Basic Information | |
---|---|
Family ID | F043793 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 155 |
Average Sequence Length | 37 residues |
Representative Sequence | MLVLRTLTVKMTVKVCEAAASALQINSLEGSLMIEWE |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 155 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 41.83 % |
% of genes near scaffold ends (potentially truncated) | 21.94 % |
% of genes from short scaffolds (< 2000 bps) | 70.32 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (61.935 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment (21.290 % of family members) |
Environment Ontology (ENVO) | Unclassified (41.935 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Sediment (non-saline) (39.355 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.15% β-sheet: 0.00% Coil/Unstructured: 53.85% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 155 Family Scaffolds |
---|---|---|
PF01381 | HTH_3 | 4.52 |
PF05015 | HigB-like_toxin | 3.87 |
PF13338 | AbiEi_4 | 2.58 |
PF09907 | HigB_toxin | 2.58 |
PF01850 | PIN | 1.94 |
PF14437 | MafB19-deam | 1.29 |
PF06742 | DUF1214 | 1.29 |
PF00378 | ECH_1 | 1.29 |
PF00872 | Transposase_mut | 1.29 |
PF07969 | Amidohydro_3 | 1.29 |
PF00690 | Cation_ATPase_N | 1.29 |
PF02518 | HATPase_c | 1.29 |
PF13356 | Arm-DNA-bind_3 | 0.65 |
PF09957 | VapB_antitoxin | 0.65 |
PF02635 | DrsE | 0.65 |
PF00196 | GerE | 0.65 |
PF04851 | ResIII | 0.65 |
PF01292 | Ni_hydr_CYTB | 0.65 |
PF05521 | Phage_H_T_join | 0.65 |
PF05016 | ParE_toxin | 0.65 |
PF01979 | Amidohydro_1 | 0.65 |
PF01569 | PAP2 | 0.65 |
PF05598 | DUF772 | 0.65 |
PF00383 | dCMP_cyt_deam_1 | 0.65 |
PF03050 | DDE_Tnp_IS66 | 0.65 |
PF05258 | DciA | 0.65 |
PF14659 | Phage_int_SAM_3 | 0.65 |
PF00027 | cNMP_binding | 0.65 |
PF00486 | Trans_reg_C | 0.65 |
PF09860 | DUF2087 | 0.65 |
PF13247 | Fer4_11 | 0.65 |
PF01609 | DDE_Tnp_1 | 0.65 |
PF00665 | rve | 0.65 |
PF04986 | Y2_Tnp | 0.65 |
PF13177 | DNA_pol3_delta2 | 0.65 |
PF05489 | Phage_tail_X | 0.65 |
PF02368 | Big_2 | 0.65 |
PF08450 | SGL | 0.65 |
PF00211 | Guanylate_cyc | 0.65 |
PF13377 | Peripla_BP_3 | 0.65 |
PF12146 | Hydrolase_4 | 0.65 |
PF02777 | Sod_Fe_C | 0.65 |
PF06348 | DUF1059 | 0.65 |
PF01027 | Bax1-I | 0.65 |
PF08681 | DUF1778 | 0.65 |
PF07676 | PD40 | 0.65 |
PF13751 | DDE_Tnp_1_6 | 0.65 |
PF13511 | DUF4124 | 0.65 |
PF08240 | ADH_N | 0.65 |
PF05973 | Gp49 | 0.65 |
PF06779 | MFS_4 | 0.65 |
PF00171 | Aldedh | 0.65 |
PF13193 | AMP-binding_C | 0.65 |
PF01527 | HTH_Tnp_1 | 0.65 |
PF01425 | Amidase | 0.65 |
PF03466 | LysR_substrate | 0.65 |
PF01464 | SLT | 0.65 |
PF00702 | Hydrolase | 0.65 |
COG ID | Name | Functional Category | % Frequency in 155 Family Scaffolds |
---|---|---|---|
COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 3.87 |
COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 1.29 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 1.29 |
COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 1.29 |
COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 1.29 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.65 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.65 |
COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.65 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.65 |
COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.65 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.65 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.65 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.65 |
COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.65 |
COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.65 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.65 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.65 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.65 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.65 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.65 |
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.65 |
COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.65 |
COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.65 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.65 |
COG4453 | Uncharacterized conserved protein, DUF1778 family | Function unknown [S] | 0.65 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.65 |
COG5004 | P2-like prophage tail protein X | Mobilome: prophages, transposons [X] | 0.65 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.65 |
COG5512 | Predicted nucleic acid-binding protein, contains Zn-ribbon domain (includes truncated derivatives) | General function prediction only [R] | 0.65 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 61.94 % |
Unclassified | root | N/A | 38.06 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000558|Draft_11730333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1121 | Open in IMG/M |
3300001213|JGIcombinedJ13530_102116599 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300001592|Draft_10017556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5737 | Open in IMG/M |
3300004048|Ga0055494_10013713 | Not Available | 1229 | Open in IMG/M |
3300005565|Ga0068885_1489202 | Not Available | 769 | Open in IMG/M |
3300005656|Ga0073902_10230445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 832 | Open in IMG/M |
3300005656|Ga0073902_10293633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 719 | Open in IMG/M |
3300005833|Ga0074472_10734774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis | 1972 | Open in IMG/M |
3300005833|Ga0074472_11151951 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
3300005940|Ga0073913_10021180 | Not Available | 939 | Open in IMG/M |
3300005982|Ga0075156_10048021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2479 | Open in IMG/M |
3300005986|Ga0075152_10012610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5488 | Open in IMG/M |
3300005987|Ga0075158_10340187 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 847 | Open in IMG/M |
3300006056|Ga0075163_10166911 | All Organisms → cellular organisms → Bacteria | 2594 | Open in IMG/M |
3300006930|Ga0079303_10102139 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
3300007202|Ga0103274_1115025 | Not Available | 1081 | Open in IMG/M |
3300007521|Ga0105044_10186020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 2128 | Open in IMG/M |
3300007521|Ga0105044_11298398 | Not Available | 533 | Open in IMG/M |
3300009075|Ga0105090_10006490 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6829 | Open in IMG/M |
3300009075|Ga0105090_10163999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1384 | Open in IMG/M |
3300009075|Ga0105090_10242961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Spongiibacteraceae → Spongiibacter → unclassified Spongiibacter → Spongiibacter sp. IMCC21906 | 1109 | Open in IMG/M |
3300009075|Ga0105090_10320752 | Not Available | 948 | Open in IMG/M |
3300009075|Ga0105090_10350553 | Not Available | 902 | Open in IMG/M |
3300009075|Ga0105090_10431418 | Not Available | 802 | Open in IMG/M |
3300009078|Ga0105106_10083393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2352 | Open in IMG/M |
3300009078|Ga0105106_10153003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1693 | Open in IMG/M |
3300009111|Ga0115026_11472214 | Not Available | 566 | Open in IMG/M |
3300009131|Ga0115027_11286259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 589 | Open in IMG/M |
3300009166|Ga0105100_10037353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2818 | Open in IMG/M |
3300009167|Ga0113563_11552121 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300009167|Ga0113563_12416738 | Not Available | 633 | Open in IMG/M |
3300009167|Ga0113563_12611589 | Not Available | 610 | Open in IMG/M |
3300009169|Ga0105097_10861642 | Not Available | 519 | Open in IMG/M |
3300009170|Ga0105096_10040406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Thiomonas → unclassified Thiomonas → Thiomonas sp. | 2293 | Open in IMG/M |
3300009170|Ga0105096_10107795 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
3300009170|Ga0105096_10144425 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
3300009170|Ga0105096_10646619 | Not Available | 558 | Open in IMG/M |
3300009171|Ga0105101_10456052 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300009430|Ga0114938_1005847 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6418 | Open in IMG/M |
3300009455|Ga0114939_10194120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 859 | Open in IMG/M |
3300009509|Ga0123573_10244779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1753 | Open in IMG/M |
3300009648|Ga0116175_1241456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium | 594 | Open in IMG/M |
3300009654|Ga0116167_1011680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4946 | Open in IMG/M |
3300009668|Ga0116180_1028046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 3021 | Open in IMG/M |
3300009696|Ga0116177_10000416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 31488 | Open in IMG/M |
3300009771|Ga0116155_10049900 | All Organisms → cellular organisms → Bacteria | 2019 | Open in IMG/M |
3300009782|Ga0116157_10143948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1362 | Open in IMG/M |
3300009782|Ga0116157_10182347 | Not Available | 1171 | Open in IMG/M |
3300009870|Ga0131092_10004129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 32578 | Open in IMG/M |
3300009873|Ga0131077_11731951 | Not Available | 507 | Open in IMG/M |
3300010334|Ga0136644_10307448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. | 917 | Open in IMG/M |
3300010343|Ga0074044_10868198 | Not Available | 590 | Open in IMG/M |
3300010345|Ga0116253_10872312 | Not Available | 530 | Open in IMG/M |
3300010345|Ga0116253_10959434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium | 500 | Open in IMG/M |
3300010351|Ga0116248_10221942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1525 | Open in IMG/M |
3300010355|Ga0116242_10588571 | Not Available | 1004 | Open in IMG/M |
3300010357|Ga0116249_11275007 | Not Available | 658 | Open in IMG/M |
3300010357|Ga0116249_11956452 | Not Available | 514 | Open in IMG/M |
3300010412|Ga0136852_10183762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2099 | Open in IMG/M |
3300012533|Ga0138256_10129384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Leptothrix → Leptothrix cholodnii | 2356 | Open in IMG/M |
3300012931|Ga0153915_10216420 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
3300012956|Ga0154020_10064795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3720 | Open in IMG/M |
3300014305|Ga0075349_1089114 | Not Available | 670 | Open in IMG/M |
3300014312|Ga0075345_1090642 | Not Available | 680 | Open in IMG/M |
3300014317|Ga0075343_1082023 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300014319|Ga0075348_1028699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1198 | Open in IMG/M |
3300015240|Ga0182876_10000655 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2481 | Open in IMG/M |
3300022214|Ga0224505_10235571 | Not Available | 697 | Open in IMG/M |
3300023174|Ga0214921_10145898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium 4572_19 | 1622 | Open in IMG/M |
3300025106|Ga0209398_1007685 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3815 | Open in IMG/M |
3300025130|Ga0209594_1135439 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300025130|Ga0209594_1156786 | Not Available | 674 | Open in IMG/M |
3300025866|Ga0208822_1219879 | Not Available | 677 | Open in IMG/M |
3300025950|Ga0210134_1002873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 2576 | Open in IMG/M |
3300026072|Ga0208292_1056121 | Not Available | 517 | Open in IMG/M |
3300026485|Ga0256805_1050886 | Not Available | 547 | Open in IMG/M |
3300027683|Ga0209392_1003568 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4369 | Open in IMG/M |
3300027683|Ga0209392_1252974 | Not Available | 524 | Open in IMG/M |
3300027705|Ga0209063_1099857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1030 | Open in IMG/M |
3300027715|Ga0208665_10152112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 724 | Open in IMG/M |
3300027721|Ga0209492_1034522 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
3300027723|Ga0209703_1126680 | Not Available | 969 | Open in IMG/M |
3300027739|Ga0209575_10309323 | Not Available | 544 | Open in IMG/M |
3300027781|Ga0209175_10439538 | Not Available | 541 | Open in IMG/M |
3300027823|Ga0209490_10068581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2688 | Open in IMG/M |
3300027885|Ga0209450_10001838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 10699 | Open in IMG/M |
3300027885|Ga0209450_10047707 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2632 | Open in IMG/M |
3300027885|Ga0209450_10065011 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2308 | Open in IMG/M |
3300027885|Ga0209450_10327704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1110 | Open in IMG/M |
3300027885|Ga0209450_10369679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1043 | Open in IMG/M |
3300027890|Ga0209496_10060666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquincola → Aquincola tertiaricarbonis | 1481 | Open in IMG/M |
3300027897|Ga0209254_10001829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 19195 | Open in IMG/M |
3300027897|Ga0209254_10045713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3844 | Open in IMG/M |
3300027897|Ga0209254_10068469 | All Organisms → cellular organisms → Bacteria | 3043 | Open in IMG/M |
3300027897|Ga0209254_10097856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pleurocapsales → Xenococcaceae → Xenococcus → unclassified Xenococcus → Xenococcus sp. PCC 7305 | 2467 | Open in IMG/M |
3300027897|Ga0209254_10102293 | All Organisms → cellular organisms → Bacteria | 2402 | Open in IMG/M |
3300027897|Ga0209254_10105938 | All Organisms → cellular organisms → Bacteria | 2353 | Open in IMG/M |
3300027897|Ga0209254_10123503 | Not Available | 2147 | Open in IMG/M |
3300027897|Ga0209254_10180519 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1703 | Open in IMG/M |
3300027897|Ga0209254_10304593 | Not Available | 1218 | Open in IMG/M |
3300027897|Ga0209254_10306489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1213 | Open in IMG/M |
3300027897|Ga0209254_10484488 | Not Available | 897 | Open in IMG/M |
3300027897|Ga0209254_10535275 | Not Available | 839 | Open in IMG/M |
3300027897|Ga0209254_10540767 | Not Available | 834 | Open in IMG/M |
3300027897|Ga0209254_10579349 | Not Available | 795 | Open in IMG/M |
3300027897|Ga0209254_10651299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 734 | Open in IMG/M |
3300027897|Ga0209254_10894192 | Not Available | 591 | Open in IMG/M |
3300027897|Ga0209254_10957315 | Not Available | 562 | Open in IMG/M |
3300027900|Ga0209253_10167835 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1768 | Open in IMG/M |
3300027900|Ga0209253_10169146 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1761 | Open in IMG/M |
3300027900|Ga0209253_10252836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1386 | Open in IMG/M |
3300027900|Ga0209253_10269684 | Not Available | 1332 | Open in IMG/M |
3300027900|Ga0209253_10433364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas → Pseudoxanthomonas winnipegensis | 993 | Open in IMG/M |
3300027900|Ga0209253_10853932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → Ideonella sakaiensis | 642 | Open in IMG/M |
3300027900|Ga0209253_10876644 | Not Available | 631 | Open in IMG/M |
3300027902|Ga0209048_10017752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 6231 | Open in IMG/M |
3300027902|Ga0209048_10064207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2936 | Open in IMG/M |
3300027902|Ga0209048_10217903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1378 | Open in IMG/M |
3300027902|Ga0209048_11001523 | Not Available | 534 | Open in IMG/M |
3300027975|Ga0209391_10021664 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3272 | Open in IMG/M |
3300027975|Ga0209391_10039736 | Not Available | 2280 | Open in IMG/M |
3300027975|Ga0209391_10128195 | Not Available | 1102 | Open in IMG/M |
3300027975|Ga0209391_10203837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. OV329 | 820 | Open in IMG/M |
3300027975|Ga0209391_10224251 | Not Available | 771 | Open in IMG/M |
3300027975|Ga0209391_10273215 | Not Available | 678 | Open in IMG/M |
3300028108|Ga0256305_1093201 | Not Available | 730 | Open in IMG/M |
3300028647|Ga0272412_1414989 | Not Available | 531 | Open in IMG/M |
3300028804|Ga0268298_10073647 | Not Available | 2120 | Open in IMG/M |
3300031784|Ga0315899_10776498 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 880 | Open in IMG/M |
3300031873|Ga0315297_11395006 | Not Available | 569 | Open in IMG/M |
3300032156|Ga0315295_10193093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. PS1(2021) | 2042 | Open in IMG/M |
3300032164|Ga0315283_10401726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1490 | Open in IMG/M |
3300032256|Ga0315271_10070226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2589 | Open in IMG/M |
3300032397|Ga0315287_10846534 | Not Available | 1073 | Open in IMG/M |
3300032397|Ga0315287_12547345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 548 | Open in IMG/M |
3300032456|Ga0335394_10260760 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1602 | Open in IMG/M |
3300032516|Ga0315273_11098311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 1010 | Open in IMG/M |
3300033413|Ga0316603_10183443 | Not Available | 1766 | Open in IMG/M |
3300033413|Ga0316603_10301950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium GJ-E10 | 1414 | Open in IMG/M |
3300033414|Ga0316619_12107497 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300033416|Ga0316622_100038559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4380 | Open in IMG/M |
3300033416|Ga0316622_102237651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11 | 633 | Open in IMG/M |
3300033419|Ga0316601_102109941 | Not Available | 568 | Open in IMG/M |
3300033483|Ga0316629_10775281 | Not Available | 734 | Open in IMG/M |
3300033487|Ga0316630_11046434 | Not Available | 716 | Open in IMG/M |
3300033488|Ga0316621_10820327 | Not Available | 682 | Open in IMG/M |
3300033557|Ga0316617_100644631 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 991 | Open in IMG/M |
3300034018|Ga0334985_0354575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales | 896 | Open in IMG/M |
3300034066|Ga0335019_0046043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2992 | Open in IMG/M |
3300034108|Ga0335050_0007021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7627 | Open in IMG/M |
3300034125|Ga0370484_0125126 | Not Available | 681 | Open in IMG/M |
3300034283|Ga0335007_0147582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1686 | Open in IMG/M |
3300034284|Ga0335013_0154394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1558 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 21.29% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 16.13% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 9.68% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.45% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.52% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 3.23% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.23% |
Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 3.23% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.87% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 2.58% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.94% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.94% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.94% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.94% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 1.29% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.29% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.29% |
Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 1.29% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.29% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 1.29% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.65% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.65% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.65% |
Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Microbial Mat | 0.65% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.65% |
Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.65% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.65% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.65% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.65% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.65% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.65% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.65% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.65% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.65% |
Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.65% |
Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.65% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001592 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April2: | Engineered | Open in IMG/M |
3300004048 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 | Environmental | Open in IMG/M |
3300005565 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005656 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-Kit | Engineered | Open in IMG/M |
3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
3300005982 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA | Engineered | Open in IMG/M |
3300005986 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 DNA | Engineered | Open in IMG/M |
3300005987 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNA | Engineered | Open in IMG/M |
3300006056 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA | Engineered | Open in IMG/M |
3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
3300007202 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site C) 9 sequencing projects | Environmental | Open in IMG/M |
3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009430 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring | Environmental | Open in IMG/M |
3300009455 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring | Environmental | Open in IMG/M |
3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
3300009648 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC125_MetaG | Engineered | Open in IMG/M |
3300009654 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR3_MetaG | Engineered | Open in IMG/M |
3300009668 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC073_MetaG | Engineered | Open in IMG/M |
3300009696 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG | Engineered | Open in IMG/M |
3300009771 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG | Engineered | Open in IMG/M |
3300009782 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG | Engineered | Open in IMG/M |
3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010345 | AD_JPNAca2 | Engineered | Open in IMG/M |
3300010351 | AD_USPNca | Engineered | Open in IMG/M |
3300010355 | AD_USDVca | Engineered | Open in IMG/M |
3300010357 | AD_USSTca | Engineered | Open in IMG/M |
3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
3300014305 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 | Environmental | Open in IMG/M |
3300014312 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 | Environmental | Open in IMG/M |
3300014317 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300014319 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 | Environmental | Open in IMG/M |
3300015240 | Freshwater microbial mat microbial communities from Canadian High Arctic Lake 9K, Kuujjuarapik, Canada - Sample L9Kc | Environmental | Open in IMG/M |
3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300025106 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring (SPAdes) | Environmental | Open in IMG/M |
3300025130 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring (SPAdes) | Environmental | Open in IMG/M |
3300025866 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025950 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026072 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026485 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 F6 | Environmental | Open in IMG/M |
3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027705 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-Kit (SPAdes) | Engineered | Open in IMG/M |
3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027723 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027739 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
3300027781 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes) | Engineered | Open in IMG/M |
3300027823 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 (SPAdes) | Environmental | Open in IMG/M |
3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300027975 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300028108 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028647 | Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300028804 | Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt | Engineered | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032456 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (spades assembly) | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Draft_117303333 | 3300000558 | Hydrocarbon Resource Environments | MLVLSTLTAKMTVKVCEAAAGALQINSLKSSLMIEWE* |
JGIcombinedJ13530_1021165993 | 3300001213 | Wetland | MLVLRTLTAKMTVKVCEAAAGASRINSLEGSLMIEWE* |
Draft_100175566 | 3300001592 | Hydrocarbon Resource Environments | MLVPDKLTVRMTVKTREAAASFLQINRLESSLMIEWE* |
Ga0055494_100137132 | 3300004048 | Natural And Restored Wetlands | PAPMLVLRTLTAKVTVNFCGAASGALQSNSLEGSLMIEWE* |
Ga0068885_14892021 | 3300005565 | Freshwater Lake | MLVLRTLTVNMTVNFCRAASGALQINSLEGSLMIEWE* |
Ga0073902_102304452 | 3300005656 | Activated Sludge | MLVPDTLTVKMTVKIERATCKHLEINSLEGSLMIEWE* |
Ga0073902_102936331 | 3300005656 | Activated Sludge | MLVLDRLTVNMTVKVCGAAAIALRINSLEGSLMIEWE* |
Ga0074472_107347742 | 3300005833 | Sediment (Intertidal) | MLVPDRLTAKVTAKICEAASSALPINGLVRSLTIEWEEGPQW* |
Ga0074472_111519513 | 3300005833 | Sediment (Intertidal) | MLVLSTLKVEMTVKVCEAAASTLQINSLEGSLMIEWE* |
Ga0073913_100211802 | 3300005940 | Sand | MLVPSTLTVKVTAKVFEEAARNLQINNLEGWLMIERE* |
Ga0075156_100480212 | 3300005982 | Wastewater Effluent | MLVPDTLTVKMTVKIERATCKHFEINSLEGSLMIEWE* |
Ga0075152_100126105 | 3300005986 | Wastewater Effluent | MLVPDTLTVKMTVKIERATCKHFEINSLEGPLMIEWAK* |
Ga0075158_103401872 | 3300005987 | Wastewater Effluent | MLVPDTLTVKMTVKIERATCKHFEINSLEGPLMIEWE* |
Ga0075163_101669112 | 3300006056 | Wastewater Effluent | MLVLRTLTVKMTVNFGGAASGALQINSLEGSLMIEWE* |
Ga0079303_101021393 | 3300006930 | Deep Subsurface | MLVPDRLTVKVTVKICKAAPGALPINNLEGSLMIEWE* |
Ga0103274_11150254 | 3300007202 | Freshwater Lake | MLVLGRLTVKMTVKVCGAATSDLQINSLEGSLMIEWE* |
Ga0105044_101860202 | 3300007521 | Freshwater | MLVPDTLTVKMAVKIDRTTWNHFEINSLDGSLMIEWE* |
Ga0105044_112983981 | 3300007521 | Freshwater | MLVHGTLTVKMTVKVDQETWNHFQINSLERSLTIEWE |
Ga0105090_100064901 | 3300009075 | Freshwater Sediment | MLVPDRLTVKMTVKICEAASNALPINSLEGSLMIEWE* |
Ga0105090_101639994 | 3300009075 | Freshwater Sediment | MLVPDRLTVRMTVKIREAVASTLQVNDLDGSLMIEWE* |
Ga0105090_102429611 | 3300009075 | Freshwater Sediment | MLVPSASTVKVTVKVFEEAARTLQSNNLEGSLMIEWE* |
Ga0105090_103207523 | 3300009075 | Freshwater Sediment | MLVSDRLTVKMTVKIFEAAASALRINSLEGSLMIEWE* |
Ga0105090_103505531 | 3300009075 | Freshwater Sediment | MLVPDTLTVKVTVKIFEAAASALQINGLEGSLMIEWE* |
Ga0105090_104314182 | 3300009075 | Freshwater Sediment | MLVPGTLTVNVTAKVLEAAASTLQINSLEGSLMIEWE* |
Ga0105106_100833933 | 3300009078 | Freshwater Sediment | MLVPSTLTVKVTVKVFEEAARTLQINNGEGSLMIEWE* |
Ga0105106_101530032 | 3300009078 | Freshwater Sediment | MLMPDELTVKVTVKGASPLMDALQINSLESSLMIEWE* |
Ga0115026_114722141 | 3300009111 | Wetland | MLMPDGLTVNVTVKIWEAAATALQLNSLEGSLMSEWE* |
Ga0115027_112862592 | 3300009131 | Wetland | MLVPGTLTVIVTVKVFEAAASALQINNLEGSLMIEWE* |
Ga0105100_100373533 | 3300009166 | Freshwater Sediment | MLVPSTLTVKVTVKVFEEAARTLQINNVEGSLMIEWE* |
Ga0113563_115521211 | 3300009167 | Freshwater Wetlands | APMLVLDRFTVKMTVEVCEATSSALLINSLERSLMIEWE* |
Ga0113563_124167382 | 3300009167 | Freshwater Wetlands | LVPGTLTVNVTVRICEAASGALPINNLEGSLMIEWE* |
Ga0113563_126115892 | 3300009167 | Freshwater Wetlands | MLVPAGLTVKVTVKTLAPCSDARQINSLEGSLMIEWE* |
Ga0105097_108616421 | 3300009169 | Freshwater Sediment | MLVPSTLTVKVTVKVFEEAARTLQINNLEGSLMIEWE* |
Ga0105096_100404063 | 3300009170 | Freshwater Sediment | LGRLTVKVTVKVRVAVESAMKINGLKRSLMIEWE* |
Ga0105096_101077952 | 3300009170 | Freshwater Sediment | MLVPDRLTKKMTVKIFEAAASALRTNSLEGSSMIEWE* |
Ga0105096_101444251 | 3300009170 | Freshwater Sediment | PAPMLVPSASTVKVTVKVFEEAARTLQSNNLEGSLMIEWE* |
Ga0105096_106466191 | 3300009170 | Freshwater Sediment | MLVPSTLTVKVTVEVFEEAAGTLQINNLEGSLMIEWE* |
Ga0105101_104560522 | 3300009171 | Freshwater Sediment | MLVLRTLTVKTTVKRRDTAQSPMQINGLEASLMIEWE* |
Ga0114938_10058472 | 3300009430 | Groundwater | MLVPGTLTVNVTVKVFEAAASTLQINNLEVSLMIEWE* |
Ga0114939_101941201 | 3300009455 | Groundwater | MLVLRTLTVKLTVNFCDAAASPLSINNLERSLMIEWE* |
Ga0123573_102447794 | 3300009509 | Mangrove Sediment | MLMLDGLTAKVTVKFCETAASPLSINDLERSLMIEWE* |
Ga0116175_12414561 | 3300009648 | Anaerobic Digestor Sludge | MLVPDTLTVKMTVKVDHATWNHFEINSLDGSLMIEWE* |
Ga0116167_10116805 | 3300009654 | Anaerobic Digestor Sludge | MLVPNTLTVKMTVKIARATCKHFEINSLEGSLMIEWE* |
Ga0116180_10280462 | 3300009668 | Anaerobic Digestor Sludge | MLVPDTLTVKMTVKIDCAAWNHLEINSLDGSLMIEWE* |
Ga0116177_1000041632 | 3300009696 | Anaerobic Digestor Sludge | MLVRDTLTVKMTVKIERATCKHFEINSLEGSLMIEWE* |
Ga0116155_100499003 | 3300009771 | Anaerobic Digestor Sludge | MLVPGTLTVNVTVKAFEAAASTLQINNLEGSLMIEWE* |
Ga0116157_101439482 | 3300009782 | Anaerobic Digestor Sludge | MLVPDTLTVKMTVKIDRTTWNHFEINSLDCSLMIEWE* |
Ga0116157_101823472 | 3300009782 | Anaerobic Digestor Sludge | MLVPDTLTVKMTVKIEISTWNHFEINSLEGLLMIEWE* |
Ga0131092_1000412933 | 3300009870 | Activated Sludge | MLVLRALTVKMTVNFYVAASGVLQINSLEGSLMIEWE* |
Ga0131077_117319511 | 3300009873 | Wastewater | MLVLRTLTVKMTVKVCEAAASALQINSLEGSLMIEWE* |
Ga0136644_103074483 | 3300010334 | Freshwater Lake | LRTLTVKMTVNFRGAASGALQINSLEGSLMIEWE* |
Ga0074044_108681981 | 3300010343 | Bog Forest Soil | MLMRDRLTVRMTVKICMASASALRINSLEGSLMIEWE* |
Ga0116253_108723122 | 3300010345 | Anaerobic Digestor Sludge | RKPAPMLVPDTLTVKMTVKIDRSTWKHFEINSLEGSLMIEWE* |
Ga0116253_109594341 | 3300010345 | Anaerobic Digestor Sludge | MLVPDTLTVKMTVKIDRSTWKHFEINSLEGSLMIEWE* |
Ga0116248_102219422 | 3300010351 | Anaerobic Digestor Sludge | MLVPDTLTVKMTVKIERATCKHFEINSLEGLLMIEWE* |
Ga0116242_105885712 | 3300010355 | Anaerobic Digestor Sludge | MLVPDTLTVKMTVKSYRSIWKHFEINSLEGSLMIEWES* |
Ga0116249_112750072 | 3300010357 | Anaerobic Digestor Sludge | PAPMLVLRTLTVKMTVKVCGAAESALRINSLEGSLMIEWE* |
Ga0116249_113725722 | 3300010357 | Anaerobic Digestor Sludge | KPAPMLVPGTLTVKMTVNIREAVSRTIQINSLEGLLMIEWE* |
Ga0116249_119564521 | 3300010357 | Anaerobic Digestor Sludge | RKPAPMLVLRTLTVKMTVKVCGAAESALRINSLEGSLMIEWE* |
Ga0136852_101837622 | 3300010412 | Mangrove Sediment | MLVLRTLTVKLTVKGCGTVASALRINSLEGSLMIEWE* |
Ga0138256_101293843 | 3300012533 | Active Sludge | MLVPDTLTVKMTVKSERATCKHFEINSLEGSLMIEWE* |
Ga0153915_102164202 | 3300012931 | Freshwater Wetlands | MLVPDRLTVKMTVKIRAAAASTLQINDVEGSLMIEWE* |
Ga0154020_100647955 | 3300012956 | Active Sludge | MLVLRTLTVKMTVNFCGSTSGALQINSLEGSLMIEWE* |
Ga0075349_10891141 | 3300014305 | Natural And Restored Wetlands | MLVLRTLTAKVTVNFCGAASGALQSNSLEGSLMIECE* |
Ga0075345_10906422 | 3300014312 | Natural And Restored Wetlands | MLALRTLTVKVTVNFGGAASGALQINSLEGSLMIEWE* |
Ga0075343_10820231 | 3300014317 | Natural And Restored Wetlands | MLVPDRLTVKMTVEICEGVSGALQINSLEGSLMIEWE* |
Ga0075348_10286993 | 3300014319 | Natural And Restored Wetlands | MLVPDRLTVKMTVKVCDAAVSTLEINGLESSLMIEW |
Ga0182876_100006553 | 3300015240 | Microbial Mat | MLVPDRLTVIVTVNICDAAATALQINGSEGSLMIEWE* |
Ga0224505_102355711 | 3300022214 | Sediment | KPAPMLAPDRLTVRMSVKVCEAASIPLRINSLEGSLMIEWE |
Ga0214921_101458983 | 3300023174 | Freshwater | MLVPDTLTVKMTVKSELATCKHFEINSLEGSLMIEWE |
Ga0209398_10076852 | 3300025106 | Groundwater | MLVPGTLTVNVTVKVFEAAASTLQINNLEVSLMIEWE |
Ga0209594_11354392 | 3300025130 | Groundwater | KPAPMLVPGTLTVNVTVKVFEAAASTLQINNLEVSLMIEWE |
Ga0209594_11567862 | 3300025130 | Groundwater | MLVPGTLTVNVTVRVFEAASSTLQINNLEGSLMIEWE |
Ga0208822_12198792 | 3300025866 | Anaerobic Digestor Sludge | RKPAPMLVPDTLTVKMTVKIERATCKHFEINSLEGSLMIEWE |
Ga0210134_10028733 | 3300025950 | Natural And Restored Wetlands | LVPEMLTVKMTVKVCEAVSGALQINSLEGSLMIEWE |
Ga0208292_10561211 | 3300026072 | Natural And Restored Wetlands | MLALRTLTVKMTVNFGGAASGALQINSLEGSLMIEWE |
Ga0256805_10508861 | 3300026485 | Sediment | MLVPDRLTVKMTVKVCGAAASALRINSLEGSLTIEWVAFEIYRGL |
Ga0209392_10035685 | 3300027683 | Freshwater Sediment | MLVPSTLTVKVTVKVFEEAARTLQINNGEGSLMIEWE |
Ga0209392_12529741 | 3300027683 | Freshwater Sediment | MLVPDRLTKKMTVKIFEAAASALRTNSLEGSSMIEWE |
Ga0209063_10998572 | 3300027705 | Activated Sludge | MLVLDRLTVNMTVKVCGAAAIALRINSLEGSLMIEWE |
Ga0208665_101521122 | 3300027715 | Deep Subsurface | MLVPDRLTVKVTVKICKAAPGALPINNLEGSLMIEWE |
Ga0209492_10345223 | 3300027721 | Freshwater Sediment | MLVPSTLTVKVTVKVFEEAARTLQINNLEGSLMIEWE |
Ga0209703_11266801 | 3300027723 | Freshwater Sediment | MLVPSTLTVKVTVKVFEEAARTLQINNVEGSLMIEWE |
Ga0209575_103093232 | 3300027739 | Freshwater | MLDLDGLTVKVTVKICEAEASAMKINSLEGSLMIEWE |
Ga0209175_104395381 | 3300027781 | Wastewater Effluent | MLVLRTLTVKMTVNFGGAASGALQINSLEGSLMIEWE |
Ga0209490_100685812 | 3300027823 | Freshwater | MLVPDTLTAKMTVKVDQETWNHFQINSLERSLTIEWE |
Ga0209262_100501362 | 3300027841 | Freshwater | MRVLRTLTAKVTVKTLVPCSDATQINSLEGSLMIEWE |
Ga0209450_100018383 | 3300027885 | Freshwater Lake Sediment | MLVPDKLTVIVTVKLRDTAWSAMQINGLEGSLMIEWE |
Ga0209450_100477072 | 3300027885 | Freshwater Lake Sediment | MLALRTLTVKMTVNFGGAASGALQINSLEGSWMIEWE |
Ga0209450_100650113 | 3300027885 | Freshwater Lake Sediment | MLVLCALTVKMTVKICGAASNHLRINSLEGSLMIE |
Ga0209450_103277042 | 3300027885 | Freshwater Lake Sediment | MLMPDGLTARMTVKLSHAAQSAMQINGLDGSLMIEWE |
Ga0209450_103696792 | 3300027885 | Freshwater Lake Sediment | MLVLSTLTVKMTVKVCEAAANTLRINSLEGSLMIEWE |
Ga0209496_100606661 | 3300027890 | Wetland | MLVPDTLTVKVTVKIFEAAASALQINGLEGSLMIEWE |
Ga0209254_100018293 | 3300027897 | Freshwater Lake Sediment | MLDLDRLTVKVTVRICEAEAGTLQINRLRGSLMFEWE |
Ga0209254_100457135 | 3300027897 | Freshwater Lake Sediment | MRAPDRLTVKMTVKIFEAASSALPINSLERSLMIEWE |
Ga0209254_100684692 | 3300027897 | Freshwater Lake Sediment | MLVPDRLTVKMTAKICEAAARSIRINSLEGSLMIEWE |
Ga0209254_100978563 | 3300027897 | Freshwater Lake Sediment | MLVLSTLTAKMTVKVCVAAASTLQINSVEGSLMIEWE |
Ga0209254_101022933 | 3300027897 | Freshwater Lake Sediment | MLVPDRLPAKMTAKICGAAASTLLINSLEGSLMIEWE |
Ga0209254_101059382 | 3300027897 | Freshwater Lake Sediment | MLVLHRLTVKMTVKICETEAIDLRINILESPLMIEWE |
Ga0209254_101235032 | 3300027897 | Freshwater Lake Sediment | RIVRKPAPMLVPDRLTVKVTVKIFEAAASSLQINNLECLLMIE |
Ga0209254_101805192 | 3300027897 | Freshwater Lake Sediment | MLDLDGLTVKVTVKICEAEARAMEINSLEGSLMIEWE |
Ga0209254_103045931 | 3300027897 | Freshwater Lake Sediment | MLVLRTSTAKMTANACGAAAGALQINSLEGSLMIEWE |
Ga0209254_103064891 | 3300027897 | Freshwater Lake Sediment | MLVLSTLTVEMTVKVCEAAVKTLRINSLERSLMIEWE |
Ga0209254_104844881 | 3300027897 | Freshwater Lake Sediment | MLVLGSLTVKVTAEVCKAAVSTLRINSLEGSLMIEWE |
Ga0209254_105352751 | 3300027897 | Freshwater Lake Sediment | MLDLVGLTVKVTVKTCEAEASAMQINSFEGSLMIEWE |
Ga0209254_105407672 | 3300027897 | Freshwater Lake Sediment | MLVPDRLTVKVTVKVFEVAAIALQINSLEGSLMIEWE |
Ga0209254_105793492 | 3300027897 | Freshwater Lake Sediment | MLVLDRLTVKVTVTVWGAAAGALQINSLERSLMIEWE |
Ga0209254_106512992 | 3300027897 | Freshwater Lake Sediment | MLMPARLTAKVTVKVCEEAASALQINGLEGLLMIEWE |
Ga0209254_108941921 | 3300027897 | Freshwater Lake Sediment | MLVPGTLTVNVTVKIFGAAASALRINSLEGSLMIEWE |
Ga0209254_109573152 | 3300027897 | Freshwater Lake Sediment | VLVLRTLTVKMTVKVCEATSSALPINSLEGSLMIEWE |
Ga0209253_101678352 | 3300027900 | Freshwater Lake Sediment | MLVPDRLTAKTTVKICEAAASALQINSSEGSSMIEWE |
Ga0209253_101691461 | 3300027900 | Freshwater Lake Sediment | MLVLRTLTVKMTAKSCDEPASALQINSLEGSLMIEWE |
Ga0209253_102528363 | 3300027900 | Freshwater Lake Sediment | MLVPDRLTVKMTVKVCEAAYSAFQINGLERSLMIEWE |
Ga0209253_102696841 | 3300027900 | Freshwater Lake Sediment | MLDLDGLTVKVTVKICEAEASAMQINSLEGSLMIEWE |
Ga0209253_104333642 | 3300027900 | Freshwater Lake Sediment | MLMPHGLTVKVTVKICEAAASALSINSLEGSLMIEWE |
Ga0209253_108539323 | 3300027900 | Freshwater Lake Sediment | IARIPPPMLMPDRLTVIVTVKTCDAALKAMKINDVEGSLMIEWE |
Ga0209253_108766441 | 3300027900 | Freshwater Lake Sediment | MLVLSTLTVKTTVNVCEAAANTLQINSLEGSLMIEWE |
Ga0209048_100177521 | 3300027902 | Freshwater Lake Sediment | MLVLSTLTVKMTVKICEAAASTLQINSLEGSLMIEWE |
Ga0209048_100642074 | 3300027902 | Freshwater Lake Sediment | MLVLDRLTVKMTVKIREAVASTLQINDLDGSLTIEWE |
Ga0209048_102179032 | 3300027902 | Freshwater Lake Sediment | MLVPDRLTVRMTAKIREAVASALQINDLDGSLMIEWE |
Ga0209048_110015231 | 3300027902 | Freshwater Lake Sediment | MLVPDRLTVKVTVKVCVAAASALQINSLEGSLMIEWE |
Ga0209391_100216643 | 3300027975 | Freshwater Sediment | MLVPSTLTVKVTVKVFEEAARTLQINNFEGSLMIEWE |
Ga0209391_100397361 | 3300027975 | Freshwater Sediment | PAPMLVPSTLTVKVTVKVFEEAARTLQINNGEGSLMIEWE |
Ga0209391_101281951 | 3300027975 | Freshwater Sediment | MLVPSASTVKVTVKVFEEAARTLQSNNLEGSLMIEWE |
Ga0209391_102038371 | 3300027975 | Freshwater Sediment | KPAPMLVLRTLTVKMTAKVCEAASSALPINSLERSLMIEWE |
Ga0209391_102242512 | 3300027975 | Freshwater Sediment | MPYGLTARVTVKTCEAAANALRINSVEGSLMIEWE |
Ga0209391_102732152 | 3300027975 | Freshwater Sediment | MLVPEMLTVKMTVKVCEAVSGALQINSLEGSLMIEWE |
Ga0256305_10932013 | 3300028108 | Freshwater | MLVPDTLTVKMTVKIARATCKHFEINSLEGSLMIEWE |
Ga0272412_14149891 | 3300028647 | Activated Sludge | MLVPDTLTVKMTVKIDRATWNHFEINSLGCSLMIEWE |
Ga0268298_100736472 | 3300028804 | Activated Sludge | MLVPDTLTVKMTVKLDRATWKHFEINGLEGSLMIEWE |
Ga0315899_107764982 | 3300031784 | Freshwater | MLVLSTLTVDMTVKVCEAAVKTLRINSLERSLMIEWE |
Ga0315297_113950062 | 3300031873 | Sediment | MLVLRTLTVKVTVNVCAAAASALRINSLEGSLMIEWV |
Ga0315295_101930932 | 3300032156 | Sediment | MLVPDRLTVKMTVKICEAAASALLINSLEGSLMIEWE |
Ga0315283_104017263 | 3300032164 | Sediment | KIARKPAPMLVLRTLTVKVTVNFCRAASGALQINSLEGLLMIEWE |
Ga0315271_100702264 | 3300032256 | Sediment | MSEKVSRLVPDRLTAKMTVRICEAAVSALRINSLEGSLMIEWE |
Ga0315287_108465342 | 3300032397 | Sediment | MLVPGTLTVNVTVKVFEAAASTLQSNNLEGSLMIEWE |
Ga0315287_125473451 | 3300032397 | Sediment | MLVLNRLTVKMTVRIFEAAASALRINSLEGSLMIEW |
Ga0335394_102607602 | 3300032456 | Freshwater | MLVPDTLTVKMAVKIDRTTWNHFEINSLDGSLMIEWE |
Ga0315273_110983111 | 3300032516 | Sediment | EPDRLTVKMTVNGCEASTSALPINDLVGSLMIEWE |
Ga0316603_101834431 | 3300033413 | Soil | MLVPDRLTVKMTVKICDAAASTLNINSLEGSLMIEWE |
Ga0316603_103019501 | 3300033413 | Soil | PAPMLVPDRLTVKMTVKVCEAGASTLQINSLEVSLMIEWE |
Ga0316619_121074972 | 3300033414 | Soil | KPAPMLMPHGLTVIVTVTIYDAVTSALQINSLEGSWMIAWE |
Ga0316622_1000385592 | 3300033416 | Soil | MLVPAGLTVKVTVKTLAPCSDARQINSLEGSLMIEWE |
Ga0316622_1022376511 | 3300033416 | Soil | MLVLRTLTVKMTVKVCEAVVSTLKINSLEGSLMIEWE |
Ga0316601_1021099411 | 3300033419 | Soil | MLVPERLTVKVTVKRDDAAQRPMQINGLEGSLMIEWE |
Ga0316629_107752811 | 3300033483 | Soil | APMLVLRTLTVKMTVKVCEEAANTLRINSLEGSLMIEWE |
Ga0316630_110464341 | 3300033487 | Soil | MLTPDRLTVKATVKIWGVAAGALQINSLEGSLVIEWE |
Ga0316621_108203272 | 3300033488 | Soil | MLVPDRLTVKMSVRMVEAAASASQINNLEDSLMIEWE |
Ga0316617_1006446313 | 3300033557 | Soil | MLVPDRLTVEVTVKICKAAPGALPINSLEGSLMIEWE |
Ga0334985_0354575_224_337 | 3300034018 | Freshwater | MLVLSTLTVKMTVNVCEAAANTLQINSLEGSLMIEWE |
Ga0335019_0046043_440_553 | 3300034066 | Freshwater | MLVLRTLTAKMTVNFCRAASGALQINSLEGSLMIEWE |
Ga0335050_0007021_7512_7625 | 3300034108 | Freshwater | MLVPDRLTVKVTEKVCVAAASALRIKSLEISLTIEWE |
Ga0370484_0125126_387_500 | 3300034125 | Untreated Peat Soil | MLVPDRLTVKVTVDIFDAAVLALQINSLEGSLMIEWE |
Ga0335007_0147582_1562_1684 | 3300034283 | Freshwater | PAPMLVPDRLTVKVTVKVCVAAASALRIKSLEISLTIEWE |
Ga0335013_0154394_3_125 | 3300034284 | Freshwater | PAPMLVPDRLTVKVTVKVCVAAASALRIKRLEISLTIEWE |
⦗Top⦘ |