


| Basic Information | |
|---|---|
| Family ID | F043685 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 156 |
| Average Sequence Length | 48 residues |
| Representative Sequence | EFQRLRLQYTRLEQPGLHENQFFLQWTVILGSHVHSFRDR |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 156 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.44 % |
| % of genes from short scaffolds (< 2000 bps) | 98.08 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.359 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (18.590 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.410 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.077 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 156 Family Scaffolds |
|---|---|---|
| PF01297 | ZnuA | 87.82 |
| PF00005 | ABC_tran | 8.33 |
| PF00950 | ABC-3 | 1.92 |
| PF02538 | Hydantoinase_B | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 156 Family Scaffolds |
|---|---|---|---|
| COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 1.92 |
| COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 1.92 |
| COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 1.92 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 1.28 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.36 % |
| Unclassified | root | N/A | 0.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101305702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300001431|F14TB_106849040 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300002560|JGI25383J37093_10079425 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300003992|Ga0055470_10011740 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300003994|Ga0055435_10210059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300004463|Ga0063356_104208134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
| 3300004479|Ga0062595_100961971 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300004479|Ga0062595_102114625 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005176|Ga0066679_10570429 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300005180|Ga0066685_10208991 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300005184|Ga0066671_10318556 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300005186|Ga0066676_10206610 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300005187|Ga0066675_10414666 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300005187|Ga0066675_11418626 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300005332|Ga0066388_103270716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 828 | Open in IMG/M |
| 3300005332|Ga0066388_103406285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 812 | Open in IMG/M |
| 3300005444|Ga0070694_100423790 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300005447|Ga0066689_10234959 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300005447|Ga0066689_10922079 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300005468|Ga0070707_100729898 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300005471|Ga0070698_100498063 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300005540|Ga0066697_10110070 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1610 | Open in IMG/M |
| 3300005559|Ga0066700_10813094 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 628 | Open in IMG/M |
| 3300005561|Ga0066699_10399741 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300005568|Ga0066703_10091623 | All Organisms → cellular organisms → Bacteria | 1773 | Open in IMG/M |
| 3300005568|Ga0066703_10614313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 632 | Open in IMG/M |
| 3300005587|Ga0066654_10781928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300005615|Ga0070702_101893219 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005764|Ga0066903_108176426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300005985|Ga0081539_10233094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 829 | Open in IMG/M |
| 3300006046|Ga0066652_100985993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 800 | Open in IMG/M |
| 3300006046|Ga0066652_101609920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300006577|Ga0074050_10964002 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300006794|Ga0066658_10912665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300006854|Ga0075425_102137748 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300006903|Ga0075426_10769009 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300006914|Ga0075436_100345420 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300007076|Ga0075435_101532074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300007076|Ga0075435_101638059 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300009012|Ga0066710_101728341 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300009012|Ga0066710_102037015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 848 | Open in IMG/M |
| 3300009012|Ga0066710_102629302 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300009090|Ga0099827_10342081 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300009162|Ga0075423_10624502 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300009177|Ga0105248_12922076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300009177|Ga0105248_13477609 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300010301|Ga0134070_10030096 | All Organisms → cellular organisms → Bacteria | 1793 | Open in IMG/M |
| 3300010303|Ga0134082_10319330 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300010326|Ga0134065_10303842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300010358|Ga0126370_12088335 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300010362|Ga0126377_10526081 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300010366|Ga0126379_12746941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300010371|Ga0134125_12264989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300010379|Ga0136449_103172844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300010398|Ga0126383_11964596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 673 | Open in IMG/M |
| 3300011119|Ga0105246_11252254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 685 | Open in IMG/M |
| 3300012202|Ga0137363_10561017 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300012209|Ga0137379_11456109 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300012211|Ga0137377_10747385 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300012212|Ga0150985_113988661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300012349|Ga0137387_10643203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 768 | Open in IMG/M |
| 3300012532|Ga0137373_10730724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 736 | Open in IMG/M |
| 3300012582|Ga0137358_10488203 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300012582|Ga0137358_11012567 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300012922|Ga0137394_11102583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300012923|Ga0137359_10346205 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300012925|Ga0137419_11887002 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012929|Ga0137404_10802401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 855 | Open in IMG/M |
| 3300012929|Ga0137404_11904846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300012930|Ga0137407_11523614 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300012971|Ga0126369_10612121 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300012971|Ga0126369_12060363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 658 | Open in IMG/M |
| 3300012977|Ga0134087_10260602 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300012977|Ga0134087_10766756 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300014154|Ga0134075_10156793 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300014154|Ga0134075_10381285 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300014297|Ga0075306_1073752 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300014880|Ga0180082_1093264 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300015077|Ga0173483_10473836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300015374|Ga0132255_100689223 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300016319|Ga0182033_10750017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 857 | Open in IMG/M |
| 3300016341|Ga0182035_11501503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300017654|Ga0134069_1033404 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300017656|Ga0134112_10039867 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300017959|Ga0187779_10366819 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300018431|Ga0066655_10294406 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300018431|Ga0066655_11066285 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300018433|Ga0066667_12034771 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300018468|Ga0066662_11003549 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300018468|Ga0066662_11448922 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300019789|Ga0137408_1105082 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300020170|Ga0179594_10008696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2745 | Open in IMG/M |
| 3300021560|Ga0126371_12592967 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300025905|Ga0207685_10141503 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300025918|Ga0207662_10353887 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300025922|Ga0207646_10278752 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300025961|Ga0207712_10368001 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300026118|Ga0207675_101159668 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300026295|Ga0209234_1179821 | Not Available | 738 | Open in IMG/M |
| 3300026296|Ga0209235_1098584 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300026298|Ga0209236_1126687 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300026307|Ga0209469_1124480 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300026315|Ga0209686_1165345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300026323|Ga0209472_1032689 | All Organisms → cellular organisms → Bacteria | 2361 | Open in IMG/M |
| 3300026324|Ga0209470_1057115 | All Organisms → cellular organisms → Bacteria | 1859 | Open in IMG/M |
| 3300026329|Ga0209375_1059931 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
| 3300026342|Ga0209057_1027905 | All Organisms → cellular organisms → Bacteria | 3023 | Open in IMG/M |
| 3300026343|Ga0209159_1241047 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300026377|Ga0257171_1083580 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300026529|Ga0209806_1169487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 810 | Open in IMG/M |
| 3300026547|Ga0209156_10299015 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300026552|Ga0209577_10622730 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300027655|Ga0209388_1196064 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300027671|Ga0209588_1079525 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300027743|Ga0209593_10170505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 775 | Open in IMG/M |
| 3300027748|Ga0209689_1249405 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300027748|Ga0209689_1258679 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300027880|Ga0209481_10119482 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300027880|Ga0209481_10765943 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031239|Ga0265328_10119005 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300031240|Ga0265320_10087076 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300031242|Ga0265329_10328620 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031251|Ga0265327_10058547 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
| 3300031668|Ga0318542_10656787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300031679|Ga0318561_10166763 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300031723|Ga0318493_10263115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 924 | Open in IMG/M |
| 3300031740|Ga0307468_100856913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 782 | Open in IMG/M |
| 3300031740|Ga0307468_101299407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300031748|Ga0318492_10504524 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300031765|Ga0318554_10274000 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300031769|Ga0318526_10488819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300031771|Ga0318546_10162227 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
| 3300031771|Ga0318546_10627215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 756 | Open in IMG/M |
| 3300031778|Ga0318498_10554205 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300031798|Ga0318523_10122221 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300031805|Ga0318497_10576799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300031819|Ga0318568_10857294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300031820|Ga0307473_11443456 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031846|Ga0318512_10144648 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300031873|Ga0315297_11261127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 604 | Open in IMG/M |
| 3300031912|Ga0306921_10964332 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300031912|Ga0306921_11884268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300031942|Ga0310916_11752210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300032041|Ga0318549_10266614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300032066|Ga0318514_10128095 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300032180|Ga0307471_101189243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 927 | Open in IMG/M |
| 3300032180|Ga0307471_101394453 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300032180|Ga0307471_102439892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300032261|Ga0306920_102331035 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300032770|Ga0335085_10566648 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300032892|Ga0335081_12427146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300032893|Ga0335069_10478662 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300032893|Ga0335069_11188077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 836 | Open in IMG/M |
| 3300033004|Ga0335084_11089900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 802 | Open in IMG/M |
| 3300033408|Ga0316605_11289037 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300033485|Ga0316626_11935081 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.59% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.13% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.49% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.49% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.21% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.28% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.64% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.64% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.64% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.64% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.64% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.64% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.64% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.64% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.64% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.64% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.64% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014297 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D1 | Environmental | Open in IMG/M |
| 3300014880 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1013057021 | 3300000364 | Soil | FQRLRLQYTHTQASNQSPDDAFFLQWTGIIGSHVHSFRDR* |
| F14TB_1068490402 | 3300001431 | Soil | RLQYTYLDEPGXXESQFFLQWSVAIGSHVHGFRDR* |
| JGI25383J37093_100794251 | 3300002560 | Grasslands Soil | WLSEFQRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFKDR* |
| Ga0055470_100117403 | 3300003992 | Natural And Restored Wetlands | QSIDRQSPDTLAYSPYVTFWLSEFQRLRLQYQYLDMPQNHESQFFLQWTAILGSHVHGFTNR* |
| Ga0055435_102100592 | 3300003994 | Natural And Restored Wetlands | AAEGYSPYLTIWASEFQRFRLQYTHLSQPGGDDDQFFAQWTVILGSHVHSFRER* |
| Ga0063356_1042081341 | 3300004463 | Arabidopsis Thaliana Rhizosphere | KAQGDTMAYSPYLTVWASEFQRLRLQYTRLEAPRQHDDQFFLQWTVILGSHVHSFKDR* |
| Ga0062595_1009619712 | 3300004479 | Soil | SEFQRFRLQYTHLSQPGGDDDQFFLQWTVIMGSHVHSFRDR* |
| Ga0062595_1021146252 | 3300004479 | Soil | WASEFQRLRLQYTRLESPGLHENEFFVQWTVILGSHVHSFKDR* |
| Ga0066679_105704291 | 3300005176 | Soil | SPYFTIWASEFQRLRLQYTRLETNAPKQTDDQFFLQWTIVMGSHAHSFRDR* |
| Ga0066685_102089913 | 3300005180 | Soil | YLTLWLSEFNRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFRDR* |
| Ga0066671_103185563 | 3300005184 | Soil | EFQRLRLQYTRLETNAPKQTDDQFFLQWTIIMGSHVHSFRDR* |
| Ga0066676_102066103 | 3300005186 | Soil | EFQRLRLQYTRLEEPGNHENQFFLQWSIALGNHVHGFSDR* |
| Ga0066675_104146662 | 3300005187 | Soil | EFQRLRLQYTRLETNSPKQTDDQFFLQWTIIMGSHAHSFRDR* |
| Ga0066675_114186262 | 3300005187 | Soil | PYLTLWLSEFNRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFRDR* |
| Ga0066388_1032707162 | 3300005332 | Tropical Forest Soil | EFNRLRFQYTRLEQPGLHENQFFLQWTVILGSHVHGFRER* |
| Ga0066388_1034062851 | 3300005332 | Tropical Forest Soil | FWPSEFQRLRLQYTYIDQPGNPQRPAHENQLFLQWTATLGSHVHGFRDR* |
| Ga0070694_1004237901 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | ASEFQRIRLQYTRLEAPGAGNEDNQFFLQWTVILGSHVHSFRDR* |
| Ga0066689_102349591 | 3300005447 | Soil | TIWASEFQRFRLQYTRLDAPEGHDNQFFLQWTVILGSHVHGFRDR* |
| Ga0066689_109220791 | 3300005447 | Soil | YTTGYSPYLTVWLSEFQRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFKDR* |
| Ga0070707_1007298981 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | WASEFQRFRLQYTHLDQSPRDDDKFFLQWTVILGSHVHSFRDR* |
| Ga0070698_1004980632 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | AGDTIAYSPYLTVWASEFQRIRLQYTRLEAPGAGNEDNQFFLQWTVILGSHVHSFRDR* |
| Ga0066697_101100701 | 3300005540 | Soil | TLWLSEFNRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFKDR* |
| Ga0066700_108130942 | 3300005559 | Soil | SPYLTVWLSEFNRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFRDR* |
| Ga0066699_103997411 | 3300005561 | Soil | RLQYTHLDQSPRDDDKFFLQWTVILGSHVHSFRDR* |
| Ga0066703_100916231 | 3300005568 | Soil | QDIDRPASRTWALSPYFTIWASEFQRLRLQYTRLETNSPKQTDDQFFLQWTIIMGSHAHSFRDR* |
| Ga0066703_106143132 | 3300005568 | Soil | YAQDVDHVVGPTYAYSPYLTIWASEFQRLRFQYTRLEQPGNHDDQFFLQWTVILGSHVHSFKDR* |
| Ga0066654_107819282 | 3300005587 | Soil | ASEFQRLRLQYTHADGPDRSDDRFFLQWTVIIGSHVHSFRDR* |
| Ga0070702_1018932191 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | EFQRFRLQYTRLDAPGDHDDQFFLQWTVIMGSHVHSFRDR* |
| Ga0066903_1081764262 | 3300005764 | Tropical Forest Soil | TLWASEFQRFRLQYTRFEAPGDHENQFFLQWTVIIGSHVHSFRDR* |
| Ga0081539_102330941 | 3300005985 | Tabebuia Heterophylla Rhizosphere | PYLTFWPSEFQRLRLQYTYLSRPGTAQQPAHANQLFLQWSVVLGSHVHGFRDR* |
| Ga0066652_1009859932 | 3300006046 | Soil | PYLTLWLSEFNRLRLQYTRLEQPGLHENQFFLQWTVILGSHVHSFRDR* |
| Ga0066652_1016099201 | 3300006046 | Soil | PYLTLWLSEFNRLRLQYTRLEQPGLHENQFFLQWTVILGSHVHSFKDR* |
| Ga0074050_109640021 | 3300006577 | Soil | GDTFAYSPYLTLWASEFQRFRLEYTRFEAPGDHENQFFLQWTVIIGSHVHSFRDR* |
| Ga0066658_109126651 | 3300006794 | Soil | TAYSPYLTLWLSEFNRLRLQYTRLEQPGLHENQFFLQWTVILGSHVHSFKDR* |
| Ga0075425_1021377481 | 3300006854 | Populus Rhizosphere | TRAYSPYLTIWLSEFNRLRFQYTYLDEPGNHESQFFIQWTVILGSHVHGFSNR* |
| Ga0075426_107690091 | 3300006903 | Populus Rhizosphere | QDIDHVVGPTYAYSPYFTMWLSEFNRLRFQYTRLEQPGLHENEFFLQWTVILGSHVHGFRDR* |
| Ga0075436_1003454202 | 3300006914 | Populus Rhizosphere | RLERATKGYSPYLTLWASEFQRFRLQFTHLDQSPRDDERFFLQWTVILGSHVHSFRDR* |
| Ga0075435_1015320741 | 3300007076 | Populus Rhizosphere | PYLTMWLSEFNRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFRDR* |
| Ga0075435_1016380592 | 3300007076 | Populus Rhizosphere | TFWPSEFQRLRLQYTYLSQPGIPQLPAHANQVFLQWTAILGSHVHGFRDR* |
| Ga0066710_1017283412 | 3300009012 | Grasslands Soil | QRFRLQYTRLDAPEGHDNQFFLQWTVILGSHVHGFRDR |
| Ga0066710_1020370151 | 3300009012 | Grasslands Soil | QRFRLQYTRLDAPEGNDNQFFLQWTVILGSHVHGFRDR |
| Ga0066710_1026293022 | 3300009012 | Grasslands Soil | SPYLTLWASEFQRFRLQYTRLEEPHNRDNQFFLQWTVILGSHVHSFKDR |
| Ga0099827_103420811 | 3300009090 | Vadose Zone Soil | LTFWPSEFQRLRLQYTYLDTPGKHENQVFLQWTAILGSHVHGFRNR* |
| Ga0075423_106245022 | 3300009162 | Populus Rhizosphere | MWLSEFNRLRFQYTRLEQPGLHENEFFLQWTVILGSHVHGFRDR* |
| Ga0105248_129220762 | 3300009177 | Switchgrass Rhizosphere | ASEFQRLRFQYTYLDAPGNHENQFFVQWTAILGSHVHGFRDR* |
| Ga0105248_134776092 | 3300009177 | Switchgrass Rhizosphere | LQYTHLSQPGGDDDQFFLQWTVIMGSHVHSFRDR* |
| Ga0134070_100300963 | 3300010301 | Grasslands Soil | FNRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFRDR* |
| Ga0134082_103193301 | 3300010303 | Grasslands Soil | LSEFNRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFRDR* |
| Ga0134065_103038422 | 3300010326 | Grasslands Soil | YSPYLTIWASEFQRFRLQYTRLDAPEGNDNQFFLQWTVILGSHVHGFRDR* |
| Ga0126370_120883352 | 3300010358 | Tropical Forest Soil | FSPYLTVWLSELQRLRLQYTYIDQPGNPQQPAHENQFFLQWTAILGSHVHGFRDR* |
| Ga0126377_105260813 | 3300010362 | Tropical Forest Soil | QRLRLQYTYLSQPATLQQPAYANQVFLQWTAILGSHAHGFRDR* |
| Ga0126379_127469412 | 3300010366 | Tropical Forest Soil | LQYTYLSQPGTSQQPAHANQVFLQWTAILGSHAHGFRDR* |
| Ga0134125_122649892 | 3300010371 | Terrestrial Soil | EFQRFRLQYTHLDQSPRDDDKFFLQWTVIMGSHVHSFRDR* |
| Ga0136449_1031728441 | 3300010379 | Peatlands Soil | KAYAPYFTIWLSEFQRLRLQYTYNDEPQNHENQFFVQWTAVLGSHVHGFRDR* |
| Ga0126383_119645961 | 3300010398 | Tropical Forest Soil | DTLAYSPYLTIWASEFQRLRLQYTRLEAPAQHENQFFLQWTVILGSHVHSFKDR* |
| Ga0105246_112522542 | 3300011119 | Miscanthus Rhizosphere | MFQYTQDINGVQGPAEGYSPYLTIWASEFQRFRLQYTHLSQPGGDDDQFFLQWTVIMGSHVHSFRDR* |
| Ga0137363_105610171 | 3300012202 | Vadose Zone Soil | YTRLEASLPARTDDQFFLQWTIIMGSHAHSFRDR* |
| Ga0137379_114561092 | 3300012209 | Vadose Zone Soil | SEFQRLRLQYTYFNQPGTPQQPAHANQVFLQWTAILGSHVHGFRDR* |
| Ga0137377_107473851 | 3300012211 | Vadose Zone Soil | AYSPYLTLWLSEFNRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFRDR* |
| Ga0150985_1139886611 | 3300012212 | Avena Fatua Rhizosphere | EFQRLRLQYTYLDQPGAHEHQVFLQWTAILGSHVHGFRDR* |
| Ga0137387_106432031 | 3300012349 | Vadose Zone Soil | LTIWRPEFQRIRLQYTYLDQPGTAQQPAHENQFFLQWTAILGSHVHGFRDR* |
| Ga0137373_107307241 | 3300012532 | Vadose Zone Soil | GQRFFRAYSPYLTIWASEFQRLRLQYTRVESPVHDDQFFLQWTAIIGSHVHTFRDR* |
| Ga0137358_104882032 | 3300012582 | Vadose Zone Soil | MWLSEFQRLRLQYTRLEQPGLHDDQFFLQWTVILGSHVHSFRDR* |
| Ga0137358_110125671 | 3300012582 | Vadose Zone Soil | ALTGRVTNAYSAYFTVWASEFQRLRLQYTRLDAARQRPWDQCFLQWTIIMGSHVHSFRDR |
| Ga0137394_111025832 | 3300012922 | Vadose Zone Soil | IWLSEFQRLRLQYTRLEEPGNHENQFFLQWSIALGNHVHGFSDR* |
| Ga0137359_103462051 | 3300012923 | Vadose Zone Soil | TWAVSPYFTIWASEFQRLRLQYTRLEASLPARTDDQFFLQWTIIMGSHAHSFRDR* |
| Ga0137419_118870021 | 3300012925 | Vadose Zone Soil | YFTVWASEFQRLRLQYTHLDAPRRRPEDQFFLQWTIIMGSHVHSFRDR* |
| Ga0137404_108024011 | 3300012929 | Vadose Zone Soil | YLTFWPSEFMRLRLQYTYLSQPGTSQQAAHENQVFLQWTAILGSHVHGFRDR* |
| Ga0137404_119048461 | 3300012929 | Vadose Zone Soil | AYSPYFTIWLYEFQRLRLQYTYLDAPTNHESQFFVQWSIALGSHVHGFGDR* |
| Ga0137407_115236141 | 3300012930 | Vadose Zone Soil | EFNRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFKDR* |
| Ga0126369_106121211 | 3300012971 | Tropical Forest Soil | EFQRLRAQYTYLDSPGNHENQIFLQWTVFIGAHSHGFRER* |
| Ga0126369_120603632 | 3300012971 | Tropical Forest Soil | WASEFQRFRLEYTRFEAPGDHENQFFLQWTVIIGSHVHSFRDR* |
| Ga0134087_102606022 | 3300012977 | Grasslands Soil | SPYLTLWLSEFNRLRLQYTRLEQPGLHENQFFLQWTVILGSHVHSFKDR* |
| Ga0134087_107667562 | 3300012977 | Grasslands Soil | VDRVKGPTYAYSPFFTLWLSEFQRLRLQYTRLEEPGNHENQFFLQWSIALGNHVHGFSDR |
| Ga0134075_101567932 | 3300014154 | Grasslands Soil | AGYTTAYSPYLTVWLSEFDRLRFQYTRLEQPGLHDNQFFLQWTVILGSHVHSFKDR* |
| Ga0134075_103812852 | 3300014154 | Grasslands Soil | RFFRAYSPYLTIWASEFQRLRLQYTRVESPVHDDQFFLQWTAIIGSHVHTFRDR* |
| Ga0075306_10737522 | 3300014297 | Natural And Restored Wetlands | DFTQAIDRSSGPARGYSPYVTIWPSEFQRLRVQYTYLDEPANHENELFAQWTVFLGSHVHGFRNR* |
| Ga0180082_10932641 | 3300014880 | Soil | HRLRLQYTYLDQPGAYENQVFLQWTAVLGSHVHGFRER* |
| Ga0173483_104738362 | 3300015077 | Soil | NGVQGPAEGYSPYLTIWASEFQRFRLQYTHLSQPGGDDDQFFLQWTVIMGSHVHSFRDR* |
| Ga0132255_1006892233 | 3300015374 | Arabidopsis Rhizosphere | MWLSEFNRLRFQYTRLEQPGLHENQFFLQWTVILGSHVHSFRDR* |
| Ga0182033_107500171 | 3300016319 | Soil | QYTQDINGVQSAAEGYSPYLTIWASEFQRFRLQYTHLSQPGGDDDQFFLQWTVIMGSHVHSFRDR |
| Ga0182035_115015032 | 3300016341 | Soil | EFQRFRLQYTHLSQPGGNDDQFFLQWTVIMGSHVHSFRDR |
| Ga0134069_10334043 | 3300017654 | Grasslands Soil | DLDHVAGYTTAYSPYLTLWLSEFNRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFKD |
| Ga0134112_100398671 | 3300017656 | Grasslands Soil | EFNRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFRDR |
| Ga0187779_103668191 | 3300017959 | Tropical Peatland | RFRLQYTHLTQSPRDDDQFFLQWTVILGSHVHSFRDR |
| Ga0066655_102944062 | 3300018431 | Grasslands Soil | RLQYTRLEQPGLHENEFFLQWTVILGSHVHSFRDR |
| Ga0066655_110662851 | 3300018431 | Grasslands Soil | FQRLRLQYTPLDAPGDHDNQFFLQWTVILVSHAHPFKDR |
| Ga0066667_120347712 | 3300018433 | Grasslands Soil | WLSEFNRLRLQYTRLEQPGLHENQFFLQWTVILGSHVHSFKDR |
| Ga0066662_110035491 | 3300018468 | Grasslands Soil | TIWASEFQRLRFQYTRLEQPGNHDDQFFLQWTVILGSHVHSFKDR |
| Ga0066662_114489221 | 3300018468 | Grasslands Soil | LSEFNRLRLQYTRLEQPGLHENQFFLQWTVILGSHVHSFKDR |
| Ga0137408_11050821 | 3300019789 | Vadose Zone Soil | LRLQYSLQYTRLEQPGLHENEFFLQWTVILGSHVHSFKDR |
| Ga0179594_100086961 | 3300020170 | Vadose Zone Soil | EFNRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFKDR |
| Ga0126371_125929671 | 3300021560 | Tropical Forest Soil | VDPGVGDTRAYSPYFTMWMSEFQRLRFQYTYLDAPKDHESEFFLQWTVILGSHVHGFRDR |
| Ga0207685_101415032 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VGETLAYSPYFTVWASEFQRLRLQYTRLESPGLHENEFFLQWTVILGSHVHSFKDR |
| Ga0207662_103538872 | 3300025918 | Switchgrass Rhizosphere | FRLQYTHLSQPGGDDDQFFLQWTVIMGSHVHSFRDR |
| Ga0207646_102787523 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | FQRLRLEYTRLDEPARNDDRFFLQWTVILGSHVHSFRDR |
| Ga0207712_103680011 | 3300025961 | Switchgrass Rhizosphere | EFQRLRLQYTYLSQPGIPQVPAYANQVFLQWTAILGSHAHGFRDR |
| Ga0207675_1011596682 | 3300026118 | Switchgrass Rhizosphere | QRFRLQYTRLDAPGDHDDQFFLQWTVILGSHTHSFRER |
| Ga0209234_11798212 | 3300026295 | Grasslands Soil | FQRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFRDR |
| Ga0209235_10985843 | 3300026296 | Grasslands Soil | WLSEFQRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFKDR |
| Ga0209236_11266872 | 3300026298 | Grasslands Soil | AYSPYFTVWLSEFNRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFRDR |
| Ga0209469_11244801 | 3300026307 | Soil | TYAYSPYLTIWASEFQRLRFQYTRLEQPGNHDDQFFLQWTVILGSHVHSFKDR |
| Ga0209686_11653452 | 3300026315 | Soil | FQRFRLQYTRLDAPEGHDNQFFLQWTVILGSHVHGFRDR |
| Ga0209472_10326894 | 3300026323 | Soil | FQRFRLQYTRLDAPEGNDNQFFLQWTVILGSHVHGFRDR |
| Ga0209470_10571153 | 3300026324 | Soil | YSPYLTVWLSEFNRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFRDR |
| Ga0209375_10599313 | 3300026329 | Soil | YSPYFTVWLSEFNRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFRDR |
| Ga0209057_10279051 | 3300026342 | Soil | TLWLSEFNRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFKDR |
| Ga0209159_12410472 | 3300026343 | Soil | DRVKGPTYAYSPFFTLWLSEFQRLRLQYTRLEEPGNHENQFFLQWSIALGNHVHGFSDR |
| Ga0257171_10835802 | 3300026377 | Soil | DTLAYAPYLTIWLSEFQRIRLQYQYLDAPQNHESQFFLQWTAIIGSHVHGFRDR |
| Ga0209806_11694872 | 3300026529 | Soil | LRLQYTRLETNSPKQTDDQFFLQWTIIMGSHAHSFRDR |
| Ga0209156_102990152 | 3300026547 | Soil | TAYSPYLTLWLSEFNRLRLQYTRLEQPGLHENQFFLQWMVILGSHVHSFKDR |
| Ga0209577_106227302 | 3300026552 | Soil | SEFQRLRLQYTHLDGNTRPDDQFFLQWTAVIGSHVHSFRDR |
| Ga0209388_11960643 | 3300027655 | Vadose Zone Soil | YLTVWASEFQRLRLQYTRLEAPGDHDNQFFLQWTVILGSHAHTFKDR |
| Ga0209588_10795251 | 3300027671 | Vadose Zone Soil | LTMWLSEFNRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFKDR |
| Ga0209593_101705052 | 3300027743 | Freshwater Sediment | TTAFSPYITLWASEFQRIRLQYSNIAQPGGHDNAGFIQWTVVLGSHVHGFRDR |
| Ga0209689_12494052 | 3300027748 | Soil | VWLSEFNRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFKDR |
| Ga0209689_12586792 | 3300027748 | Soil | VWLSEFNRLRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFRDR |
| Ga0209481_101194823 | 3300027880 | Populus Rhizosphere | RLQYTYVDQASTPQQPAHANQVFLQWTAILGSHVHGFRDR |
| Ga0209481_107659432 | 3300027880 | Populus Rhizosphere | FQRLRLQYAHVESNQPRTRPSDDQFFLQWTAIIGSHVHSFRDR |
| Ga0265328_101190052 | 3300031239 | Rhizosphere | VQDLNRQEPDTLSYSPYFTIWLSEFDRLRAQYTYLDSPGNHESQFFLQWTVFIGSHAHGFRDR |
| Ga0265320_100870761 | 3300031240 | Rhizosphere | LSEFQRVRLQYTYLTQPENHESQFFLQWTAVLGSHVHGFRDR |
| Ga0265329_103286202 | 3300031242 | Rhizosphere | IWFSEFQRVRLQYTYLTQPENHESQFFLQWTAVLGSHVHGFRDR |
| Ga0265327_100585471 | 3300031251 | Rhizosphere | SPYFTIWLSEFQRVRLQYTYLTQPENHESQFFLQWTAVLGSHVHGFRDR |
| Ga0318542_106567872 | 3300031668 | Soil | PGVGETFAYSPYVTLWASEFQRFRLEYTRFEAPGDHENQFFLQWTVIIGSHVHSFRDR |
| Ga0318561_101667631 | 3300031679 | Soil | INPGVGDTFAYSPYLTLWASEFQRFRLQYTRFEAPGDHENQCFLQWTVIIGSHVHSFRDR |
| Ga0318493_102631152 | 3300031723 | Soil | PFLTMWASEFQRIRLEYAYLDAPGNHENQFFLQWTVILGSHVHGFRER |
| Ga0307468_1008569131 | 3300031740 | Hardwood Forest Soil | SPYFTIWASEFQRLRLQYTHTWSSNQSPDDAFFLQWTGIIGSHVHSFRDR |
| Ga0307468_1012994072 | 3300031740 | Hardwood Forest Soil | WASEFQRFRLQYTHLDQEPRDDDKFFLQWTVILGSHVHSFRDR |
| Ga0318492_105045242 | 3300031748 | Soil | RGGETTQALSPYLTIWPSEFQRIRLEYSRVEHPDHLRGDDDRFFLQWTVILGSHVHSFRD |
| Ga0318554_102740002 | 3300031765 | Soil | GETLAYSPYLTVWASEFQRIRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFKDR |
| Ga0318526_104888192 | 3300031769 | Soil | WAESINPGVGDTFAYSPYLTLWASEFQRFRLQYTRFEAPGNHENQFFLQWTVIIGSHVHSFRDR |
| Ga0318546_101622273 | 3300031771 | Soil | ESINPGVGDTFAYSPYLTLWASEFQRFRLQYTRFEAPGDHENQFFLQWTVIIGSHVHSFRDR |
| Ga0318546_106272151 | 3300031771 | Soil | FQRFRLQYTHLSQPGGDDDQFFLQWTVIMGSHVHSFRDR |
| Ga0318498_105542052 | 3300031778 | Soil | VTLWASEFQRFRLEYTRFEAPGDHENQFFLQWTVIIGSHVHSFRDR |
| Ga0318523_101222211 | 3300031798 | Soil | AESINPGVGDTFAYSPYLTLWASEFQRFRLQYTRFEAPGDHENQFFLQWTVIIGSHVHSFRDR |
| Ga0318497_105767992 | 3300031805 | Soil | YVTLWASEFQRFRLEYTRFEAPGDHENQFFLQWTVIIGSHVHSFRDR |
| Ga0318568_108572942 | 3300031819 | Soil | SPYLTVWASEFQRIRLQYTRLEQPGLHENEFFLQWTVILGSHVHSFKDR |
| Ga0307473_114434561 | 3300031820 | Hardwood Forest Soil | EFQRLRLQYTRLEQPGDHENQFFLQWTVILGSHVHGFKER |
| Ga0318512_101446481 | 3300031846 | Soil | LWASEFQRFRLQYTRFEAPGDHENQFFLQWTVIIGSHVHSFRDR |
| Ga0315297_112611271 | 3300031873 | Sediment | IWLSEFQRLRLQYTYFTGPANHQSQFFLQWTAVLGSHVHGFRDR |
| Ga0306921_109643322 | 3300031912 | Soil | DIDRGGETTQALSPYLTIWPSEFQRIRLEYSRVEHPDHLRGDDDRFFLQWTVILGSHVHSFRDR |
| Ga0306921_118842682 | 3300031912 | Soil | SEFQRFRLQYTHLSQPGGDDDQFFLQWTVIMGSHVHSFRDR |
| Ga0310916_117522101 | 3300031942 | Soil | TFAYSPYLTLWASEFQRFRLQYTRFEAPGDHENQFFLQWTVIIGSHVHSFRDR |
| Ga0318549_102666142 | 3300032041 | Soil | SPYLTLWASEFQRFRLQYTRFEAPGDHENQFFLQWTVIIGSHVHSFRDR |
| Ga0318514_101280953 | 3300032066 | Soil | QDINRQRGDTLSYSPYFTIWLSEFQRLRAQYTYLDSPGNHENQFFLQWTVIIGSHVHSFRDR |
| Ga0307471_1011892432 | 3300032180 | Hardwood Forest Soil | YLTLWASEFQRFRLQYTHLDQQPRDDDKFFLQWTVILGSHVHSFRDR |
| Ga0307471_1013944532 | 3300032180 | Hardwood Forest Soil | EFQRLRLQYTRLEQPGLHENQFFLQWTVILGSHVHSFRDR |
| Ga0307471_1024398921 | 3300032180 | Hardwood Forest Soil | FQRLRLQYTHLESNRPATRPTDDQFFLQWTAIIGSHVHSFRDR |
| Ga0306920_1023310351 | 3300032261 | Soil | QYTYLSQPGIPQVPAHENQVFLQWTAILGSHVHGFRDR |
| Ga0335085_105666481 | 3300032770 | Soil | EFQRIRLEYQYLDAPGAHESQFFLQWTGVLGSHVHGFRDR |
| Ga0335081_124271461 | 3300032892 | Soil | QRFRLQYTHLSQPGGDDDQFFLQWTVVMGSHVHSFRDR |
| Ga0335069_104786621 | 3300032893 | Soil | ISRLSGDTRGYSPYFTIWLSEFNRIRLQYTYLDEPANHENQFFLQWTAVLGSHVHGFRDR |
| Ga0335069_111880772 | 3300032893 | Soil | SYSPYFTIWLSEFQRLRLQYTYLTQPANHESQFFLQWTAVLGSHVHGFRDR |
| Ga0335084_110899002 | 3300033004 | Soil | FQRLRVQYTYLDAPGNHENQFFLQWTVVIGSHVHSFRDR |
| Ga0316605_112890371 | 3300033408 | Soil | VWASEFQRLRFQYTHLDEPGDHDDLFYLQWTVALGSHVHGFKDR |
| Ga0316626_119350811 | 3300033485 | Soil | FAYSPYLTVWASEFQRLRFQYTHLDEPGDHDDLFYLQWTVALGSHVHGFKDR |
| ⦗Top⦘ |