NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F043880

Metagenome / Metatranscriptome Family F043880

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F043880
Family Type Metagenome / Metatranscriptome
Number of Sequences 155
Average Sequence Length 48 residues
Representative Sequence MLVVIGIAIGLAVGAGLAFLSLYAFTGSRLAAARRTRQLLVTEAR
Number of Associated Samples 139
Number of Associated Scaffolds 155

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 96.77 %
% of genes from short scaffolds (< 2000 bps) 92.90 %
Associated GOLD sequencing projects 131
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (68.387 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(24.516 % of family members)
Environment Ontology (ENVO) Unclassified
(27.097 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(58.710 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 58.90%    β-sheet: 0.00%    Coil/Unstructured: 41.10%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 155 Family Scaffolds
PF02631RecX 56.77
PF00154RecA 9.68
PF12072RNase_Y_N 1.94
PF02834LigT_PEase 1.29
PF00106adh_short 0.65
PF135632_5_RNA_ligase2 0.65
PF01250Ribosomal_S6 0.65
PF02548Pantoate_transf 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 155 Family Scaffolds
COG2137SOS response regulatory protein OraA/RecX, interacts with RecAPosttranslational modification, protein turnover, chaperones [O] 56.77
COG0468RecA/RadA recombinaseReplication, recombination and repair [L] 9.68
COG1514RNA 2',3'-cyclic phosphodiesterase (2'-5' RNA ligase)Translation, ribosomal structure and biogenesis [J] 1.29
COG0360Ribosomal protein S6Translation, ribosomal structure and biogenesis [J] 0.65
COG0413Ketopantoate hydroxymethyltransferaseCoenzyme transport and metabolism [H] 0.65

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.39 %
UnclassifiedrootN/A31.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459019|G14TP7Y01COU5AAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria698Open in IMG/M
2199352025|deepsgr__Contig_37155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1119Open in IMG/M
3300000956|JGI10216J12902_104100641Not Available515Open in IMG/M
3300000956|JGI10216J12902_104767680All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300001205|C688J13580_1053493Not Available550Open in IMG/M
3300001686|C688J18823_10091836All Organisms → cellular organisms → Bacteria2108Open in IMG/M
3300002568|C688J35102_118127197Not Available532Open in IMG/M
3300004463|Ga0063356_104589957All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300005093|Ga0062594_103247025Not Available510Open in IMG/M
3300005181|Ga0066678_10633214All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300005187|Ga0066675_10248579All Organisms → cellular organisms → Bacteria1269Open in IMG/M
3300005187|Ga0066675_10601976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes826Open in IMG/M
3300005329|Ga0070683_101591943Not Available628Open in IMG/M
3300005334|Ga0068869_101117562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria690Open in IMG/M
3300005355|Ga0070671_101503914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium596Open in IMG/M
3300005364|Ga0070673_100713221All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300005367|Ga0070667_101470750Not Available639Open in IMG/M
3300005454|Ga0066687_10103572All Organisms → cellular organisms → Bacteria1441Open in IMG/M
3300005454|Ga0066687_10990031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300005553|Ga0066695_10259158All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300005560|Ga0066670_10353150All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300005569|Ga0066705_10610323All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300005586|Ga0066691_10377967All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300005587|Ga0066654_10536007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria644Open in IMG/M
3300005587|Ga0066654_10639869Not Available591Open in IMG/M
3300005598|Ga0066706_11311928Not Available547Open in IMG/M
3300005615|Ga0070702_100521140All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300005617|Ga0068859_101735109All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300005618|Ga0068864_100109803All Organisms → cellular organisms → Bacteria2455Open in IMG/M
3300005840|Ga0068870_10259880All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300005842|Ga0068858_102209372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300005886|Ga0075286_1068226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → unclassified Bacillus (in: Bacteria) → Bacillus sp. URHB0009518Open in IMG/M
3300006046|Ga0066652_101050943All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300006755|Ga0079222_10292734All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300006796|Ga0066665_11223659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M
3300006845|Ga0075421_100061586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4743Open in IMG/M
3300006903|Ga0075426_10337738All Organisms → cellular organisms → Bacteria1106Open in IMG/M
3300006904|Ga0075424_100907485Not Available940Open in IMG/M
3300006914|Ga0075436_101184079Not Available576Open in IMG/M
3300006969|Ga0075419_10222383All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300007820|Ga0104324_113366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1277Open in IMG/M
3300009012|Ga0066710_101021669All Organisms → cellular organisms → Bacteria1276Open in IMG/M
3300009012|Ga0066710_102326568Not Available779Open in IMG/M
3300009098|Ga0105245_10327818All Organisms → cellular organisms → Bacteria1510Open in IMG/M
3300009137|Ga0066709_100313259All Organisms → cellular organisms → Bacteria2138Open in IMG/M
3300009148|Ga0105243_10137374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2081Open in IMG/M
3300009148|Ga0105243_12974401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300009545|Ga0105237_10930315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria876Open in IMG/M
3300009545|Ga0105237_11325165Not Available726Open in IMG/M
3300010166|Ga0126306_11525113Not Available555Open in IMG/M
3300010301|Ga0134070_10271604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium639Open in IMG/M
3300010304|Ga0134088_10326476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria743Open in IMG/M
3300010321|Ga0134067_10042362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1444Open in IMG/M
3300010322|Ga0134084_10030496All Organisms → cellular organisms → Bacteria1506Open in IMG/M
3300010323|Ga0134086_10308676Not Available616Open in IMG/M
3300010396|Ga0134126_13006474Not Available509Open in IMG/M
3300010397|Ga0134124_10620829All Organisms → cellular organisms → Bacteria → Proteobacteria1061Open in IMG/M
3300010399|Ga0134127_12528223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria593Open in IMG/M
3300010400|Ga0134122_10816395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium892Open in IMG/M
3300010400|Ga0134122_11493762Not Available694Open in IMG/M
3300010400|Ga0134122_11658214Not Available666Open in IMG/M
3300010401|Ga0134121_11142969Not Available774Open in IMG/M
3300011003|Ga0138514_100092700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300011992|Ga0120146_1069763Not Available569Open in IMG/M
3300012005|Ga0120161_1124840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium590Open in IMG/M
3300012011|Ga0120152_1001846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10776Open in IMG/M
3300012199|Ga0137383_10336611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1105Open in IMG/M
3300012285|Ga0137370_10650982All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300012350|Ga0137372_10473982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria935Open in IMG/M
3300012351|Ga0137386_11040864Not Available581Open in IMG/M
3300012359|Ga0137385_10332894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1302Open in IMG/M
3300012481|Ga0157320_1026669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300012491|Ga0157329_1014623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium669Open in IMG/M
3300012514|Ga0157330_1056796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium571Open in IMG/M
3300012893|Ga0157284_10128865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium695Open in IMG/M
3300012902|Ga0157291_10070911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium879Open in IMG/M
3300012904|Ga0157282_10011272All Organisms → cellular organisms → Bacteria1631Open in IMG/M
3300012948|Ga0126375_11972398Not Available515Open in IMG/M
3300012957|Ga0164303_10938101Not Available610Open in IMG/M
3300012960|Ga0164301_10210563All Organisms → cellular organisms → Bacteria1247Open in IMG/M
3300012960|Ga0164301_10438396Not Available925Open in IMG/M
3300012961|Ga0164302_11504121Not Available555Open in IMG/M
3300012971|Ga0126369_13241826Not Available533Open in IMG/M
3300012977|Ga0134087_10089706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1273Open in IMG/M
3300012985|Ga0164308_10901280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium779Open in IMG/M
3300012985|Ga0164308_11559079Not Available608Open in IMG/M
3300012988|Ga0164306_10971079Not Available698Open in IMG/M
3300012989|Ga0164305_10937500Not Available731Open in IMG/M
3300013297|Ga0157378_11019749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria862Open in IMG/M
3300013307|Ga0157372_11531631All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300013766|Ga0120181_1020019Not Available1719Open in IMG/M
3300014488|Ga0182001_10528203Not Available550Open in IMG/M
3300014497|Ga0182008_10426952Not Available717Open in IMG/M
3300014829|Ga0120104_1032405All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300015053|Ga0137405_1042113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300015053|Ga0137405_1263598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300015077|Ga0173483_10788024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300015077|Ga0173483_10880864Not Available525Open in IMG/M
3300015356|Ga0134073_10040811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1209Open in IMG/M
3300015357|Ga0134072_10389324Not Available546Open in IMG/M
3300015359|Ga0134085_10567347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300017654|Ga0134069_1158035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria760Open in IMG/M
3300017944|Ga0187786_10192267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium770Open in IMG/M
3300018051|Ga0184620_10095366Not Available910Open in IMG/M
3300018061|Ga0184619_10188236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria947Open in IMG/M
3300018468|Ga0066662_12985492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300019362|Ga0173479_10249755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria780Open in IMG/M
3300019873|Ga0193700_1046396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria692Open in IMG/M
3300019875|Ga0193701_1004639All Organisms → cellular organisms → Bacteria2583Open in IMG/M
3300019883|Ga0193725_1095179Not Available710Open in IMG/M
3300019887|Ga0193729_1146319Not Available858Open in IMG/M
3300020000|Ga0193692_1099661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria615Open in IMG/M
3300021445|Ga0182009_10228343Not Available916Open in IMG/M
3300025903|Ga0207680_10729982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium710Open in IMG/M
3300025929|Ga0207664_11429487Not Available613Open in IMG/M
3300025930|Ga0207701_11066415Not Available671Open in IMG/M
3300025931|Ga0207644_10413789All Organisms → cellular organisms → Bacteria → Proteobacteria1104Open in IMG/M
3300025935|Ga0207709_10389464All Organisms → cellular organisms → Bacteria → Terrabacteria group1063Open in IMG/M
3300025937|Ga0207669_11209082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium640Open in IMG/M
3300025938|Ga0207704_11492637Not Available580Open in IMG/M
3300025960|Ga0207651_10231696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1500Open in IMG/M
3300025972|Ga0207668_10485814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1060Open in IMG/M
3300025981|Ga0207640_10691651Not Available873Open in IMG/M
3300026035|Ga0207703_12346696Not Available509Open in IMG/M
3300026323|Ga0209472_1218054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium627Open in IMG/M
3300026326|Ga0209801_1244735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria686Open in IMG/M
3300026528|Ga0209378_1163839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria849Open in IMG/M
3300026538|Ga0209056_10286591All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300026542|Ga0209805_1393642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300026547|Ga0209156_10030922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3041Open in IMG/M
3300028379|Ga0268266_11395250Not Available676Open in IMG/M
3300028592|Ga0247822_11905258Not Available509Open in IMG/M
3300028713|Ga0307303_10196133Not Available500Open in IMG/M
3300028715|Ga0307313_10064255All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300028718|Ga0307307_10213308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300028719|Ga0307301_10190350Not Available665Open in IMG/M
3300028782|Ga0307306_10012100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1859Open in IMG/M
3300028784|Ga0307282_10012479All Organisms → cellular organisms → Bacteria3436Open in IMG/M
3300028784|Ga0307282_10057539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1746Open in IMG/M
3300028796|Ga0307287_10124624Not Available976Open in IMG/M
3300028807|Ga0307305_10187229Not Available953Open in IMG/M
3300028809|Ga0247824_10351028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium842Open in IMG/M
3300028819|Ga0307296_10041834All Organisms → cellular organisms → Bacteria2417Open in IMG/M
3300028819|Ga0307296_10506721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria660Open in IMG/M
3300028819|Ga0307296_10650730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300028824|Ga0307310_10006260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4511Open in IMG/M
3300028875|Ga0307289_10037374All Organisms → cellular organisms → Bacteria1925Open in IMG/M
3300028884|Ga0307308_10168801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1048Open in IMG/M
3300030904|Ga0308198_1078784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium551Open in IMG/M
3300031731|Ga0307405_10989595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium717Open in IMG/M
3300031858|Ga0310892_11388748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300031939|Ga0308174_11854020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300031996|Ga0308176_11338619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium761Open in IMG/M
3300032205|Ga0307472_102533406Not Available522Open in IMG/M
3300033412|Ga0310810_11082444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria670Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil24.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil14.19%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil6.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.16%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.52%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.52%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.23%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.23%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.29%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.29%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.29%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.29%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.65%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.65%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.65%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.65%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.65%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.65%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.65%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.65%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.65%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459019Litter degradation MG4EngineeredOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001205Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005886Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007820Permafrost core soil microbial communities from Svalbard, Norway - sample 2-12-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011992Permafrost microbial communities from Nunavut, Canada - A23_65cm_12MEnvironmentalOpen in IMG/M
3300012005Permafrost microbial communities from Nunavut, Canada - A15_80cm_0MEnvironmentalOpen in IMG/M
3300012011Permafrost microbial communities from Nunavut, Canada - A30_65cm_6MEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012491Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610Host-AssociatedOpen in IMG/M
3300012514Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013766Permafrost microbial communities from Nunavut, Canada - A26_65cm_6MEnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014829Permafrost microbial communities from Nunavut, Canada - A10_35cm_6MEnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019873Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030904Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4MG_030570402170459019Switchgrass, Maize And Mischanthus LitterMFVVIGILIGLGAGAALAFIGLYALPAPASRRRGGRASCY
deepsgr_002695302199352025SoilMVVVIGILIGLAVGAGLAFLSLYAFAGSRLAAARRTRQLLVSEAKRESDVMRREAPERGRRAAPRRADRGA
JGI10216J12902_10410064113300000956SoilMLIVVGIAIGLVAGAAVAFFALHALTGSRLAAARRTRQL
JGI10216J12902_10476768033300000956SoilMLVVIGIAIGLALGAGLAFLSLYALTGSRLAAARRTRQLLISEAKRDAESLRRE
C688J13580_105349313300001205SoilMVVVIGIVIGLAVGAGLAFLSLYAFAGSRLAAARRTRQ
C688J18823_1009183613300001686SoilMLVVIGIAIGLAIGAGLAFLSLYAFTGSRLAAARRTRQLLV
C688J35102_11812719723300002568SoilMLIVVGILIGLVVGAAAAFFALHALAGSRLAAARRTRQLLIAEAKR
Ga0063356_10458995723300004463Arabidopsis Thaliana RhizosphereMFVVIGILIGLGAGAALAFIGLYALTGSRLAAARRTRQLLLTDARREADAM
Ga0062594_10324702513300005093SoilMFVVIGILIGLAAGAALAFIALYALTGSRLAAARRTRQLLVTEA
Ga0066678_1063321413300005181SoilMLVVIGIVIGLGVGAGLAFLSLYALTGSRLAAARRTRQLLVAEARRDADAVR
Ga0066675_1024857913300005187SoilMFVVIGTLIGLVAGAALAFVALRAITGSRLAAARRTRQLL
Ga0066675_1060197613300005187SoilMLVVIGIAIGLVIGVGVTFLSLYAFTGSRLAAARRTRQLLVTEARRDAEA*
Ga0070683_10159194323300005329Corn RhizosphereMAIAIGILIGLVVGGALAFAILALTGGSRLAAARRTRQLLLQEAKREADA
Ga0068869_10111756213300005334Miscanthus RhizosphereMVVVIGILIGLAVGAGLAFLSLYAFAGSRLAAARRTRQLLVSEAKRESDVMRREAQSEADALRRE
Ga0070671_10150391413300005355Switchgrass RhizosphereMVVVIGILVGLAVGAGITFLSLYAFTGSRLAAARRTRQLLVT
Ga0070673_10071322123300005364Switchgrass RhizosphereMAIVIGIIIGLVVGAALAIVALAATGGSRLAAAGRQRQLLLEEARRDADALR
Ga0070667_10147075013300005367Switchgrass RhizosphereMVVVIGILIGLAVGAGLAFLSLYAFAGSRLAAARRTRQLLVSEAKRESDVMRREAQSEADALRREGQIEA
Ga0066687_1010357213300005454SoilMFVVIGILIGLGAGAALAFIALYALTGSRLAAARRTRQLLLTE
Ga0066687_1099003113300005454SoilMFVVIGILIGLGAGAALAFIALYALTGSRLAAARRTRQLLLTEARRDAEAMGR
Ga0066695_1025915813300005553SoilMLVVIGIAIGLAVGAGLAFLSLYAFTGSRLAAARRTRQLLVTEAR
Ga0066670_1035315013300005560SoilMLVVIGIAIGLVVGVGVAFLSLYAFTGSRLAAARRTRQLLVTEARRD
Ga0066705_1061032323300005569SoilMLVVIGIAIGLVAGAGVAFLSLYALTGSRLAAARRTRQLLVSEAKRDAEAL
Ga0066691_1037796723300005586SoilMFVVIGILIGLAAGAALAFIALYALTGSRLAAARRTRQLLVTEARHEAEAVRREAQ
Ga0066654_1053600723300005587SoilMFVVIGILIGLAAGAALAFFVLYALAGSRLAAARRTRQLLLAEARR
Ga0066654_1063986913300005587SoilVGATEESAPVFVVIGILIGLAAGAALAFIALYALTGSRLATARRTRQLLLTEAR
Ga0066706_1131192813300005598SoilMFVVIGILIGLGAGAALAFVALYALTGSRLAAARRTRQ
Ga0070702_10052114013300005615Corn, Switchgrass And Miscanthus RhizosphereMAILIGIIIGLVAGAVLAVVGLSASGGSRLAAARRTRQLMLEEARGEADALRREAQL
Ga0068859_10173510923300005617Switchgrass RhizosphereMVIVIGILIGLAVGAGLAFLSLYAFAGSRLAAARRTRQLLVSEAKRESD
Ga0068864_10010980313300005618Switchgrass RhizosphereMVVVIGIVAGLAVGAGVAFLSLYAFAGSRLAAARRTRQLLVTEAKREADS
Ga0068870_1025988033300005840Miscanthus RhizosphereMVVVIGILIGLALGAGIAFLSLYAFAGSRLAAARRTRQLLVTEAKREADVMRREAQSEA
Ga0068858_10220937223300005842Switchgrass RhizosphereMFVVIGILIGLGAGAALAFIGLYALTGSRLAAARRTRQLLLTDARREADAMRRE
Ga0075286_106822613300005886Rice Paddy SoilMVVVIGILIGLAVGAGLAFLSLYAFAGSRLAAARRTRQLLVSEAKREADVMRREAQSEADAL
Ga0066652_10105094323300006046SoilMVVVIGILIGLAVGAGVAFFSLYAFAGSRLAAARRTRQLLVSEAKREADVM
Ga0079222_1029273433300006755Agricultural SoilMLIVIGIAIGLAVGAGVAFLSLYALTGSRLAAARRTRQLLVSEANRDAEALR
Ga0066665_1122365923300006796SoilMLVVIGIAIGLAIGVGLAFLSLYAFTGSRLAAARRT
Ga0075421_10006158673300006845Populus RhizosphereMFVVIGTLIGLVAGAALAFVALRAITGSRLAAARRTRQLLL
Ga0075426_1033773833300006903Populus RhizosphereMFVVIGILIGLAAGAALAFIALYALTGSRLAAARRTRQLLLTEARRDAEA
Ga0075424_10090748533300006904Populus RhizosphereMVVVIGILIGLALGAGIAFLSLYAFAGSRLAAARRTRQLLVTEAKREA
Ga0075436_10118407923300006914Populus RhizosphereMVVVIGILIGLALGAGVAFLSLYAFAGSRLTAARRTRQLLVTEAKREADVMRREAQS
Ga0075419_1022238313300006969Populus RhizosphereMVVVIGIVIGLAVGAGVAFLSLYAFTGSRLAAARRTRQL
Ga0104324_11336613300007820SoilMVVVIGILVGLSVGAGLAFLSLYAFAGSRLAAARRTRQLL
Ga0066710_10102166913300009012Grasslands SoilMFVVIGILIGLGAGAALAFVALYALTGSRLAAARRTRQLLLTEA
Ga0066710_10232656813300009012Grasslands SoilMLIVIGIAIGLALGASLAFLSLYALTGSRLAAARRT
Ga0105245_1032781833300009098Miscanthus RhizosphereMAIVIGIIIGLVVGAALAIVGLAANGGSRLAAARRQRQLLLDEARRDAD
Ga0066709_10031325943300009137Grasslands SoilMLVVIGIAIGLVIGVGVTFLSLYAFTGSRLAAARRTRQLLVTEARRDA
Ga0105243_1013737413300009148Miscanthus RhizosphereMVVVIGILIGLAVGAGLAFLSLYAFAGSRLAAARRTRQLLVSEAKRESDVMRREAQSE
Ga0105243_1297440113300009148Miscanthus RhizosphereMVVVIGIVIGLAVGAGVAFLSLYAFTGSRLAAARRTRQLLV
Ga0105237_1093031523300009545Corn RhizosphereMFVVIGILIGLGAGAALAFIGLYALTGSRLAAERPAA
Ga0105237_1132516513300009545Corn RhizosphereMAIVIGILIGLVVGAALTVAFLVLSGGSRLAAARRTRQLLLQEAQREAESLRREAQLE
Ga0126306_1152511313300010166Serpentine SoilMVVVIGILVGLLVGAGLAVLSLNALTGSRLAAARRTRQLLISEAKREADALRREAQ
Ga0134070_1027160423300010301Grasslands SoilMVVVIGIAIGLAVGAGCAFLSLYAFAGSRLAAARRTRQLIVTEAKGEADALRREAQIEA
Ga0134088_1032647623300010304Grasslands SoilMFVVIGTLIGLVAGAALAFVALRAITGSRLAAARRTRQLLLTEA
Ga0134067_1004236233300010321Grasslands SoilMFVVIGILIGLGAGAALAFTALHALAGSRLATARRTR
Ga0134084_1003049633300010322Grasslands SoilMFVVIGTVIGLVAGAALAFVAIRAITGSRLAAARRTRQLLLTE
Ga0134086_1030867623300010323Grasslands SoilMLVVIGIGIGLVAGAGLAFLSLYALTGSRLAAARRTRQLLVSEAKRDA
Ga0134126_1300647413300010396Terrestrial SoilMLLVGILGGLVAGAAITFFALHAFAGSRFAAARRTRQLLLAEARREAEALRRE
Ga0134124_1062082933300010397Terrestrial SoilMVVVIGILIGLALGAGVAFLSLYAFAGSRLAAARRT
Ga0134127_1252822323300010399Terrestrial SoilMFVVIGILIGLGAGAALAFIGLYALTGSRLAAARRTRQLLLTD
Ga0134122_1081639523300010400Terrestrial SoilMAVIIGIAIGLAAGAGLAFLSLYAFAGSRLAAARRTRQLLVAEAKREA
Ga0134122_1149376223300010400Terrestrial SoilMTIVIGILIGLVVGAALAIALLALSGGSRLAAARRTRQLLLEEARREA
Ga0134122_1165821413300010400Terrestrial SoilMVVVIGILIGLALGAGIAFLSLYAFAGSRLAAARRTRQLLVTEAKREADVMRREAQS
Ga0134121_1114296923300010401Terrestrial SoilMVVVIGILIGLAVGAGLAFLSLYAFAGSRLAAARRTR
Ga0138514_10009270023300011003SoilMLVVIGIAIGLAAGLGLAFVWLYAFTGSRLAAARRTQQLLVTEA
Ga0120146_106976313300011992PermafrostMVVVIGIVVGLAAGAGFAFLSLYAFAGSRPRGARRPRH
Ga0120161_112484013300012005PermafrostMVVVIGILVGLAVGAGLAFLSLYAFAGSRLAAARRTRQLL
Ga0120152_100184613300012011PermafrostMGIVIGILVGLIAGSGLTVAALVLNGGSRLAAARRTRQLLIQEARGEADVLRRGGELAG
Ga0137383_1033661133300012199Vadose Zone SoilMGIVIGILVGLLAGSGLTVAALVLNGGSRLAVARRTRQLLIQEARGEADALRREAQLAA
Ga0137370_1065098223300012285Vadose Zone SoilMVVVIGILIGLAVGAGLAFLSLYAFAGSRLAAARRTRQLLVSEAKRESDVMRREA
Ga0137372_1047398213300012350Vadose Zone SoilMFVVIGILIGLAAGAALAFIALYALTGSRLAAARRT
Ga0137386_1104086413300012351Vadose Zone SoilMLVVIGIAIGLVAGAGLAFLSLYALTGSRLAAARRTRQLL
Ga0137385_1033289433300012359Vadose Zone SoilMLVVIGIAIGLVAGAGVAFLSLYALTGSRLAAARRT
Ga0157320_102666923300012481Arabidopsis RhizosphereMVVVIGIVIGLAVGAGVAFLSLYAFTGSRLAAARRTRQLLVAEAKRD
Ga0157329_101462313300012491Arabidopsis RhizosphereMVVVIGIVLGLAVGAGVAFLSLYAFTGSRLAAARRTRQ
Ga0157330_105679623300012514SoilMVVVIGIVVGLAVGAGVAFLSLYAFTGSRLAAARRTRQLLISEA
Ga0157284_1012886513300012893SoilMVVVIGIVIGLVVGAGVAFLSLYAFTGSRLAAARRTRQLLVAEAKRDAEAQRREAQIEA
Ga0157291_1007091133300012902SoilMVVVIGIVIGLAVGAGVAFLSLYAFTGSRLAAARR
Ga0157282_1001127213300012904SoilMVVVIGIVIGLVVGAGVAFLSLYAFTGSRLAAARRTRQLL
Ga0126375_1197239813300012948Tropical Forest SoilMFVVIGILIGLVVGAALVFVALYAFTGSRLAAARRTRQLLVTEARREAEA
Ga0164303_1093810113300012957SoilMFVVIGILIGLAAGAALAFIALYALTGSRLATARRTRQLLLTEARREAEAMRRE
Ga0164301_1021056313300012960SoilMFVVIGILIGLAAGAALAFIALYALTGSRLATARRTRQLLLTEARREA
Ga0164301_1043839623300012960SoilMAIGIGILIGLVVGGALAFAILALTGGSRLAAARRTRQLLLQEAKREAE
Ga0164302_1150412123300012961SoilMLVVIGIAIGLAVGAGLAFLSLYALTGSRLAAARRTRQLLIAEARRDADAFRR
Ga0126369_1324182623300012971Tropical Forest SoilMAIVIGIIIGLVVGAALAIATLAANGGSRLAAARRQRQLMLEEARGEADALRREA
Ga0134087_1008970633300012977Grasslands SoilMFVVIGTLIGLVVGAALAFVALRAITGSRLGAARRTRQLLLTEARREA
Ga0164308_1090128023300012985SoilMVVVIGIVIGLVVGAGLAFLSLYAFAGSRLAAARRTRQLLVSEAKRE
Ga0164308_1155907913300012985SoilMLVVIGIVVGLAVGAGLAFLSLYALTGSRLAAARRTRQLVIAEARREADAFRREAQIE
Ga0164306_1097107913300012988SoilMVVVIGILIGLAVGAGLAFLSLYAFAGSRLAAARRTRQLLVSEAKRESDVMRREAQSEADAM
Ga0164305_1093750013300012989SoilMAIGIGILIGLVVGGALAFAILALTGGSRLAAARRTRQLLLQEAKREAEA
Ga0157378_1101974923300013297Miscanthus RhizosphereMFVVIGILIGLGAGAALAFIGLYALTGSRLAAARRTRQLLLTDARREADAMRRETQI
Ga0157372_1153163123300013307Corn RhizosphereMAIVIGIIIGLVVGAALAIVALAATGGSRLAAAGRQRQLLLEEARRDADALRREAQLEA
Ga0120181_102001923300013766PermafrostMVVVIGILVGLSVGAGLAFLSLYAFAGSRLAAARRTRQLLVAEAKREADALRREAQI*
Ga0182001_1052820323300014488SoilMLVVLGILIGLAAGAALAFVALYAFAGSRLATARRTRQLLLS
Ga0182008_1042695223300014497RhizosphereMVVVIGILIGLALGAGVAFLSLYAFAGSRLAAARRTRQLLVTEAKREADVMRREAQSEADALRRE
Ga0120104_103240533300014829PermafrostMVVVIGILVGLSVGAGLAFLSLYAFAGSRLAAARRDSSGG*
Ga0137405_104211323300015053Vadose Zone SoilMFVVIGILIGLGVGAALAFVALYALTGSRLAAARRTRQ
Ga0137405_126359813300015053Vadose Zone SoilMFVVIGILIGLGVGAALAFVALYALTGSRLASRRPAGRG
Ga0173483_1078802413300015077SoilMVVVIGIVVGLAVGAGIAFLSLYAFTGSRLAAARRTRQLLVTDAK
Ga0173483_1088086413300015077SoilMVVVIGILIGLAVGAGVAFFSLYAFAGSRLAAARRTRQLLMSEAKREA
Ga0134073_1004081113300015356Grasslands SoilMFVVIGILIGLAVGAALAFIALYALAGSRLAAARRTRQL
Ga0134072_1038932413300015357Grasslands SoilMVVVIGIAIGLAVGAGFAFLSLYAFAGSRLAAARRTRQLMVTEAKREADALRREAQI
Ga0134085_1056734713300015359Grasslands SoilMFVVIGILIGLGAGAALAFIGLYALTGSRLAAARRTRQLLLTEARREAEAM
Ga0134069_115803523300017654Grasslands SoilMFVVIGILIGLGAGTALAFVALYALTGSRLAAARRTRQLLLTEARRE
Ga0187786_1019226713300017944Tropical PeatlandMVVVIGIVVGLAVGAGIAFLSLYAFTGSRLAAARRTRQLLLSEAKRDA
Ga0184620_1009536623300018051Groundwater SedimentMFVVIGILIGLGAGAALAFIGLYALTGSRLAAARRTRQLLLTDARREA
Ga0184619_1018823633300018061Groundwater SedimentMWTLNTGAPMFVVIGILIGLGAGAALAFIALYALTGSRLAAARRT
Ga0066662_1298549223300018468Grasslands SoilMFVVIGILIGLGAGAALAFIALYALTGSRLAAARRTRQLLLTEARREA
Ga0173479_1024975513300019362SoilMFVVIGILIGLAAGAALAFIALYALTGSRLAAARRTRQLLLTEARR
Ga0193700_104639623300019873SoilMFVVIGILIGLGAGAALAFIALYALTGSRLAAARRTRQLLLTDAR
Ga0193701_100463913300019875SoilMFVVIGILIGLGAGAALAFIGLYALTGSRLAAARR
Ga0193725_109517923300019883SoilMVVVIGILIGLAVGAGLAFLSLYAFAGSRLAAARRTRQLLVSEAKRESDVMRREAQS
Ga0193729_114631923300019887SoilMLVVIGIAIGLAAGAGLAFLSLYALTGSRLAAARRNRQLL
Ga0193692_109966113300020000SoilMFVVIGILIGLGAGAALAFIALYALTGSRLAAARR
Ga0182009_1022834313300021445SoilMLIVIGIAIGLATGAGLAFLSLYALTGSRLAAARRTRQLLVSEAKRDAEAL
Ga0207680_1072998213300025903Switchgrass RhizosphereMVVVIGIVVGLAVGAGIAFLSLYAFTGSRLAAARRTRQLLLTEAKR
Ga0207664_1142948713300025929Agricultural SoilMVVVIGIVAGLAVGAGVAFLSLYAFAGSRLAAARRTRQ
Ga0207701_1106641513300025930Corn, Switchgrass And Miscanthus RhizosphereMVVVIGILIGLAVGAGLAFLSLYAFAGSRLAAARRTRQLLVSEAKRESDVM
Ga0207644_1041378933300025931Switchgrass RhizosphereMAIAIGILIGLVVGGALAFAILALTGGSRLAAARRTRQLLLQEA
Ga0207709_1038946433300025935Miscanthus RhizosphereMVVVIGILIGLAVGAGVAFFSLYAFAGSRLAAARRTRQLLVSEAK
Ga0207669_1120908223300025937Miscanthus RhizosphereMAVIIGIAIGLAAGAGLAFLSLYAFAGSRLAAARRTRQLLVAEAKRE
Ga0207704_1149263713300025938Miscanthus RhizosphereMFVVIGILIGLAAGAALAFIALYALTGSRLAAARRTRQLLLTE
Ga0207651_1023169613300025960Switchgrass RhizosphereMVVVIGILIGLAVGAGLAFLSLYAFAGSRLAAARRTRQLLVSEAKRESDVMRREAQSEADALRREGQI
Ga0207668_1048581413300025972Switchgrass RhizosphereMFVVIGILIGLGAGAALAFIGLYALTGSRLAAARRTR
Ga0207640_1069165113300025981Corn RhizosphereMVVVIGILIGLAVGAGLAFLSLYAFAGSRLAAARRTRQLLVSEAKRESDVMRREAQSEADALR
Ga0207703_1234669623300026035Switchgrass RhizosphereMVVVIGILIGLAVGAGLAFLSLYAFAGSRLAAARRT
Ga0209472_121805423300026323SoilMLVVIGIAIGLAVGAGLAFLSLYAFAGSRLAAARRTRQLLVTDARREAE
Ga0209801_124473513300026326SoilMFVVIGILIGLGAGAALAFIALYALTGSRLAAARRTRQLLLTEAR
Ga0209378_116383923300026528SoilMFVVIGILIGLGAGAALAVIGLYALTGSRLAAARRTRQLLLTEARREAEAMRRETQIEAR
Ga0209056_1028659113300026538SoilMFVVIGILIGLGAGAALAFIGLYALTGSRLAAARRTRQLLLTEARREA
Ga0209805_139364223300026542SoilMFVVIGILIGLGAGAALAFIALYALTGSRLAAARRTR
Ga0209156_1003092253300026547SoilMLVVIGIAIGLVAGAGVAFLSLYALTGSRLAAARRTRQLLV
Ga0268266_1139525023300028379Switchgrass RhizosphereMAIVIGIIIGLVVGAALAIVGLAANGGSRLAAARRQRQLLLDEARRDADALRREAQLE
Ga0247822_1190525813300028592SoilMAVIIGIAIGLAAGAGLAFLSLYAFAGSRLAAARRTRQLLVAEA
Ga0307303_1019613323300028713SoilMLIVIGIAIGLAAGAGLTFLSLYAFTGSRLAAARRT
Ga0307313_1006425533300028715SoilMVVVIGILIGLAVGAGGAFLSLYSFAGSRLAAARRTRQLLITEA
Ga0307307_1021330813300028718SoilMLVIVIGIAIGLVAGAGLTFLSLYAFTGSRLAAARRTRQLLVTEA
Ga0307301_1019035023300028719SoilMVVVIGILIGLAVGASGAFLSLYAFAGSRLAAARRTRQLLITEAKREADAVRR
Ga0307306_1001210013300028782SoilMLVVIGIAIGLVIGVGVAFLSLYAFTGSRLAAARRTR
Ga0307282_1001247913300028784SoilMLVVIGIAIGLAAGASLAFLSLYALTGSRLATARRTR
Ga0307282_1005753933300028784SoilMVVVIGILIGLAVGAGGAFLSLYSFAGSRLAAARRTRQLLITEAKRESDALRRESQIE
Ga0307287_1012462413300028796SoilMVVVIGILIGLAVGAGGAFLSLYSFAGSRLAAARRT
Ga0307305_1018722913300028807SoilMVVVIGILIGLAVGAGGAFLSLYSFAGSRLAAARRTRQLLITEAKRESDALRRESQ
Ga0247824_1035102823300028809SoilMVVVIGIVIGLAVGAGVAFLSLYAFTGSRRAAGRRPRQLLGAEATRHPEAPRRAAASRDPVN
Ga0307296_1004183413300028819SoilMFVVIGILIGLGAGAALAFIGLYALTGSRLAAARRTRQLLLTDARREAEAMRRETQI
Ga0307296_1050672123300028819SoilMWALNTGAPMFVVIGILIGLGAGAALAFIALYALTGSRLAAARRTRQLLLTEARREAEA
Ga0307296_1065073013300028819SoilMFVVIGILIGLGAGAALAFIGLYALTGSRLAAARRTRQLLLTDARREADA
Ga0307310_1000626063300028824SoilMDVVIGIVIGLAVGAGVAFLSLYAFAGSRLAAARRTRQLLVTEAKRESD
Ga0307289_1003737433300028875SoilMVFVIGILIGLAVGAGLAFLSLYAFAGSRLAAARRTRQLLVTEAKREADVMRREAQSEADAL
Ga0307308_1016880133300028884SoilMAVIIGIAIGLAAGAGLAFLSLYAFAGSRLAAARRTRQLLVAEAKREGE
Ga0308198_107878423300030904SoilMVFVIGILIGLAVGAGLAFLSLYAFAGSRLAAARRTRQLLVTEAKREADVM
Ga0307405_1098959523300031731RhizosphereMVVVIGIVVGLAVGAGVAFLSLYAFTGSRLAGARRTRQLLLTEANRDADAMRRE
Ga0310892_1138874813300031858SoilMFVVIGILIGLAAGAALAFIALYALTGSRLAAARRTRQLLLTEARRD
Ga0308174_1185402013300031939SoilMVVVIGILIGLALGAGVAFLSLYAFAGSRLAAARRTRQLLVTEA
Ga0308176_1133861913300031996SoilMVVVIGILIGLAVGAGAAFLSLYAFTGSRLAAARRTRQLLISEAKRDSDALRRE
Ga0307472_10253340613300032205Hardwood Forest SoilMFVVIGILIGLAAGAALAFIALYALTGSRLATARRTRQLLL
Ga0310810_1108244423300033412SoilMFVVIGILIGLAAGAALAFIALYALTGSRLAAARRTRQLLLT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.