NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F043650

Metagenome / Metatranscriptome Family F043650

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F043650
Family Type Metagenome / Metatranscriptome
Number of Sequences 156
Average Sequence Length 45 residues
Representative Sequence MLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVENPNK
Number of Associated Samples 115
Number of Associated Scaffolds 156

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 51.92 %
% of genes near scaffold ends (potentially truncated) 25.64 %
% of genes from short scaffolds (< 2000 bps) 75.64 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere
(8.333 % of family members)
Environment Ontology (ENVO) Unclassified
(46.795 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(58.974 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 85.71%    β-sheet: 0.00%    Coil/Unstructured: 14.29%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 156 Family Scaffolds
PF02321OEP 30.77
PF01578Cytochrom_C_asm 28.21
PF03379CcmB 9.62
PF00005ABC_tran 3.21
PF02654CobS 1.92
PF02687FtsX 1.28
PF02277DBI_PRT 1.28
PF16327CcmF_C 1.28
PF01032FecCD 1.28
PF01497Peripla_BP_2 0.64
PF05990DUF900 0.64
PF13464DUF4115 0.64
PF02283CobU 0.64
PF04343DUF488 0.64
PF01797Y1_Tnp 0.64
PF00453Ribosomal_L20 0.64
PF01741MscL 0.64
PF12704MacB_PCD 0.64

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 156 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 61.54
COG2386ABC-type transport system involved in cytochrome c biogenesis, permease componentPosttranslational modification, protein turnover, chaperones [O] 9.62
COG0368Cobalamin synthase CobS (adenosylcobinamide-GDP ribazoletransferase)Coenzyme transport and metabolism [H] 1.92
COG2038NaMN:DMB phosphoribosyltransferaseCoenzyme transport and metabolism [H] 1.28
COG0292Ribosomal protein L20Translation, ribosomal structure and biogenesis [J] 0.64
COG0614ABC-type Fe3+-hydroxamate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.64
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.64
COG1970Large-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 0.64
COG2087Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferaseCoenzyme transport and metabolism [H] 0.64
COG3189Uncharacterized conserved protein YeaO, DUF488 familyFunction unknown [S] 0.64
COG4558ABC-type hemin transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.64
COG4592ABC-type Fe2+-enterobactin transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.64
COG4594ABC-type Fe3+-citrate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.64
COG4607ABC-type enterochelin transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.64
COG4782Esterase/lipase superfamily enzymeGeneral function prediction only [R] 0.64


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459016|G1P06HT02FSVJOAll Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
2199352024|deeps__Contig_159005All Organisms → cellular organisms → Bacteria → Acidobacteria597Open in IMG/M
3300000567|JGI12270J11330_10033385All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2974Open in IMG/M
3300004092|Ga0062389_100616688All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1250Open in IMG/M
3300005093|Ga0062594_102869518All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae536Open in IMG/M
3300005328|Ga0070676_10665032All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae757Open in IMG/M
3300005329|Ga0070683_100029427All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4972Open in IMG/M
3300005329|Ga0070683_100098857All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2746Open in IMG/M
3300005329|Ga0070683_100148548All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2222Open in IMG/M
3300005329|Ga0070683_100406258All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1299Open in IMG/M
3300005329|Ga0070683_100932890All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae833Open in IMG/M
3300005330|Ga0070690_100425954All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae979Open in IMG/M
3300005332|Ga0066388_103505243All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae801Open in IMG/M
3300005334|Ga0068869_100349055All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1206Open in IMG/M
3300005334|Ga0068869_100520544All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae995Open in IMG/M
3300005335|Ga0070666_11028393All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium611Open in IMG/M
3300005336|Ga0070680_100090854All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2527Open in IMG/M
3300005337|Ga0070682_100964158All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae705Open in IMG/M
3300005338|Ga0068868_102180401All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae528Open in IMG/M
3300005434|Ga0070709_10122962All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1762Open in IMG/M
3300005434|Ga0070709_10219260All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1356Open in IMG/M
3300005434|Ga0070709_11059722All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae647Open in IMG/M
3300005436|Ga0070713_100138674All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2152Open in IMG/M
3300005436|Ga0070713_100154188All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2046Open in IMG/M
3300005439|Ga0070711_100193223All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1566Open in IMG/M
3300005439|Ga0070711_100519750All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae984Open in IMG/M
3300005439|Ga0070711_100872071All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae767Open in IMG/M
3300005439|Ga0070711_101157379All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae668Open in IMG/M
3300005439|Ga0070711_101313660All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae628Open in IMG/M
3300005468|Ga0070707_101255862All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium707Open in IMG/M
3300005529|Ga0070741_10000689All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia116287Open in IMG/M
3300005534|Ga0070735_10010488All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7127Open in IMG/M
3300005534|Ga0070735_10317782All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae937Open in IMG/M
3300005538|Ga0070731_10012425All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus6192Open in IMG/M
3300005545|Ga0070695_100753181All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae777Open in IMG/M
3300005564|Ga0070664_101224995All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae708Open in IMG/M
3300005564|Ga0070664_101669093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae604Open in IMG/M
3300005577|Ga0068857_100465112All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1184Open in IMG/M
3300005577|Ga0068857_101283750All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae710Open in IMG/M
3300005829|Ga0074479_10770027All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1180Open in IMG/M
3300005834|Ga0068851_10675651All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300005836|Ga0074470_10954454All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1737Open in IMG/M
3300005836|Ga0074470_11176703All Organisms → cellular organisms → Bacteria3086Open in IMG/M
3300005836|Ga0074470_11765166All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300005841|Ga0068863_102683123All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae507Open in IMG/M
3300005842|Ga0068858_100203088All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1874Open in IMG/M
3300005842|Ga0068858_100544312All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1124Open in IMG/M
3300005842|Ga0068858_101237643All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae734Open in IMG/M
3300005843|Ga0068860_102005360All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae600Open in IMG/M
3300006163|Ga0070715_10391359All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae770Open in IMG/M
3300006237|Ga0097621_101083428All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae752Open in IMG/M
3300006237|Ga0097621_101735563All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae595Open in IMG/M
3300006354|Ga0075021_10034777All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2876Open in IMG/M
3300006638|Ga0075522_10000014All Organisms → cellular organisms → Bacteria100958Open in IMG/M
3300006755|Ga0079222_11307026All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae661Open in IMG/M
3300006755|Ga0079222_12245596All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia543Open in IMG/M
3300006854|Ga0075425_101893877All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae668Open in IMG/M
3300006871|Ga0075434_102396304All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae530Open in IMG/M
3300006881|Ga0068865_100518197All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae997Open in IMG/M
3300006881|Ga0068865_100678136All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium878Open in IMG/M
3300006893|Ga0073928_10578723All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae795Open in IMG/M
3300006954|Ga0079219_12521811All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae500Open in IMG/M
3300009093|Ga0105240_10003032All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia26423Open in IMG/M
3300009093|Ga0105240_10010794All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia12802Open in IMG/M
3300009098|Ga0105245_10014489All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6866Open in IMG/M
3300009098|Ga0105245_11817401All Organisms → cellular organisms → Bacteria → Acidobacteria662Open in IMG/M
3300009098|Ga0105245_11950316All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300009098|Ga0105245_13254315All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300009148|Ga0105243_10027531All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4356Open in IMG/M
3300009174|Ga0105241_11609154All Organisms → cellular organisms → Bacteria → Acidobacteria628Open in IMG/M
3300009176|Ga0105242_11796721All Organisms → cellular organisms → Bacteria → Acidobacteria651Open in IMG/M
3300009545|Ga0105237_10063121All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3702Open in IMG/M
3300009545|Ga0105237_11210048All Organisms → cellular organisms → Bacteria → Acidobacteria762Open in IMG/M
3300009551|Ga0105238_10003062All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia16671Open in IMG/M
3300010359|Ga0126376_10538716All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1090Open in IMG/M
3300010371|Ga0134125_10781566All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1051Open in IMG/M
3300010375|Ga0105239_10223790All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2110Open in IMG/M
3300010379|Ga0136449_100212727All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3653Open in IMG/M
3300010397|Ga0134124_12714042All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300010399|Ga0134127_10393679All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1368Open in IMG/M
3300011431|Ga0137438_1176918All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium655Open in IMG/M
3300012532|Ga0137373_10885983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium656Open in IMG/M
3300012982|Ga0168317_1008306All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3580Open in IMG/M
3300013105|Ga0157369_12299792All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300013296|Ga0157374_11030394All Organisms → cellular organisms → Bacteria → Acidobacteria842Open in IMG/M
3300013297|Ga0157378_10904943All Organisms → cellular organisms → Bacteria → Acidobacteria913Open in IMG/M
3300013297|Ga0157378_11446178All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300013297|Ga0157378_13050475All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300013307|Ga0157372_10025703All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus6405Open in IMG/M
3300014326|Ga0157380_11413305All Organisms → cellular organisms → Bacteria → Acidobacteria747Open in IMG/M
3300014969|Ga0157376_11981546All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300017939|Ga0187775_10252141All Organisms → cellular organisms → Bacteria → Acidobacteria677Open in IMG/M
3300017959|Ga0187779_10656041All Organisms → cellular organisms → Bacteria → Acidobacteria706Open in IMG/M
3300017972|Ga0187781_10210680All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1372Open in IMG/M
3300020581|Ga0210399_11545464All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300021088|Ga0210404_10764280All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300021168|Ga0210406_10139110All Organisms → cellular organisms → Bacteria → Acidobacteria2042Open in IMG/M
3300021170|Ga0210400_10063170All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2889Open in IMG/M
3300021170|Ga0210400_10087052All Organisms → cellular organisms → Bacteria → Acidobacteria2461Open in IMG/M
3300021401|Ga0210393_10626568All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3878Open in IMG/M
3300021402|Ga0210385_10726025All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae761Open in IMG/M
3300021420|Ga0210394_10571332All Organisms → cellular organisms → Bacteria → Acidobacteria994Open in IMG/M
3300021420|Ga0210394_11035634All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300021420|Ga0210394_11340831All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300021559|Ga0210409_10702020All Organisms → cellular organisms → Bacteria → Acidobacteria883Open in IMG/M
3300025862|Ga0209483_1000013All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia217700Open in IMG/M
3300025899|Ga0207642_10159350All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1210Open in IMG/M
3300025899|Ga0207642_10554829All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae710Open in IMG/M
3300025903|Ga0207680_10141550All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1595Open in IMG/M
3300025911|Ga0207654_10059509All Organisms → cellular organisms → Bacteria → Acidobacteria2228Open in IMG/M
3300025912|Ga0207707_10556189All Organisms → cellular organisms → Bacteria → Acidobacteria974Open in IMG/M
3300025913|Ga0207695_10015179All Organisms → cellular organisms → Bacteria → Acidobacteria9083Open in IMG/M
3300025913|Ga0207695_10732243All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae869Open in IMG/M
3300025913|Ga0207695_10898956All Organisms → cellular organisms → Bacteria → Acidobacteria765Open in IMG/M
3300025914|Ga0207671_10148517All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1810Open in IMG/M
3300025919|Ga0207657_10261263All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1378Open in IMG/M
3300025924|Ga0207694_10017071All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5483Open in IMG/M
3300025927|Ga0207687_10002434All Organisms → cellular organisms → Bacteria → Acidobacteria12640Open in IMG/M
3300025927|Ga0207687_10146518All Organisms → cellular organisms → Bacteria → Acidobacteria1797Open in IMG/M
3300025934|Ga0207686_10343157All Organisms → cellular organisms → Bacteria → Acidobacteria1122Open in IMG/M
3300025940|Ga0207691_11305830All Organisms → cellular organisms → Bacteria → Acidobacteria599Open in IMG/M
3300025941|Ga0207711_10913880All Organisms → cellular organisms → Bacteria → Acidobacteria816Open in IMG/M
3300025942|Ga0207689_10544711All Organisms → cellular organisms → Bacteria → Acidobacteria974Open in IMG/M
3300025944|Ga0207661_10026044All Organisms → cellular organisms → Bacteria → Acidobacteria4452Open in IMG/M
3300026023|Ga0207677_11211987All Organisms → cellular organisms → Bacteria → Acidobacteria691Open in IMG/M
3300026023|Ga0207677_11548882All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300026035|Ga0207703_12112337All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300026088|Ga0207641_10847011All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae906Open in IMG/M
3300026089|Ga0207648_10210788All Organisms → cellular organisms → Bacteria → Acidobacteria1725Open in IMG/M
3300026089|Ga0207648_11583869All Organisms → cellular organisms → Bacteria → Acidobacteria616Open in IMG/M
3300026116|Ga0207674_10482771All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1198Open in IMG/M
3300026116|Ga0207674_11355458All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae681Open in IMG/M
3300026555|Ga0179593_1172671All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium2540Open in IMG/M
3300027725|Ga0209178_1390482All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300027854|Ga0209517_10003860All Organisms → cellular organisms → Bacteria → Acidobacteria20045Open in IMG/M
3300027869|Ga0209579_10350579All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300027894|Ga0209068_10031217All Organisms → cellular organisms → Bacteria → Acidobacteria2639Open in IMG/M
3300027986|Ga0209168_10084296All Organisms → cellular organisms → Bacteria → Acidobacteria1653Open in IMG/M
3300028381|Ga0268264_10007129All Organisms → cellular organisms → Bacteria → Acidobacteria9368Open in IMG/M
3300029636|Ga0222749_10075514All Organisms → cellular organisms → Bacteria → Acidobacteria1538Open in IMG/M
3300031231|Ga0170824_120138984All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3694Open in IMG/M
3300031231|Ga0170824_128917340All Organisms → cellular organisms → Bacteria → Acidobacteria692Open in IMG/M
3300031250|Ga0265331_10374441All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae638Open in IMG/M
3300031474|Ga0170818_111537970All Organisms → cellular organisms → Bacteria → Acidobacteria810Open in IMG/M
3300031595|Ga0265313_10001799All Organisms → cellular organisms → Bacteria → Acidobacteria19597Open in IMG/M
3300031711|Ga0265314_10001307All Organisms → cellular organisms → Bacteria → Acidobacteria28236Open in IMG/M
3300031720|Ga0307469_10333496All Organisms → cellular organisms → Bacteria → Acidobacteria1266Open in IMG/M
3300031720|Ga0307469_11234489All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae708Open in IMG/M
3300031740|Ga0307468_101641265All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300031938|Ga0308175_100236921All Organisms → cellular organisms → Bacteria → Acidobacteria1822Open in IMG/M
3300032180|Ga0307471_101547630All Organisms → cellular organisms → Bacteria → Acidobacteria820Open in IMG/M
3300032421|Ga0310812_10525889All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300032828|Ga0335080_11714678All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae616Open in IMG/M
3300033158|Ga0335077_10656202All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1087Open in IMG/M
3300033412|Ga0310810_10722060All Organisms → cellular organisms → Bacteria → Acidobacteria921Open in IMG/M
3300033433|Ga0326726_10232836All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1710Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.33%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere8.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere7.69%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere5.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere5.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.13%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.85%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.21%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.21%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)2.56%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.56%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.56%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.92%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.92%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.92%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.92%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.92%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.28%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.28%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.28%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.28%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.28%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.28%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.28%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.28%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.28%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.64%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.64%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.64%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.64%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.64%
Weathered Mine TailingsEnvironmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.64%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.64%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459016Litter degradation ZMR2EngineeredOpen in IMG/M
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011431Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012982Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfieldEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300025862Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031595Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaGHost-AssociatedOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
2ZMR_030378902170459016Switchgrass, Maize And Mischanthus LitterMLLGLGAAWMIMFIYVVLITLRERKLRKELDRVRRMVEH
deeps_029263602199352024SoilMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVENPNK
JGI12270J11330_1003338533300000567Peatlands SoilMNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVEHSGK*
Ga0062389_10061668823300004092Bog Forest SoilMESRNVTFMIYGLVAAWLIVLGYVVLLALRERKLRKELDRVRHMVEGGKHS*
Ga0062594_10286951823300005093SoilMLLGLGAAWLIMFLYVVLITLRERKLRKELDRVRKMVEAPNK*
Ga0070676_1066503223300005328Miscanthus RhizosphereMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVENPGK*
Ga0070683_10002942733300005329Corn RhizosphereVNRNVQYMLLGLGAAWLIMFIYVILITLRERKLRKELDRVRRMVEQPNK*
Ga0070683_10009885733300005329Corn RhizosphereMNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRKMVETPNK*
Ga0070683_10014854823300005329Corn RhizosphereVNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVEQPNK*
Ga0070683_10040625833300005329Corn RhizosphereMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRHMVEHPQK*
Ga0070683_10093289023300005329Corn RhizosphereMNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVEQPNK*
Ga0070690_10042595423300005330Switchgrass RhizosphereMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVEHSDK*
Ga0066388_10350524323300005332Tropical Forest SoilVTRNVAYMLLGLGAAWLIMFTYVVLITLRERKLRKELDRVRRMVENPDK
Ga0068869_10034905523300005334Miscanthus RhizosphereMNRNVQYMLLGLGAAWLIMFLYVVLITLRERKLRKELDRVRKMVETPNK*
Ga0068869_10052054413300005334Miscanthus RhizosphereYMLLGLGAAWLIMFLYVVLITLRERKLRKELDRVRKMVEAPNK*
Ga0070666_1102839323300005335Switchgrass RhizosphereMLYGLMAAWLIVVLYVVHLTLRENRLRKELDRVRRMVESGEKRQ*
Ga0070680_10009085453300005336Corn RhizosphereLNRNVQYMLLGLGAAWLIMFTYVVLITLRERKLRKELDRVRRMVESASADR*
Ga0070682_10096415813300005337Corn RhizosphereLNRNVQYMLLGLGAAWLIMFTYVVLITLRERKLRKELDRVR
Ga0068868_10218040123300005338Miscanthus RhizosphereVNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVENPGK*
Ga0070709_1012296243300005434Corn, Switchgrass And Miscanthus RhizosphereLNRNVQFMLLGLGAAWMIMFIYVVLITLRERKLRKELDRVRRMVEHPNK*
Ga0070709_1021926013300005434Corn, Switchgrass And Miscanthus RhizosphereMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVENPNK*
Ga0070709_1105972223300005434Corn, Switchgrass And Miscanthus RhizosphereMLHGLGAAWLIMFIYVILITLRERKLRKELDRVRRMVEHPNK*
Ga0070713_10013867423300005436Corn, Switchgrass And Miscanthus RhizosphereMLLGLGAAWLIMFIYVILITLRERKLRKELDRVRRMVEHPQK*
Ga0070713_10015418813300005436Corn, Switchgrass And Miscanthus RhizosphereLNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVENPNK*
Ga0070711_10019322323300005439Corn, Switchgrass And Miscanthus RhizosphereMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVETPHK*
Ga0070711_10051975023300005439Corn, Switchgrass And Miscanthus RhizosphereMLLGLGAAWMIMFIYVVLITLRERKLRKELDRVRRMVEHPNK*
Ga0070711_10087207123300005439Corn, Switchgrass And Miscanthus RhizosphereMNRNVEYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVEHPQK*
Ga0070711_10115737913300005439Corn, Switchgrass And Miscanthus RhizosphereMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVEQPNK*
Ga0070711_10131366023300005439Corn, Switchgrass And Miscanthus RhizosphereVNRNVQYMLLGLGAAWLIMFIYVILITLRERKLRKELDRVRRM
Ga0070707_10125586223300005468Corn, Switchgrass And Miscanthus RhizosphereMLLGLGAAWLIMFLYVVLITLRERKLRKELDRVRRMVETPDK*
Ga0070741_10000689673300005529Surface SoilMNRNVEYMLLGLAAAWLIMFLYVVLITLRERKLRKELDRVRRMVEHPNK*
Ga0070735_1001048853300005534Surface SoilMLFGLGAAWLIMFAYVVLITLRERKLRKELDRVRRMVEHPQK*
Ga0070735_1031778213300005534Surface SoilMIYGLVAAWLIVLGYVVLLALRERKLRKELDRVRHMVETTKRP*
Ga0070731_1001242563300005538Surface SoilMLYGLTAAWLIVVVYVVLLSLRDRKLRKELDRVRRMVETAEKPK*
Ga0070695_10075318123300005545Corn, Switchgrass And Miscanthus RhizosphereRLNRNVQYMLLGLGAAWLIMFTYVVLITLRERKLRKELDRVRRMVESSSADR*
Ga0070664_10122499523300005564Corn RhizosphereMLLGLGAAWLIMFLYVVLITLRERKLRKELDRVRRMVENPNK*
Ga0070664_10166909313300005564Corn RhizosphereRSMNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRKMVETPNK*
Ga0068857_10046511213300005577Corn RhizosphereWLIMFLYVVLITLRERKLRKELDRVRKMVETPNK*
Ga0068857_10128375023300005577Corn RhizosphereMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVETPDK*
Ga0074479_1077002723300005829Sediment (Intertidal)MNRNVQFMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVENPNK*
Ga0068851_1067565123300005834Corn RhizosphereMNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRK
Ga0074470_1095445423300005836Sediment (Intertidal)VNRNVEYMLLGLGAAWLIMFTYVVLITLRERKLRKELDRVRRMVENPEK*
Ga0074470_1117670343300005836Sediment (Intertidal)MLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVEK*
Ga0074470_1176516623300005836Sediment (Intertidal)MNRNVEYMLLGLGAAWMIMFIYVVLITLRERKLRKELD
Ga0068863_10268312313300005841Switchgrass RhizosphereMLLGLGAAWLIMFLYVVLITLRERNLRKELDRVRKMVETPNK*
Ga0068858_10020308823300005842Switchgrass RhizosphereMLLGLGAAWLIMFLYVVLITLRERKLRKELDRVRKMVETPNK*
Ga0068858_10054431233300005842Switchgrass RhizosphereVNRNVEYMLLGLGAAWLIMFAYVVLITLRERKLRKELDRV
Ga0068858_10123764323300005842Switchgrass RhizosphereMNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVEHPQK*
Ga0068860_10200536013300005843Switchgrass RhizosphereMNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDR
Ga0070715_1039135923300006163Corn, Switchgrass And Miscanthus RhizosphereMLLGLGAAWMIMFIYVVLITLRERKLRKELDRVRRMVESPDK*
Ga0097621_10108342823300006237Miscanthus RhizosphereMLYGLMAAWLIVVLYVVHLTLRENRLRKELDRVRRMVESGEKR
Ga0097621_10173556323300006237Miscanthus RhizosphereMNRNVQYMLLGLGAAWLIMFLYVVLITLRERKLRKELDRVRKMVETPHK*
Ga0075021_1003477743300006354WatershedsMLEARNLTYMFYGFSAWFLILLGYVVLLALRERKLRGELDRVRRMVETPK*
Ga0075522_10000014753300006638Arctic Peat SoilVNRNVEYMLLGLGAAWLIMFTYVVLITLRERKLRKELDRVRRMVENPDR*
Ga0079222_1130702613300006755Agricultural SoilMNRNVEYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVETSSTEPRNS*
Ga0079222_1224559623300006755Agricultural SoilMNRNVQYMLLGLGAAWVIMFIYVVLITLRERKLRKELDRVRRMVENSGK*
Ga0075425_10189387713300006854Populus RhizosphereMNRNTEYMLLGLTAAWVIMMIYVVLITLRERKLRKELDRVR
Ga0075434_10239630423300006871Populus RhizosphereMNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVENPNK*
Ga0068865_10051819723300006881Miscanthus RhizosphereMLLGLGAAWLIMFAYVVLITLRERKLRKELDRVRKMVETPNK*
Ga0068865_10067813623300006881Miscanthus RhizosphereMLLGLGAAWLIMFLYVVLITLRERKLRKELDRVRKMVEK*
Ga0073928_1057872323300006893Iron-Sulfur Acid SpringMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVESSDK*
Ga0079219_1252181123300006954Agricultural SoilYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVETSSTEPRNS*
Ga0105240_10003032173300009093Corn RhizosphereMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVEHPNK*
Ga0105240_10010794143300009093Corn RhizosphereMLLGLGAAWLIMFTYVVLITLRERKLRKELDRVRRMVESASADR*
Ga0105245_1001448983300009098Miscanthus RhizosphereMLLGLGAAWLIMFLYVVLITLRERKLRKELDRVRKMVETPHK*
Ga0105245_1181740123300009098Miscanthus RhizosphereMLLGLGAAWLIMFLYVVLITLRERKLRKELDRVRRMVEHPQK*
Ga0105245_1195031623300009098Miscanthus RhizosphereLLGLGAAWLIMFIYVILITLRERKLRKELDRVRRMVEQPNK*
Ga0105245_1325431523300009098Miscanthus RhizosphereMLLGLGAAWLIMFAYVVLITLRERKLRKELDRVRKMVETPHK*
Ga0105243_1002753133300009148Miscanthus RhizosphereMLLGLGAAWLIMFIHVVLITLRERKLRKELDRVRRMVENPGK*
Ga0105241_1160915413300009174Corn RhizosphereVNRNVQYMLLGLGAAWLIMFIYVILITLRERKLREELDRVRRMVEHPQK*
Ga0105242_1179672123300009176Miscanthus RhizosphereMLLGLGAAWLIMFVYVVLITLRERKLRKELDRVRRMVENPGK*
Ga0105237_1006312153300009545Corn RhizosphereMLLGLGAAWLIMFTYVVLITLRERKLRKELDRVRRMVESSSADR*
Ga0105237_1121004823300009545Corn RhizosphereYMLLCRRSAWLIMFIYVVLITLRERKLRKELDRVRKMVETPNK*
Ga0105238_10003062143300009551Corn RhizosphereMNRNDQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRKMVETPNK*
Ga0126376_1053871623300010359Tropical Forest SoilVTRNVEYMLLGLGAAWLIMFTYVVLITLRERKLRKELDRVRRMVENPGK*
Ga0134125_1078156633300010371Terrestrial SoilMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVENPG
Ga0105239_1022379023300010375Corn RhizosphereMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRNMVEHPQK*
Ga0136449_10021272733300010379Peatlands SoilMLLGLGAAWLIMFIYVVLITLRERKLHKELDRVRRMVEHPNK*
Ga0134124_1271404223300010397Terrestrial SoilMLLGLGAAWLIMFIYVILITLRERKLRKELDRVRRMVEK*
Ga0134127_1039367923300010399Terrestrial SoilMLLGLGAAWLIMFTYVVLITLRERKLRKELDRVRRMVESSSAER*
Ga0137438_117691823300011431SoilMNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVEK*
Ga0137373_1088598323300012532Vadose Zone SoilMNRNVQYMLLGLGAAWLIMFAYVVLITLRERKLRKELDRVRKMVETPNK*
Ga0168317_100830643300012982Weathered Mine TailingsMLLGLGAAWLIMFIYVILITLRERKLRKELDRVRRMVESSSTDR*
Ga0157369_1229979213300013105Corn RhizosphereMLLGLGAAWLIMFIYVILITLRERKLRKELDRVRHMVEHPQK*
Ga0157374_1103039413300013296Miscanthus RhizosphereMLLGLGAAWLIMFIYVILITLRERKLRKELDRVRRMVEQPNK*
Ga0157378_1090494313300013297Miscanthus RhizosphereMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVEQPNR*
Ga0157378_1144617823300013297Miscanthus RhizosphereMLYGLMAAWLIVVVYVVHLTLRESRLRKELDRVRRIVESGEKRS*
Ga0157378_1305047513300013297Miscanthus RhizosphereMLLGLGAAWLIMFIYVVLITLRERKLRKELDRGRRMVENPGK*
Ga0157372_1002570383300013307Corn RhizosphereMLLGLGAAWLIMFLYVVLITLRERKLRKELDRVRKMVETSNK*
Ga0157380_1141330513300014326Switchgrass RhizosphereMLYGLMAAWLIVVLYVVHLTLRENRLRKELDRVRRMVES
Ga0157376_1198154623300014969Miscanthus RhizosphereMNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRV
Ga0187775_1025214113300017939Tropical PeatlandMNRNVEYMLLGLGAAWLIMFIYVVLITLRERKLHKELDRVRRMVEHPDK
Ga0187779_1065604113300017959Tropical PeatlandRNRHSSQDGARPVTRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVEK
Ga0187781_1021068023300017972Tropical PeatlandMMGFMAAWIIIVVYVITIVLRESKLRRELDRVRRMVETPSKR
Ga0210399_1154546413300020581SoilMNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRM
Ga0210404_1076428023300021088SoilVNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVENPNR
Ga0210406_1013911023300021168SoilMNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVESSDK
Ga0210400_1006317033300021170SoilMENRNVTFMIYGLVAAWLIVLGYVVLLALRERKLRKELDRVRHMVEGGKQS
Ga0210400_1008705233300021170SoilVNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVESSDK
Ga0210393_1062656823300021401SoilMENRNVTFMIYGLVAAWLIVLGYVVLLALRERKLRKELDRVRHMVEGGKR
Ga0210385_1072602523300021402SoilMENRNVTFMIYGLVAAWLVVLGYVVLLALRERKLRKELDRVRHMVESGKH
Ga0210394_1057133213300021420SoilARTVNRNVQYMLLGLGAAWLIMFTYVVLITLRERKLRKELDRVRRMVENADK
Ga0210394_1103563413300021420SoilMIYGLVAAWLVVLGYVVLLALRERKLRKELDRVRHMVETTKRS
Ga0210394_1134083113300021420SoilVNRNVQYMLMGLGAAWLIMFTYVVLITLRERKLRKELDRVRRMVENSDK
Ga0210409_1070202013300021559SoilVQFMLLGLGAAWMIMFIYVVLITLRERKLRKELDRVRRMVENPNK
Ga0209483_10000131353300025862Arctic Peat SoilVNRNVEYMLLGLGAAWLIMFTYVVLITLRERKLRKELDRVRRMVENPDR
Ga0207642_1015935023300025899Miscanthus RhizosphereMLLGLGAAWLIMFLYVVLITLRERKLRKELDRVRKMVETPNK
Ga0207642_1055482923300025899Miscanthus RhizosphereMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVENPGK
Ga0207680_1014155013300025903Switchgrass RhizosphereGLGAAWLIMFLYVVLITLRERKLRKELDRVRKMVETPNK
Ga0207654_1005950943300025911Corn RhizosphereMLLGLGAAWLIMFTYVVLITLRERKLRKELDRVRRMVESASADR
Ga0207707_1055618923300025912Corn RhizosphereMNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRKMVETPNK
Ga0207695_1001517953300025913Corn RhizosphereMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVEHPNK
Ga0207695_1073224323300025913Corn RhizosphereMLLGLGAAWLIMFLYVVLITLRERRLRKELDRVRKMVETPNK
Ga0207695_1089895613300025913Corn RhizosphereMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRHMVEHPQK
Ga0207671_1014851723300025914Corn RhizosphereVNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRHMVEHPQK
Ga0207657_1026126313300025919Corn RhizosphereVNRNVQYMLLGLGAAWLIMFLYVVLITLRERKLRKELDRVRKMVETPNK
Ga0207694_1001707133300025924Corn RhizosphereMNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVEQPNK
Ga0207687_10002434123300025927Miscanthus RhizosphereMNRNVQYMLLGLGAAWLIMFLYVVLITLRERKLRKELDRVRKMVETPHK
Ga0207687_1014651823300025927Miscanthus RhizosphereMLLGLGAAWLIMFLYVVLITLRERKLRKELDRVRKMVEAPNK
Ga0207686_1034315723300025934Miscanthus RhizosphereMLLGLGAAWLIMFAYVVLITLRERKLRKELDRVRKMVETPNK
Ga0207691_1130583013300025940Miscanthus RhizosphereGAAWLIMFIYVVLITLRERKLRKELDRVRRMVENPGK
Ga0207711_1091388023300025941Switchgrass RhizosphereAWLIMFLYVVLITLRERKLRKELDRVRKMVETPNK
Ga0207689_1054471113300025942Miscanthus RhizosphereMNRNVQYMLLGLGAAWLIMFLYVVLITLRERKLRKELDRVRKMVE
Ga0207661_1002604433300025944Corn RhizosphereVNRNVQYMLLGLGAAWLIMFIYVILITLRERKLRKELDRVRRMVEQPNK
Ga0207677_1121198723300026023Miscanthus RhizosphereLGLGAAWLIMFIYVILITLRERKLRKELDRVRRMVEQPNK
Ga0207677_1154888223300026023Miscanthus RhizosphereMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVE
Ga0207703_1211233723300026035Switchgrass RhizosphereMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVEHSDK
Ga0207641_1084701123300026088Switchgrass RhizosphereMLLGLGAAWLIMFLYVVLITLRERNLRKELDRVRKMVETPNK
Ga0207648_1021078823300026089Miscanthus RhizosphereMLLGLGAAWLIMFIYVVLITLRERRLRKELDRVRRMVEK
Ga0207648_1158386913300026089Miscanthus RhizosphereMNRNVQYMLLGLGAAWLIMFLYVVLITLRERKLRKELDRVRKMVETPN
Ga0207674_1048277123300026116Corn RhizosphereLGAAWLIMFLYVVLITLRERKLRKELDRVRKMVETPNK
Ga0207674_1135545823300026116Corn RhizosphereMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVETPDK
Ga0179593_117267123300026555Vadose Zone SoilMLLGLGAAWLIMFTYVVLITLRERKLRKELDRVRRMVENPNK
Ga0209178_139048223300027725Agricultural SoilMNRNVEYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVETSSTEPRNS
Ga0209517_1000386073300027854Peatlands SoilMNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVEHSGK
Ga0209579_1035057913300027869Surface SoilRNIEFMLYGLTAAWLIVVVYVVLLSLRDRKLRKELDRVRRMVETAEKPK
Ga0209068_1003121723300027894WatershedsMLEARNLTYMFYGFSAWFLILLGYVVLLALRERKLRGELDRVRRMVETPK
Ga0209168_1008429623300027986Surface SoilMLFGLGAAWLIMFAYVVLITLRERKLRKELDRVRRMVEHPQK
Ga0268264_1000712993300028381Switchgrass RhizosphereMNRNVQYMLLGLGAAWLIMFLYVVLITLRERKLRKELDRVRKMVETPNK
Ga0222749_1007551413300029636SoilMLYGLMAAWLIVVVYVALITLRERRLRKELDRVRRMVESGEKRP
Ga0170824_12013898413300031231Forest SoilVTFMIYGLVAAWLIVLGYVVLLALRERKLRKELDRVRHMLEGGKHS
Ga0170824_12891734023300031231Forest SoilMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVESSDK
Ga0265331_1037444123300031250RhizosphereMLLGLGAAWLIMFIYVILITLRERKLRKELDRVRRMVEHPNK
Ga0170818_11153797013300031474Forest SoilMLLGLGAAWLIMFTYVVIITFRERKLRRELDRVRRMVENPDK
Ga0265313_1000179973300031595RhizosphereVNRNVQYMLLGLGAAWLIMFTYVVLITLRERKLRKELDRVRRMVENADK
Ga0265314_10001307113300031711RhizosphereVNRNVQYMLLGLGAAWLIMFTYVVLITLRERKLRKELDRVRRMVEHSDK
Ga0307469_1033349633300031720Hardwood Forest SoilMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVESTDK
Ga0307469_1123448923300031720Hardwood Forest SoilMNRNVQYMLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVENPNK
Ga0307468_10164126513300031740Hardwood Forest SoilMLLGLGAAWLVMMIYVVLITLRERKLRKELDRVRRMVENPNK
Ga0308175_10023692113300031938SoilVNRNVQYMLLGLGAAWLIMFIYVILITLRERKLRKELDRVRRMVEHPNK
Ga0307471_10154763023300032180Hardwood Forest SoilMNRNVQYMLLGLGAAWMIMFIYVVIITLRERKLRKELDRVRRMVESSDK
Ga0310812_1052588923300032421SoilMLLGLGAAWLIMFTYVVLITLRERKLRKELDRVRRMVENPDK
Ga0335080_1171467823300032828SoilMENRNVTFMIYGLVAAWLIVLGYVVLLALRERKLRKELDRVRHMVETTKKP
Ga0335077_1065620223300033158SoilMIYGLVAAWLIVLGYVVLLALRERKLRKELDRVRHMVETTKKP
Ga0310810_1072206023300033412SoilLLGLGAAWLIMFIYVVLITLRERKLRKELDRVRRMVESSSEPRA
Ga0326726_1023283623300033433Peat SoilMDNRNVTFMIYGLVAAWLVVLGYVVLLALRERKLRKELDRVRNMVEGGKQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.