209701_10355577 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300027862|Ga0209701_10637845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300027882|Ga0209590_10466485 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300027882|Ga0209590_10517168 | Not Available | 770 | Open in IMG/M |
3300027882|Ga0209590_10585556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
3300027882|Ga0209590_10764676 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300027882|Ga0209590_10934439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 544 | Open in IMG/M |
3300027909|Ga0209382_10298451 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
3300030006|Ga0299907_10257843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1431 | Open in IMG/M |
3300030606|Ga0299906_11015883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 606 | Open in IMG/M |
3300030903|Ga0308206_1184999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300031092|Ga0308204_10278420 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300031093|Ga0308197_10313016 | Not Available | 583 | Open in IMG/M |
3300031098|Ga0308191_1012124 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300031545|Ga0318541_10311842 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 877 | Open in IMG/M |
3300031573|Ga0310915_10756359 | Not Available | 685 | Open in IMG/M |
3300031681|Ga0318572_10669381 | Not Available | 618 | Open in IMG/M |
3300031724|Ga0318500_10069214 | Not Available | 1546 | Open in IMG/M |
3300031751|Ga0318494_10241532 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
3300031796|Ga0318576_10630319 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300031890|Ga0306925_11213356 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300031946|Ga0310910_10232905 | Not Available | 1436 | Open in IMG/M |
3300031995|Ga0307409_100646545 | Not Available | 1051 | Open in IMG/M |
3300032004|Ga0307414_11402492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
3300032035|Ga0310911_10009722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4343 | Open in IMG/M |
3300032180|Ga0307471_102459223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 659 | Open in IMG/M |
3300033004|Ga0335084_11887776 | Not Available | 584 | Open in IMG/M |
3300033289|Ga0310914_10822927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
3300034676|Ga0314801_144251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.03% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.34% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.49% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.19% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.90% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.90% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 3.25% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.25% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.25% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.60% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.95% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.30% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.30% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.30% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.30% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.65% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.65% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.65% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.65% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.65% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.65% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012188 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06) | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012378 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
3300012679 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06) | Environmental | Open in IMG/M |
3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300025149 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 (SPAdes) | Environmental | Open in IMG/M |
3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031098 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_186 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A1DRAFT_101743732 | 3300000597 | Forest Soil | MDAIKLWARNGDAVRQAIELGKLVHLDTASEELTDEFLLFAIESGLLQSW |
JGI1027J12803_1049959751 | 3300000955 | Soil | MDSLRLWARDGEAVRQAIELGESAHMETASEECTD |
Ga0055438_102361411 | 3300003995 | Natural And Restored Wetlands | MDTIKLWAHNGDAVRQAIALGELVHLETACEELADEFLLFAIESGLLVRGPLSSKEAVPL |
Ga0066397_100763552 | 3300004281 | Tropical Forest Soil | MDSSKLWARNGEAVRQAIELGELAHLETASEELTDEFLLFA |
Ga0066673_108422741 | 3300005175 | Soil | MESIKLWARNGEAVRQAIELGEIAHLETASEELTDEFLLF |
Ga0066671_109045951 | 3300005184 | Soil | MDSIKLWARNGTAVRQAIELGEIAHLETASEELTDEFLLFAIESGLLKSWAGSFPD |
Ga0066388_1060418301 | 3300005332 | Tropical Forest Soil | MDSIQLWARDGEAVRQAIELGEIAHIETASEELTDEFLLFAI |
Ga0066681_103820362 | 3300005451 | Soil | MDTIKLWARNGEAVRQAIELGELVHLDTASEELTDEFLLFAIQSG |
Ga0066692_108896361 | 3300005555 | Soil | METIKLWGRNGDAVRQALELGDLVHLDTASEELTDAFLLV |
Ga0066707_103037032 | 3300005556 | Soil | MDSIKLWARDGEAVHQAIELGEIAHMETASEELTDEFLLFAIESGLLKT |
Ga0066700_104411381 | 3300005559 | Soil | AMDSIKLWARDGEAVRQAIELGETAHMETASEELTDAFRLFAIESGL* |
Ga0066708_107920961 | 3300005576 | Soil | METIKLWARNGDAVRQAIEFGELVHLDTASEELTDEFLLFAIQSG |
Ga0066691_100650314 | 3300005586 | Soil | MDSIKLWARDGEAVRQAIELGETAHMETASEELTDAFRLFAIESGL* |
Ga0068861_1014460581 | 3300005719 | Switchgrass Rhizosphere | MDSLRLWARDGEAVRQALELGEIAHIATASEELTDEFLLF |
Ga0066903_1033618933 | 3300005764 | Tropical Forest Soil | MDSIKLWARNGEAVRQAIELGEIAHIETASEELTDEFLLFA |
Ga0066903_1062117501 | 3300005764 | Tropical Forest Soil | MESIKLWARDGEAVRQAIELGAIAHIETASEELTDDFLLFAIES |
Ga0066903_1063953381 | 3300005764 | Tropical Forest Soil | MDAIKLWARNGDAVRQAIELGELVHLDTASEELTDEF |
Ga0066903_1068769251 | 3300005764 | Tropical Forest Soil | MDSLRLWARDREAVRQAIELGEIAHVETASEELTDAFLLF |
Ga0066660_103550731 | 3300006800 | Soil | MDSIKLWARDGEAVRQAIELGEIAHMETASEELTDAFRLFAIESGL* |
Ga0075430_1004072624 | 3300006846 | Populus Rhizosphere | MDSIKLWARDGEAVHQAIELGEIAHMETASEELTDAFLLFAIESGLLQTWAEAFPDP |
Ga0075430_1015858382 | 3300006846 | Populus Rhizosphere | MESIKLWARNGEAVRQAIELGEIAHIETASEELTDEFLLFAI |
Ga0075420_1006077351 | 3300006853 | Populus Rhizosphere | METIKLWARNGDAVRQAIELGELVHLDTASEELTDEFLLFAIQSGL |
Ga0073934_104933141 | 3300006865 | Hot Spring Sediment | METIKLWARNGEAVRQAIELGEIVQLETASEEITDEFLLFAINSG |
Ga0075419_100330801 | 3300006969 | Populus Rhizosphere | MDSIKLWARNGTAVRQAIELGEIAHIETASEELTDEFLLFAIESGL |
Ga0075419_105510862 | 3300006969 | Populus Rhizosphere | MDSIQLWARNGEAVRRAIELGEIAHMETASEELTDEFLLFAIG* |
Ga0066710_1009035632 | 3300009012 | Grasslands Soil | METIKLWARNGDAVRQAIELGDLVHLDTASEELTDEFLLF |
Ga0099829_103049811 | 3300009038 | Vadose Zone Soil | MDTIKLWARNGDAVRQAIELGELVHLDTASEELTDEFLLFAID |
Ga0099829_107406101 | 3300009038 | Vadose Zone Soil | LWARNGEVVRQAIELGEIAHIETASEELTDEFLLFAIESGLLQSWAG |
Ga0099829_116734301 | 3300009038 | Vadose Zone Soil | METIKLWARNGDAVRQAIELGELVHLDTASEELTDEFLLFAID |
Ga0099830_118822021 | 3300009088 | Vadose Zone Soil | MESIKLWARHGEAVRQAIELGELAHMETASEELTDEFGV* |
Ga0099827_105358591 | 3300009090 | Vadose Zone Soil | MDSLRLWARDGEAVRQAIELGEIAHIETASKELTDEFLLFAIE |
Ga0066709_1037471021 | 3300009137 | Grasslands Soil | METIKLWARNGDAVRQAIEFGELVHLDTASEELTDE |
Ga0114129_106134753 | 3300009147 | Populus Rhizosphere | MDSIKLWARNGEAVRQAIELGELVHMETASEELTDEFLLFAIE |
Ga0114129_130328932 | 3300009147 | Populus Rhizosphere | MESIKLWARNGEAVRQAIELGELVHMETASEELTDEFLLFAIE |
Ga0075423_111545191 | 3300009162 | Populus Rhizosphere | MDSIKLWARNGAAVRQAIELGELVHMETASEELTDEFLLFAIESGL |
Ga0105104_101200261 | 3300009168 | Freshwater Sediment | MDTLKLWARDGDAVRQAIELGELVHLETASEELTDEF |
Ga0126374_107851152 | 3300009792 | Tropical Forest Soil | MDSIKLWARNGEVVRQAIELGEIAHLETASEELTEAFLLFGIESGLLKS |
Ga0105056_10330761 | 3300009801 | Groundwater Sand | MDSIKLWARNGEAVRQAIELGEIAHIETASEELTDEFLVFAIESGLLKSWAG |
Ga0105089_10519321 | 3300009809 | Groundwater Sand | MESIKLWARNGEAVRQAIELGEIAHIETASEELTDEFLLFAIESGLLRSWAG |
Ga0105084_10979291 | 3300009811 | Groundwater Sand | MDSIKLWARDGEAVRQAIELGEIAHIETASEELTDAFLLF |
Ga0105057_10729811 | 3300009813 | Groundwater Sand | MAPIKLWARNGDAVRQASELGELVHLDTANEELTDAF |
Ga0105064_11098111 | 3300009821 | Groundwater Sand | METIKLWARNGDTVRQAIACGDLVHLDTASEALTDAFLLFAIQSGLLSKWAEVF |
Ga0105058_10322341 | 3300009837 | Groundwater Sand | METIKLWARNGDAVRQAIELGDLVHLDTASEELTDEF* |
Ga0126384_109294951 | 3300010046 | Tropical Forest Soil | MDSLKLWARNGEAVRQAIELGEIAHIETASEELTDEFLLFAIESGLLKSWAG |
Ga0126384_124204261 | 3300010046 | Tropical Forest Soil | MESIKWWARHGAAVRQAIELGEMAPIETASEELTDEF |
Ga0126382_101440672 | 3300010047 | Tropical Forest Soil | MESIKLWARNGEAVRQAIELGEITHIETASEELTDEFLLCA |
Ga0126382_104796101 | 3300010047 | Tropical Forest Soil | MQLWARDGEAVRQAIELGEIAHIETASEELTDEFLLFAIESG |
Ga0126382_106863362 | 3300010047 | Tropical Forest Soil | MEGIKLWARNGEVVRQALELGELVHIDTASEELTDEFLLFAF |
Ga0126382_117823472 | 3300010047 | Tropical Forest Soil | MESIKLWARDGEAVRQAIELGEIAHIETASEELTDEFLLFAIESGLLQTWANAFPDPR |
Ga0134082_100229161 | 3300010303 | Grasslands Soil | MESIKLWARNGEAVRQAIELGELVHMETASEELTDAFLLFAIESG |
Ga0134088_100326002 | 3300010304 | Grasslands Soil | MESIKLWARHSEAVRQAIELGELVHIETASEELTDEFLG* |
Ga0134080_103393941 | 3300010333 | Grasslands Soil | MDSIKLWARDGEAVHQAIELGEIAHMETASEELTDAFLLFAIESGL* |
Ga0126376_101183871 | 3300010359 | Tropical Forest Soil | MDSIKLWARDGEAVRQAIELGEIAHMETASEELTDEFLLF |
Ga0126376_102084271 | 3300010359 | Tropical Forest Soil | MESLKWWARNGAAVRQAIELGEIAHLETASEELTDEFLLLAIDSGLLKSWAGSFPDPR |
Ga0126376_114229571 | 3300010359 | Tropical Forest Soil | MESIKLWARDGEAVHQAIALGEIAHLETASEELTDAFLLCAIASGL* |
Ga0126376_129861781 | 3300010359 | Tropical Forest Soil | MDSLKLWARNGEAVRQAIELGEIAHIETASEELTDAFLLFAIDSGLLKRWAESFPDPRD |
Ga0126372_124207091 | 3300010360 | Tropical Forest Soil | MDSIKLWARNGEAVRQAIELGEIAHLETASEEFTDEFLLEFI |
Ga0126377_125794692 | 3300010362 | Tropical Forest Soil | MDAIKLWARNGDAVRQSIELGELVHLDTASEELTDEFLLFAIESGLLSK* |
Ga0126377_130318311 | 3300010362 | Tropical Forest Soil | MDSIQLWARDGEAVRQAIELGEIAHIETASEELTDEFLLFAIESG |
Ga0126379_116082852 | 3300010366 | Tropical Forest Soil | MDSLKLWARDGEAVRQAIELGEIAHIETASEELTDEFLLFAIDS |
Ga0126379_130720902 | 3300010366 | Tropical Forest Soil | MDSIQLWARDGEAVRQAIELGEIAHMETASEELTDEFLLFAIESGLLKTWAEAFPDP |
Ga0126379_133248862 | 3300010366 | Tropical Forest Soil | MDSIKLWARNGEAVRQAIELGELVHMETASEELTDEFLLFAIESGLLK |
Ga0137391_108250261 | 3300011270 | Vadose Zone Soil | MDSIKLWARNGEAVRQAIELGELVHMETASEELTDEFLL |
Ga0137393_116814761 | 3300011271 | Vadose Zone Soil | MDSLKLWARNGEAVRQAIELGEIAHIETASEELTDEFLLFAIESG |
Ga0136618_104535552 | 3300012188 | Polar Desert Sand | MESIKLLARNGQAVRHALELGEILHLETASEELTDEFLIFVIK |
Ga0137399_102381341 | 3300012203 | Vadose Zone Soil | RRWAMESIKLWARNGEAVRQAIELGALVHMETASEE* |
Ga0137362_112430092 | 3300012205 | Vadose Zone Soil | MESIKLWARNGEAVRQAIELGEIAHIETASEELTDEFLLFAIESGLLKTW |
Ga0137381_109628532 | 3300012207 | Vadose Zone Soil | METIKLWARNGDAVRQAIELGDLVHLDTASEELTDEFLLFAIQSGLLS |
Ga0137379_116029992 | 3300012209 | Vadose Zone Soil | MDSIKLWARNGEAVRQAIELGELVHMETASEELTDEFLLFAVVVK* |
Ga0150985_1151114632 | 3300012212 | Avena Fatua Rhizosphere | MESIKLWARHGEAVRQALELGELVHMETASEELTDEFL |
Ga0137387_108036241 | 3300012349 | Vadose Zone Soil | MDTIKLWARNGDAVRQALELGELVHLETASEELTDEFLLFAIQSGL |
Ga0137387_113212181 | 3300012349 | Vadose Zone Soil | MDSIKLWARNGEAVRQAIELGEIAHIETASEEAAPG* |
Ga0137371_103522201 | 3300012356 | Vadose Zone Soil | MDSINLGARKCDAVRQAIELGEIEHLQTASEELTDEFILFAIDLLYPSLLTPV |
Ga0137385_116425111 | 3300012359 | Vadose Zone Soil | MDRLKLWARNGEAVRQAIELGELVHIETASEELTDEFLLFA |
Ga0137360_101961431 | 3300012361 | Vadose Zone Soil | MDSIKLWARNGEAVRQAIELGELVHLETASEELTDEFLLFAIESGLSKK |
Ga0137360_102953041 | 3300012361 | Vadose Zone Soil | LWARKGEAVRQAIELGEIAHIETASEELTDEFLLF |
Ga0137360_118965041 | 3300012361 | Vadose Zone Soil | METLKLWARNGDAVRQAIEFGELVYLETAGEELTDEFLLFAIHS |
Ga0137361_100636183 | 3300012362 | Vadose Zone Soil | METLKLWARNGDAVRQAIEFGELVYLETAGEELTDEFLLFAIHSGLLSK* |
Ga0137361_104001391 | 3300012362 | Vadose Zone Soil | MESIELWARNGEAVRQAIELGELVHMETASEELTDEFLL |
Ga0137361_113088362 | 3300012362 | Vadose Zone Soil | MDSIKLWARNGEAVRQAIELGEMAHIETASEELTDEFLLFAIES |
Ga0137390_103274281 | 3300012363 | Vadose Zone Soil | METIKLWARNGDAVRQAIELGELVHLDTASEELTDE |
Ga0134025_12468122 | 3300012378 | Grasslands Soil | MESITLWARNGEAVRQAIELGAIPHIETASEEFTDEFLLFAIDSGL |
Ga0157336_10144871 | 3300012477 | Arabidopsis Rhizosphere | MDRIKLWARDGEAVREAIELGEVAHIETASEEWTDEFLLF |
Ga0157314_10546181 | 3300012500 | Arabidopsis Rhizosphere | MDSMQLWARDGEAVRQAIELGEIAHIETASEELTDEFLLFAIESGLLKTWANAFPDPRREPEI |
Ga0157316_10266432 | 3300012510 | Arabidopsis Rhizosphere | MDSMQLWARDGEAVRQAIELGEIAHIETASEELTDEFLLFAIESGLLKTWANAFPDPRREPEIG |
Ga0136616_105461781 | 3300012679 | Polar Desert Sand | MESLKLLARNGEAVRHALELGEILHMETASEELTDEFLIFAIKSGLLKSWAEGFPD |
Ga0136612_103502511 | 3300012680 | Polar Desert Sand | MESIKLLARNGEAVRQALELGEILHMETASEELTD |
Ga0136614_106911191 | 3300012684 | Polar Desert Sand | MESIKLLARNGEAVRQALELGEILHLETASEELTDEF |
Ga0137397_103745371 | 3300012685 | Vadose Zone Soil | MDTIELIARNGEAVRHAIALGDIVHIDTSGEERTDACLLFAINSGLLQGWAAGFPD |
Ga0137394_113838022 | 3300012922 | Vadose Zone Soil | METIKLWARNGDAVRQAIELGELSHLDTASEELTDEFLLFAI |
Ga0126375_111127782 | 3300012948 | Tropical Forest Soil | MDSIQLWARDGEAVRQAIELGEIAHIETASEELTDEF |
Ga0126369_108143261 | 3300012971 | Tropical Forest Soil | MDSIKLWARNGEVVRQAIELGEIAHLETASEELTD |
Ga0134075_100511811 | 3300014154 | Grasslands Soil | MDSIKLWARNGEAVRQAIELGELVHMETASEELTDEFLLFAI |
Ga0137405_14306735 | 3300015053 | Vadose Zone Soil | EAVRQAIELGAIAHIETASEELTDEFLLFAIESGLLKTWAEAFPDPVVSPRLAWR* |
Ga0137420_13401251 | 3300015054 | Vadose Zone Soil | MDSIKLWARNGEAVGQAIELGEIAHIETASEELTDEFLVFAIES |
Ga0182035_106568981 | 3300016341 | Soil | MDAIKLWARNGDAVRQAIELGKLVHLDTASEELTDEFLLFAIESG |
Ga0182032_105556621 | 3300016357 | Soil | MDAIKLWARNGDAVRQAIELGELVHLDTASEELTDEFLLFAI |
Ga0182032_118379961 | 3300016357 | Soil | MDSLRLWARDGEAVRQAIELGEIAHIETASEELTDEFLLF |
Ga0182039_120173391 | 3300016422 | Soil | MDSIQLWARNGTAVRQAIELGEIAHIETASEELTDELLLFAIDSGLLQSWAG |
Ga0182038_108619322 | 3300016445 | Soil | MDAIKLWARHGDAVRQAIELGELVHLDTASEELTDEFLLFAIESGLLQ |
Ga0136617_101337633 | 3300017789 | Polar Desert Sand | MESIKLLARNGEAVRQALELGEILHLETASEELTDEFLLFAIRSGLLEQWAEEFSRPSPM |
Ga0184610_11646431 | 3300017997 | Groundwater Sediment | MESRKLWARNGEAVRQAIELGEIVHIETASEEFTDAFLLCAIESGLLTTWAET |
Ga0184608_102903301 | 3300018028 | Groundwater Sediment | MDRLSLWARDGEAVRQAIELGEIAHMETASEEFTDEFLLVLWY |
Ga0184617_11834912 | 3300018066 | Groundwater Sediment | MESIKLWARHGEAVRQAIELGELVHMETAGEEVPDEFLLFAIESGLLTTWAKAFPDP |
Ga0184633_102627921 | 3300018077 | Groundwater Sediment | MDTIKLWARNGDAVRQALELGELVHLETASEELTDEFLLFAIQS |
Ga0184612_100568101 | 3300018078 | Groundwater Sediment | MDTIKLIARNGDAVRDAIELGDIVHMATASEELTD |
Ga0066662_103784001 | 3300018468 | Grasslands Soil | METIKLWARNGDAVRQAIELGDLVHLDTASEELTDEFLLFAIQSG |
Ga0190271_128968811 | 3300018481 | Soil | MESIRLWARNGAAVRQAIELGEIAHIETASEELTDEFLLFAIESGLLQS |
Ga0184648_12241322 | 3300019249 | Groundwater Sediment | MDTIKLIARNGDAVRDAIELGDIVHMATASEELTDEFLLFAIKSGVL |
Ga0137408_10451371 | 3300019789 | Vadose Zone Soil | MDSIKLWARNGEAVRQAIELGELVHMETASEELTDEFLLF |
Ga0193715_10136091 | 3300019878 | Soil | MDSIKLWARNGEAVRQAIELGEIAHIETASEELTDEFLVFAIESGLLQSWAGSF |
Ga0194110_105167551 | 3300020084 | Freshwater Lake | MDIIKLWARNGEAVRQAIELGELVHLETASEELTDAFLLFALQSGLLS |
Ga0210378_101980883 | 3300021073 | Groundwater Sediment | MDSIKLWARNGEAVRQAIELGEIAHIETASEELTDEF |
Ga0179596_103310781 | 3300021086 | Vadose Zone Soil | MDSIKLWARDGEAVHQAIELGEIAHMETASEELTDEFLLFAIESGLLKTWAEAFPD |
Ga0209827_108070662 | 3300025149 | Thermal Springs | MDTIKLWARNEDAVREAIELGALVHLETASEELTDEFLLFAIQSG |
Ga0209399_100433331 | 3300025157 | Thermal Springs | MDAITLWARNGEAVRQAIEWGEVVHLDTASEEITDEFLLFAIHRG |
Ga0210143_10245863 | 3300025792 | Natural And Restored Wetlands | MDTIELVARNGGAVRQAIELGEIVHMDTASEELTDEFLLFAINSGLLKE |
Ga0209237_10629361 | 3300026297 | Grasslands Soil | MDTIKLWARHGDAVRQAIELGELVHLDTASEALTDELLLFAIASGLLQRWA |
Ga0209153_12082442 | 3300026312 | Soil | MDSIQLWARDGEAVRQAIELGEIAHIETASEELTDEFLLF |
Ga0209158_12571822 | 3300026333 | Soil | MDSIKLWARDGEAVRQAIELGETAHMETASEELTDAFRLFAIESGL |
Ga0257173_10656692 | 3300026360 | Soil | RRCTMETIKLWARNGDAVRQAIELGDLVHLDTASEELTDEF |
Ga0209577_103330491 | 3300026552 | Soil | MDSIKLWARDGEAVRQAIELGEIAHMETASEELTDAFRLFAIESGL |
Ga0209874_10187142 | 3300027577 | Groundwater Sand | METIKLWARNGDAVRQAIELGDLVHLDTASEELTDEF |
Ga0209388_10160921 | 3300027655 | Vadose Zone Soil | METLKLWARNGDAVRQAIEFGELVYLETAGEELTDEFLLFAIHSGLL |
Ga0209388_10376371 | 3300027655 | Vadose Zone Soil | MESIKLWARHGEAVRQAIELGELVHMETASEELTDEFLL |
Ga0209701_103555771 | 3300027862 | Vadose Zone Soil | MDTIKLWARNGDAVRQAIELGELVHLETASEELTDEFLLFAIESGLLQ |
Ga0209701_106378452 | 3300027862 | Vadose Zone Soil | MVQAMDSLSLWARDGEAVRQAIELGEIAHIETASEELTDEFLLFAIESGLLQSWAGSFPDPR |
Ga0209590_104664853 | 3300027882 | Vadose Zone Soil | MESIKLWARNGEAVRQAIELGEIAHIETASEELTDEFLLFAIESGLLKRWAGAFPD |
Ga0209590_105171681 | 3300027882 | Vadose Zone Soil | METIKLWARNGEAVRQALELGEFVHLGTASEELIDEFLVF |
Ga0209590_105855561 | 3300027882 | Vadose Zone Soil | YPWGIGRRCMMDTIKLWARNGDAVRQAIELGELVHLETASEE |
Ga0209590_107646762 | 3300027882 | Vadose Zone Soil | MDTIKLWARNGDTVRQAIELGELVHLDTASEELTDEFL |
Ga0209590_109344391 | 3300027882 | Vadose Zone Soil | METLKLWARNGDAVRQAIECGELVSLETASEELTDECLLFALHSGLLSKWAEACPD |
Ga0209382_102984511 | 3300027909 | Populus Rhizosphere | MESIKLWARNGEAVRQAIELGEIAHIETASEELTDEFLLFAIESGLLKRWAGSFPD |
Ga0299907_102578432 | 3300030006 | Soil | MDTIDLVARNGDAVRQAIDLGDIVPIDTASEELTDAFLLFAIHSGL |
Ga0299906_110158831 | 3300030606 | Soil | MDTIELVARNGDAVRQAIELGDIVHMDTASEELTDEFLLFAI |
Ga0308206_11849991 | 3300030903 | Soil | MDTIKLWARNGDAVRQAIELGELVHLETASEELTDEFLLFAIQSGLLSKWAKAF |
Ga0308204_102784202 | 3300031092 | Soil | MESIKLWARHGEAVRQAIELGELVHMETASEELTDEFLLFAIDSGLLKTWA |
Ga0308197_103130163 | 3300031093 | Soil | MDTIELIARNGEAVRHAIELGDIVHMDTASEEITDELLLFAINSGLL |
Ga0308191_10121242 | 3300031098 | Soil | MESIKLWARHGEAVRQAIELGELVHMETASVPLIFD |
Ga0318541_103118422 | 3300031545 | Soil | MDTIQLWARNGDAVRQAIELGARVHLDTASAELTD |
Ga0310915_107563592 | 3300031573 | Soil | MDSIKLWARNGEAVRQAIELGELVHMETASEELTDEF |
Ga0318572_106693811 | 3300031681 | Soil | MDSIQLWARNGPAVRQAIELGEIAHIETASEELTDELLLFAIDSGLLQ |
Ga0318500_100692142 | 3300031724 | Soil | MDSIKLWARDGEAVHQAIELGEIAHMETAREELTDAFLLFAIES |
Ga0318494_102415321 | 3300031751 | Soil | MDSIQLWARNGPAVRQAIELGEIAHIETASEELTDEFLLFAIDSGLLQSWAGS |
Ga0318576_106303191 | 3300031796 | Soil | METIQLWARHGDAVRQAIELGELVHLDTAREELTDEFLLFAIQSGLLS |
Ga0306925_112133562 | 3300031890 | Soil | MESITLWARNGEAVRQAIELGEIAHIETASEELTDEFLLFAI |
Ga0310910_102329051 | 3300031946 | Soil | MESMQLWARDGEAVRQAIELGAIAHIETASEELTDEFLLFAIESGLLQTWAKAFP |
Ga0307409_1006465452 | 3300031995 | Rhizosphere | METIKLWARNGDAVCQAIELGELVHLDTASDELTDEF |
Ga0307414_114024922 | 3300032004 | Rhizosphere | MESIKLWARHGEAVRQAIELGELVHMETASEELTDEFLLFAIDSGLLKTWAEAFP |
Ga0310911_100097225 | 3300032035 | Soil | MDSMQLWARDGEAVRQAIELGEIAHIETASEELTDEF |
Ga0307471_1024592231 | 3300032180 | Hardwood Forest Soil | MESIKLWARHGEAVRQAIELGELVHMETASEELTDEFLLFAIDSG |
Ga0335084_118877761 | 3300033004 | Soil | MDSIKLWARNGEAVRQAIELGAIAHIETASEELTDEFLLF |
Ga0310914_108229271 | 3300033289 | Soil | MDSIKLWARNGEAVRQAIELGELVHMETASEELTDEFLLFAIESGLLKTWAETF |
Ga0314801_144251_3_173 | 3300034676 | Soil | MDSLRLWARDGEAVRQAIELGEIAHIETASEELTDEFLLFALESGLLQTWAEAFPDP |
⦗Top⦘ |