Basic Information | |
---|---|
Family ID | F043582 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 156 |
Average Sequence Length | 38 residues |
Representative Sequence | MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR |
Number of Associated Samples | 125 |
Number of Associated Scaffolds | 156 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 67.95 % |
% of genes near scaffold ends (potentially truncated) | 34.62 % |
% of genes from short scaffolds (< 2000 bps) | 71.15 % |
Associated GOLD sequencing projects | 120 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (87.179 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (8.333 % of family members) |
Environment Ontology (ENVO) | Unclassified (39.744 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.590 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 43.08% β-sheet: 0.00% Coil/Unstructured: 56.92% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 156 Family Scaffolds |
---|---|---|
PF00294 | PfkB | 54.49 |
PF04392 | ABC_sub_bind | 8.33 |
PF01522 | Polysacc_deac_1 | 3.85 |
PF01832 | Glucosaminidase | 3.21 |
PF01925 | TauE | 2.56 |
PF02630 | SCO1-SenC | 2.56 |
PF04536 | TPM_phosphatase | 1.28 |
PF07859 | Abhydrolase_3 | 1.28 |
PF06559 | DCD | 1.28 |
PF03330 | DPBB_1 | 1.28 |
PF02737 | 3HCDH_N | 0.64 |
PF00155 | Aminotran_1_2 | 0.64 |
PF04820 | Trp_halogenase | 0.64 |
PF00528 | BPD_transp_1 | 0.64 |
PF13416 | SBP_bac_8 | 0.64 |
PF13641 | Glyco_tranf_2_3 | 0.64 |
PF13683 | rve_3 | 0.64 |
PF00069 | Pkinase | 0.64 |
PF06532 | NrsF | 0.64 |
PF03960 | ArsC | 0.64 |
PF08501 | Shikimate_dh_N | 0.64 |
PF00884 | Sulfatase | 0.64 |
PF14707 | Sulfatase_C | 0.64 |
PF13185 | GAF_2 | 0.64 |
PF03734 | YkuD | 0.64 |
COG ID | Name | Functional Category | % Frequency in 156 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 8.33 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 3.85 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.56 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 2.56 |
COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 2.56 |
COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 2.56 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 1.28 |
COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 1.28 |
COG0169 | Shikimate 5-dehydrogenase | Amino acid transport and metabolism [E] | 0.64 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.64 |
COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.64 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.64 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.64 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.64 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.64 |
COG1393 | Arsenate reductase or related protein, glutaredoxin family | Inorganic ion transport and metabolism [P] | 0.64 |
COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.64 |
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.64 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.64 |
COG4944 | Uncharacterized conserved protein | Function unknown [S] | 0.64 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 87.18 % |
Unclassified | root | N/A | 12.82 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2035918004|FACENC_F56XM5W01ER7A8 | Not Available | 538 | Open in IMG/M |
2088090015|GPICI_9105347 | All Organisms → cellular organisms → Bacteria | 2305 | Open in IMG/M |
2124908007|FWIRElOz_GKZ9IRQ02IE3PB | Not Available | 501 | Open in IMG/M |
2166559005|cont_contig04015 | All Organisms → cellular organisms → Bacteria | 2135 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_104402851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 708 | Open in IMG/M |
3300000580|AF_2010_repII_A01DRAFT_1000071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 11358 | Open in IMG/M |
3300000787|JGI11643J11755_11672788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 530 | Open in IMG/M |
3300000789|JGI1027J11758_13009615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Limibacillus → Limibacillus halophilus | 618 | Open in IMG/M |
3300005162|Ga0066814_10075203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 598 | Open in IMG/M |
3300005164|Ga0066815_10118138 | Not Available | 513 | Open in IMG/M |
3300005335|Ga0070666_10104526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1955 | Open in IMG/M |
3300005344|Ga0070661_100149937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1762 | Open in IMG/M |
3300005436|Ga0070713_100290392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1502 | Open in IMG/M |
3300005440|Ga0070705_100355929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1069 | Open in IMG/M |
3300005529|Ga0070741_10008696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 20180 | Open in IMG/M |
3300005543|Ga0070672_100198839 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
3300005545|Ga0070695_101222692 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300005548|Ga0070665_101599679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 659 | Open in IMG/M |
3300005563|Ga0068855_100808870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 995 | Open in IMG/M |
3300005564|Ga0070664_100140248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2128 | Open in IMG/M |
3300005564|Ga0070664_100395948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1262 | Open in IMG/M |
3300005564|Ga0070664_100976821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 795 | Open in IMG/M |
3300005577|Ga0068857_101179548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 741 | Open in IMG/M |
3300005614|Ga0068856_100038186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4714 | Open in IMG/M |
3300005616|Ga0068852_101915483 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300005713|Ga0066905_100039940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2769 | Open in IMG/M |
3300005713|Ga0066905_100082204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2121 | Open in IMG/M |
3300005713|Ga0066905_100271137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1316 | Open in IMG/M |
3300005764|Ga0066903_100020190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7057 | Open in IMG/M |
3300005764|Ga0066903_100071653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4440 | Open in IMG/M |
3300005764|Ga0066903_101537904 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
3300005764|Ga0066903_101793804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1172 | Open in IMG/M |
3300005843|Ga0068860_101369689 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300005843|Ga0068860_101748317 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300005937|Ga0081455_10009806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9809 | Open in IMG/M |
3300005937|Ga0081455_10056319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 3340 | Open in IMG/M |
3300006058|Ga0075432_10461172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Limibacillus → Limibacillus halophilus | 559 | Open in IMG/M |
3300006172|Ga0075018_10661861 | Not Available | 561 | Open in IMG/M |
3300006573|Ga0074055_11825707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1712 | Open in IMG/M |
3300006575|Ga0074053_11169861 | Not Available | 555 | Open in IMG/M |
3300006575|Ga0074053_11929796 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300006575|Ga0074053_11959199 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300006852|Ga0075433_11016597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 722 | Open in IMG/M |
3300006953|Ga0074063_12876833 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 887 | Open in IMG/M |
3300006954|Ga0079219_10114304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1359 | Open in IMG/M |
3300006954|Ga0079219_11788916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 574 | Open in IMG/M |
3300009093|Ga0105240_11531019 | Not Available | 699 | Open in IMG/M |
3300009094|Ga0111539_10613775 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
3300009100|Ga0075418_12960309 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300009101|Ga0105247_10068361 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2215 | Open in IMG/M |
3300009147|Ga0114129_10126149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3518 | Open in IMG/M |
3300009156|Ga0111538_10673583 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
3300009553|Ga0105249_13111672 | Not Available | 533 | Open in IMG/M |
3300009792|Ga0126374_10002980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 5462 | Open in IMG/M |
3300010043|Ga0126380_10010055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4204 | Open in IMG/M |
3300010043|Ga0126380_12265346 | Not Available | 503 | Open in IMG/M |
3300010046|Ga0126384_11935752 | Not Available | 562 | Open in IMG/M |
3300010047|Ga0126382_10023348 | All Organisms → cellular organisms → Bacteria | 3265 | Open in IMG/M |
3300010154|Ga0127503_11293979 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300010358|Ga0126370_10738322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Limibacillus → Limibacillus halophilus | 870 | Open in IMG/M |
3300010362|Ga0126377_12889313 | Not Available | 554 | Open in IMG/M |
3300010366|Ga0126379_12442110 | Not Available | 622 | Open in IMG/M |
3300010371|Ga0134125_10059041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4264 | Open in IMG/M |
3300010371|Ga0134125_10383790 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
3300010373|Ga0134128_10267530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1917 | Open in IMG/M |
3300010373|Ga0134128_11439687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 759 | Open in IMG/M |
3300010396|Ga0134126_10202657 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2373 | Open in IMG/M |
3300010398|Ga0126383_10030714 | All Organisms → cellular organisms → Bacteria | 4261 | Open in IMG/M |
3300010399|Ga0134127_11118712 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
3300010401|Ga0134121_10271627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1491 | Open in IMG/M |
3300010868|Ga0124844_1063379 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
3300011119|Ga0105246_10818849 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300012494|Ga0157341_1008095 | Not Available | 851 | Open in IMG/M |
3300012514|Ga0157330_1018255 | Not Available | 774 | Open in IMG/M |
3300012912|Ga0157306_10024059 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
3300012958|Ga0164299_10003718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4917 | Open in IMG/M |
3300012971|Ga0126369_13710461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 500 | Open in IMG/M |
3300012982|Ga0168317_1040548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1216 | Open in IMG/M |
3300012985|Ga0164308_10095760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2072 | Open in IMG/M |
3300013105|Ga0157369_12330764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 542 | Open in IMG/M |
3300013306|Ga0163162_10219798 | All Organisms → cellular organisms → Bacteria | 2030 | Open in IMG/M |
3300015371|Ga0132258_10462051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3166 | Open in IMG/M |
3300015371|Ga0132258_11570632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1661 | Open in IMG/M |
3300015371|Ga0132258_12943506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1182 | Open in IMG/M |
3300015371|Ga0132258_13736514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1038 | Open in IMG/M |
3300015374|Ga0132255_104083158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Limibacillus → Limibacillus halophilus | 619 | Open in IMG/M |
3300015374|Ga0132255_104235298 | Not Available | 608 | Open in IMG/M |
3300015374|Ga0132255_104487529 | Not Available | 592 | Open in IMG/M |
3300016404|Ga0182037_10000020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 59853 | Open in IMG/M |
3300017792|Ga0163161_10230645 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
3300017944|Ga0187786_10129221 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 888 | Open in IMG/M |
3300017947|Ga0187785_10000557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 13746 | Open in IMG/M |
3300017947|Ga0187785_10011055 | All Organisms → cellular organisms → Bacteria | 3066 | Open in IMG/M |
3300017947|Ga0187785_10016692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2561 | Open in IMG/M |
3300017970|Ga0187783_11007060 | Not Available | 600 | Open in IMG/M |
3300017973|Ga0187780_10165734 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
3300018029|Ga0187787_10000343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 7897 | Open in IMG/M |
3300018058|Ga0187766_11207278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Limibacillus → Limibacillus halophilus | 548 | Open in IMG/M |
3300018072|Ga0184635_10000047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 21495 | Open in IMG/M |
3300021344|Ga0193719_10080112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1419 | Open in IMG/M |
3300021560|Ga0126371_10029118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 5154 | Open in IMG/M |
3300021560|Ga0126371_10409043 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
3300021560|Ga0126371_10801852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1088 | Open in IMG/M |
3300022880|Ga0247792_1015398 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
3300023266|Ga0247789_1001398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3739 | Open in IMG/M |
3300024254|Ga0247661_1082457 | Not Available | 603 | Open in IMG/M |
3300025549|Ga0210094_1078621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-5 | 609 | Open in IMG/M |
3300025903|Ga0207680_11098360 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300025907|Ga0207645_10547803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 785 | Open in IMG/M |
3300025907|Ga0207645_10661499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
3300025911|Ga0207654_10893998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Limibacillus → Limibacillus halophilus | 644 | Open in IMG/M |
3300025912|Ga0207707_10661906 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300025915|Ga0207693_10062305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2922 | Open in IMG/M |
3300025916|Ga0207663_10603919 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300025918|Ga0207662_10876502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella | 635 | Open in IMG/M |
3300025919|Ga0207657_10052740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3528 | Open in IMG/M |
3300025927|Ga0207687_10226163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1476 | Open in IMG/M |
3300025932|Ga0207690_11219729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 628 | Open in IMG/M |
3300025933|Ga0207706_10142548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2108 | Open in IMG/M |
3300025936|Ga0207670_11098114 | Not Available | 671 | Open in IMG/M |
3300025937|Ga0207669_10313340 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
3300025938|Ga0207704_10347733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Limibacillus → Limibacillus halophilus | 1153 | Open in IMG/M |
3300025939|Ga0207665_10027282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3773 | Open in IMG/M |
3300025942|Ga0207689_10401495 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1143 | Open in IMG/M |
3300025972|Ga0207668_10230958 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
3300025972|Ga0207668_10392970 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300025972|Ga0207668_10429003 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300026089|Ga0207648_11252463 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300026740|Ga0207439_101903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 686 | Open in IMG/M |
3300026745|Ga0207576_102152 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300026786|Ga0207497_106143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 501 | Open in IMG/M |
3300028796|Ga0307287_10172740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
3300028802|Ga0307503_10002051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4740 | Open in IMG/M |
3300030829|Ga0308203_1037124 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300030844|Ga0075377_11101508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 611 | Open in IMG/M |
3300031226|Ga0307497_10009265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2748 | Open in IMG/M |
3300031538|Ga0310888_10055885 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
3300031544|Ga0318534_10032383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2860 | Open in IMG/M |
3300031547|Ga0310887_10108514 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
3300031716|Ga0310813_10133808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1974 | Open in IMG/M |
3300031716|Ga0310813_11097604 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300031879|Ga0306919_10078829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2265 | Open in IMG/M |
3300031940|Ga0310901_10049945 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
3300031944|Ga0310884_10469351 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300031996|Ga0308176_11123144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 832 | Open in IMG/M |
3300032122|Ga0310895_10001688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 5711 | Open in IMG/M |
3300032205|Ga0307472_100335661 | Not Available | 1233 | Open in IMG/M |
3300032770|Ga0335085_10041863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 6274 | Open in IMG/M |
3300033004|Ga0335084_10043272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4636 | Open in IMG/M |
3300033004|Ga0335084_11189224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 762 | Open in IMG/M |
3300033004|Ga0335084_11320229 | Not Available | 717 | Open in IMG/M |
3300033412|Ga0310810_10161466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2589 | Open in IMG/M |
3300033433|Ga0326726_10001545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 21360 | Open in IMG/M |
3300033433|Ga0326726_10240769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1682 | Open in IMG/M |
3300033513|Ga0316628_101831411 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300034817|Ga0373948_0028991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1105 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.77% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.13% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.13% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.49% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.49% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.85% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.28% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.28% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.28% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.28% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.28% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.28% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.28% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.28% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.28% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.28% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.64% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.64% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.64% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.64% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.64% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.64% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.64% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.64% |
Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.64% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.64% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.64% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.64% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.64% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
2124908007 | Soil microbial communities from sample at FACE Site Metagenome WIR_ElevOz2 | Environmental | Open in IMG/M |
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Host-Associated | Open in IMG/M |
3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026740 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A1w-12 (SPAdes) | Environmental | Open in IMG/M |
3300026745 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08K1-12 (SPAdes) | Environmental | Open in IMG/M |
3300026786 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-11 (SPAdes) | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FACENCA_6470570 | 2035918004 | Soil | MKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPTSQR |
GPICI_00450640 | 2088090015 | Soil | MPLLFYFPYIVWMGMMQIVQDEMRVPVKIKARPPIRH |
FWIRElOz_09810590 | 2124908007 | Soil | MPLLFYFPLIVWMGMMEIANDEMRVPVDVRTRPPARR |
cont_0015.00000590 | 2166559005 | Simulated | MPLLFYFPFIVWMGLMEIAQDEMRVPVRVKTRSTSQH |
INPhiseqgaiiFebDRAFT_1044028511 | 3300000364 | Soil | MPLLLYFPLIIWMGMLGAMQDEMRPATAKVRRRN* |
AF_2010_repII_A01DRAFT_10000713 | 3300000580 | Forest Soil | MPLLFYFPFIVWMGLMEIAQDEMRVPVRVKTRTATQR* |
JGI11643J11755_116727881 | 3300000787 | Soil | MPLLFYFPYIVWMGMMQIVHDEMRVPVKIKARPPVRH* |
JGI1027J11758_130096152 | 3300000789 | Soil | MPLLFYFPYIVWMGMMQIVQDEMRVPVKIKARPPIRH* |
Ga0066814_100752032 | 3300005162 | Soil | LGFRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPIKVKARPPSQR* |
Ga0066815_101181382 | 3300005164 | Soil | LEFRTDARYKKMPLLFYFPFIVWMGMMEIAQDEMRAPVRVKAQKPSQR* |
Ga0070666_101045263 | 3300005335 | Switchgrass Rhizosphere | LGFRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR* |
Ga0070661_1001499373 | 3300005344 | Corn Rhizosphere | LGFRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPIKVKA* |
Ga0070713_1002903923 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AQKMPLLFYFPLIIWMGMMEIAHDEMRVPVNDRTRTPARR* |
Ga0070705_1003559293 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPTSQR* |
Ga0070741_1000869623 | 3300005529 | Surface Soil | MPLLFYFPLIVWMGMAEIMRDEMKVPDTADTRRRTQKQ* |
Ga0070672_1001988393 | 3300005543 | Miscanthus Rhizosphere | MPLLFYFPFIVWMGLMEVAQDEMRIPIKVKARPPSQR* |
Ga0070695_1012226922 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRDTKMPLLFYFPLIVWMGMLEAMQDEMRVPVTAKPRR* |
Ga0070665_1015996792 | 3300005548 | Switchgrass Rhizosphere | MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR* |
Ga0068855_1008088701 | 3300005563 | Corn Rhizosphere | KKMPLLFYFPLIIWMGVLEAMQDEMRVAATAKARR* |
Ga0070664_1001402482 | 3300005564 | Corn Rhizosphere | MPLLFYFPLIVWMGMLGALQDEMRVPATVKARREV* |
Ga0070664_1003959483 | 3300005564 | Corn Rhizosphere | MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTAQR* |
Ga0070664_1009768211 | 3300005564 | Corn Rhizosphere | KMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR* |
Ga0068857_1011795482 | 3300005577 | Corn Rhizosphere | LGFRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTAQR* |
Ga0068856_1000381866 | 3300005614 | Corn Rhizosphere | MPLLFYFPLIIWMGMMEIAHDEMRVPVNDRTRTPARR* |
Ga0068852_1019154831 | 3300005616 | Corn Rhizosphere | QKMPLLFYFPLIVWMGMLEAMQDEMRVPATAKPRR* |
Ga0066905_1000399402 | 3300005713 | Tropical Forest Soil | MPLLFYFPYIVWMGMMQLVQDEMRVPVKIKARPPVRN* |
Ga0066905_1000822044 | 3300005713 | Tropical Forest Soil | MPLLFYFPYIVWMGMMQLVQDEMRVPVKIKARPPIRH* |
Ga0066905_1002711372 | 3300005713 | Tropical Forest Soil | MPLLFYFPYIIWMGMMQIAQDEMRVPVKIKPRPPVRN* |
Ga0066903_1000201902 | 3300005764 | Tropical Forest Soil | MPLLFYFPFIIWTGMLQLAQDEMCVPAKVKAPVQR* |
Ga0066903_1000716536 | 3300005764 | Tropical Forest Soil | MPLLFYFPFIVWMGMLEIAQDEMRVPVKVRTPVPR* |
Ga0066903_1015379042 | 3300005764 | Tropical Forest Soil | EMPLLFYFPFIIWMGMLEIAHDEMRVPIKVKAPVR* |
Ga0066903_1017938042 | 3300005764 | Tropical Forest Soil | MPLLLYFPLIIWMGMLEAMQDEMRPATAKVRRRN* |
Ga0068860_1013696892 | 3300005843 | Switchgrass Rhizosphere | MPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPTSQR* |
Ga0068860_1017483172 | 3300005843 | Switchgrass Rhizosphere | LLFYFPLIIWMGMMEIAHDEMRVPVNDRTRTPARR* |
Ga0081455_1000980611 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MPLLFYFPYIIWMGMMQIVQDEMRVPVKIKARPPVRN* |
Ga0081455_100563194 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MPLLFYFPYIVWMGMMQFVQDEMRVPVKIKARPPVRN* |
Ga0075432_104611721 | 3300006058 | Populus Rhizosphere | MPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARTPSQR* |
Ga0075018_106618612 | 3300006172 | Watersheds | MPLLFYFPLIIWMGMMEIAHDEMRGPVNVRTRTPARR* |
Ga0074055_118257071 | 3300006573 | Soil | QKMPLLFYFPLIIWMGMLEAMQDEMRVPATAKPRR* |
Ga0074053_111698612 | 3300006575 | Soil | MPLLFYFPFIVWMGMMEIAQDEMRAPVRVKAQKPSQR* |
Ga0074053_119297962 | 3300006575 | Soil | QKMPLLFYFPLIVWMGMLEAIQDEMRVPATAKARR* |
Ga0074053_119591991 | 3300006575 | Soil | KMPLLFYFPLIIWMGMMEIAHDEMRVPVNVRTRTPARR* |
Ga0075433_110165972 | 3300006852 | Populus Rhizosphere | LGFRTDARYKKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARTPSQR* |
Ga0074063_128768332 | 3300006953 | Soil | KGEKQKMPLLFYFPLIIWMGMLEAMQDEMRVPATAKPRR* |
Ga0079219_101143042 | 3300006954 | Agricultural Soil | MPLLLYFPLIVWMGLMGVAQDQMRVPVKVKATPSLPR* |
Ga0079219_117889162 | 3300006954 | Agricultural Soil | MPLLFYFPLIIWMGMLEAVQDEMRVPATVRVRRPDRRQ* |
Ga0105240_115310192 | 3300009093 | Corn Rhizosphere | MKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARTPSQR* |
Ga0111539_106137751 | 3300009094 | Populus Rhizosphere | TGTRDKKMPLFLYFPLIIWMGMLEAMQDEMRASAPVKLRR* |
Ga0075418_129603091 | 3300009100 | Populus Rhizosphere | MPLLFYFPYIVWMGMMQIVQDEMRVPVKIKARPPVRN* |
Ga0105247_100683615 | 3300009101 | Switchgrass Rhizosphere | MPLLFYFPLIIWMGMMEIAQDEMRAPVNVRTPTPARR* |
Ga0114129_101261491 | 3300009147 | Populus Rhizosphere | DNMPLLFYFPYIVWMGMMQLVQDEMRIPVKIKARPPARN* |
Ga0111538_106735832 | 3300009156 | Populus Rhizosphere | ARYMKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPTSQR* |
Ga0105249_131116722 | 3300009553 | Switchgrass Rhizosphere | MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTSQR* |
Ga0126374_100029802 | 3300009792 | Tropical Forest Soil | MPLLFYFPFIVWMGLMEIAQDEMRVPVRVKTRTPTQR* |
Ga0126380_100100553 | 3300010043 | Tropical Forest Soil | MPLLFYFPFIVWMGLIEIAQDEMRVPVRVKTRTPTQR* |
Ga0126380_122653462 | 3300010043 | Tropical Forest Soil | MPLLFYFPFIVWMGLMEVAQNEMRIPIKVKARTPSQR* |
Ga0126384_119357521 | 3300010046 | Tropical Forest Soil | MPLLFYFPYIIWMGMIELAQEEMRVAIKVKARPTARG* |
Ga0126382_100233483 | 3300010047 | Tropical Forest Soil | MPLLFYFPYIVWMGMMQFVQDEMRVPAKVKMRPPVRN* |
Ga0127503_112939791 | 3300010154 | Soil | QKMPLLFYFPLIIWMGMMEIAHDEMRVPVNARTRTPARR* |
Ga0126370_107383222 | 3300010358 | Tropical Forest Soil | MPLLFYFPFIVWMGLMEVAQDEMRVPVRVKTRAPTQR* |
Ga0126377_128893132 | 3300010362 | Tropical Forest Soil | MPLLFYFPFIVWMGMLEIAREEMRVPVKVKTPVRR* |
Ga0126379_124421102 | 3300010366 | Tropical Forest Soil | MPLLFYFPFIVWMGMLEIAQDEMRVPAKVRTPVPR* |
Ga0134125_100590412 | 3300010371 | Terrestrial Soil | MPLLLYFPLIIWMGMLEALRDETRVPATVKARRG* |
Ga0134125_103837902 | 3300010371 | Terrestrial Soil | MKMPLLFYFPFIVWMGLMEVAQDEMRIPIKVKARPPSQR* |
Ga0134128_102675302 | 3300010373 | Terrestrial Soil | MPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPPSQR* |
Ga0134128_114396871 | 3300010373 | Terrestrial Soil | LLLYFPLIVWMGLMGVAQDQMRVPVKVKATPSLPR* |
Ga0134126_102026572 | 3300010396 | Terrestrial Soil | MPLLFHFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR* |
Ga0126383_100307147 | 3300010398 | Tropical Forest Soil | MPLLFYFPYIVWMGMMQFVQDEMRVPAKVKARPPIRN* |
Ga0134127_111187123 | 3300010399 | Terrestrial Soil | MKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTSQR* |
Ga0134121_102716273 | 3300010401 | Terrestrial Soil | AQKMPLLFYFPLIIWMGMMEIAQDEMRAPVNVRTPTPARR* |
Ga0124844_10633793 | 3300010868 | Tropical Forest Soil | MPLLFYFPFIVWMGLMEIAQDEMRVPVMVKTRTPTQR* |
Ga0105246_108188491 | 3300011119 | Miscanthus Rhizosphere | KMPLLFYFPLIVWMGMLGALQDEMRVPATVKARREV* |
Ga0157341_10080952 | 3300012494 | Arabidopsis Rhizosphere | MPLLFYFPFIVWLGLMEVAQDEMRIPVKVKARPTAQR* |
Ga0157330_10182553 | 3300012514 | Soil | MPLLFYFPFIVWMGLMEVAQDEMRIPVNVKARPTAQR* |
Ga0157306_100240591 | 3300012912 | Soil | KMPLLFYFPLIVWMGMLEAMQDEMRVPVTAKPRR* |
Ga0164299_100037186 | 3300012958 | Soil | MPLLFYFPFIVWMFLLAVVQDEMRIPVKVKARPTSQR* |
Ga0126369_137104611 | 3300012971 | Tropical Forest Soil | MPLLFYFPFIVWMGMLEIAQDEMRVPVKVRTPVPR |
Ga0168317_10405482 | 3300012982 | Weathered Mine Tailings | MPMLLYFPLIIWMGMFGVVQDEMRVPVKAKASQRR* |
Ga0164308_100957602 | 3300012985 | Soil | MKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR* |
Ga0157369_123307641 | 3300013105 | Corn Rhizosphere | KMPLLFYFPLIVWMGMLEAMQDEMRVPATAKPRR* |
Ga0163162_102197984 | 3300013306 | Switchgrass Rhizosphere | MKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPPSQR* |
Ga0132258_104620513 | 3300015371 | Arabidopsis Rhizosphere | MPLLFYFPFIVWMGMLEIAHDEMRVPLKVKAPVGR* |
Ga0132258_115706321 | 3300015371 | Arabidopsis Rhizosphere | LALGFRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPIKVKARPPSQR* |
Ga0132258_129435062 | 3300015371 | Arabidopsis Rhizosphere | MPLLFYFPLIIWMGMMEIAHDEMRVPVNVRTRTLARP* |
Ga0132258_137365142 | 3300015371 | Arabidopsis Rhizosphere | MPLLFYFPLIVWMGMLEIAHDEMRVPLKTPVRRLDRELT* |
Ga0132255_1040831582 | 3300015374 | Arabidopsis Rhizosphere | FRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPIKVKARPPSQR* |
Ga0132255_1042352981 | 3300015374 | Arabidopsis Rhizosphere | MPLLFYFPFIVWMGLMEIAQDEMRVPVRVKTRTPTHG* |
Ga0132255_1044875292 | 3300015374 | Arabidopsis Rhizosphere | MPLLFYFPLIVWMGLMEVAQDEMRIPVKVKARPTAQR* |
Ga0182037_1000002026 | 3300016404 | Soil | MPLLLYFPFIVWMGLMEVAQDEMRVPVRVKTRTPTQR |
Ga0163161_102306451 | 3300017792 | Switchgrass Rhizosphere | DARYMKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPTAQR |
Ga0187786_101292212 | 3300017944 | Tropical Peatland | MPLLFYFPFIVWMGLMEVAQDEMRIPVRVKAQTPPHR |
Ga0187785_100005575 | 3300017947 | Tropical Peatland | MPLLLYFPLIIWIGMVEIVQGEMLTRAKSKVPTPPRRR |
Ga0187785_100110553 | 3300017947 | Tropical Peatland | MPLLFYFPLIVWMGLMEVAQDEMRIPVRVKAQTPPHR |
Ga0187785_100166924 | 3300017947 | Tropical Peatland | MPLLFYFPFIVWMGLMEVAQDEMRVPVRVKTRAPTQR |
Ga0187783_110070601 | 3300017970 | Tropical Peatland | MPLLFYFPFIVWMGMLEIAHDEMRVPLKVKAPVQR |
Ga0187780_101657343 | 3300017973 | Tropical Peatland | KREAYAMPLLLYFPLIVWMGMMEIARQEMHVPVRVKAQSRQQ |
Ga0187787_100003435 | 3300018029 | Tropical Peatland | MPLLLYFPLIIWMGMMEIVQGEMRVPVRTRVPTQPQR |
Ga0187766_112072781 | 3300018058 | Tropical Peatland | KMPLLFYFPFIVWMGLMEVAQDEMRIPVRVKAQTPPHR |
Ga0184635_1000004722 | 3300018072 | Groundwater Sediment | MPLLFYFPYIVWMGMMEYARDEGRVPVKIKTQPPPR |
Ga0193719_100801123 | 3300021344 | Soil | PLLFYFPLIIWMGMMEIAHDEMRGPVNVRTRTPARR |
Ga0126371_100291182 | 3300021560 | Tropical Forest Soil | MPLLFYFPFIIWMGMLEIAHDEMRVPIKVKAPVIRR |
Ga0126371_104090432 | 3300021560 | Tropical Forest Soil | MPLLFYFPFIVWMGLMEIAQDEMRVPVRVKTRTATQR |
Ga0126371_108018521 | 3300021560 | Tropical Forest Soil | MPLLFYFPYIIWMGMMQIVQDEMRVPVKIKARPPVRN |
Ga0247792_10153982 | 3300022880 | Soil | EKKMPLLFYFPLIIWMGVLEAMQDEMRVAATAKARR |
Ga0247789_10013985 | 3300023266 | Soil | TKMPLLFYFPLIVWMGMLEAMQDEMRVPVTAKPRR |
Ga0247661_10824571 | 3300024254 | Soil | MPLLFHFPFIVWMGLMEVAQDEMRIPVKVKARPTAQR |
Ga0210094_10786212 | 3300025549 | Natural And Restored Wetlands | MPLLFYFPLIIWMGMVEIMHDELRVPAKAKVGTPARL |
Ga0207680_110983602 | 3300025903 | Switchgrass Rhizosphere | KKMPLLFYFPLIIWMGVLEAIQDEMRVAATAKARR |
Ga0207645_105478032 | 3300025907 | Miscanthus Rhizosphere | MKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR |
Ga0207645_106614991 | 3300025907 | Miscanthus Rhizosphere | TVTRDAKMPLLFYFPLIVWMGMLEAMQDEMRVPVTAKPRR |
Ga0207654_108939982 | 3300025911 | Corn Rhizosphere | GFRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR |
Ga0207707_106619062 | 3300025912 | Corn Rhizosphere | EMPLLFYFPLIIWMGMMEIAQDEMRAPVNVRTPTPARR |
Ga0207693_100623052 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLLFYFPLIIWMGMMEIAHDEMRGPVNVRTRAPARR |
Ga0207663_106039192 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARTPSQR |
Ga0207662_108765022 | 3300025918 | Switchgrass Rhizosphere | MPLLFYFPLIIWMGMMEIAHDELRVPVNVRTRTPARR |
Ga0207657_100527401 | 3300025919 | Corn Rhizosphere | DARYKKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARTPSQR |
Ga0207687_102261633 | 3300025927 | Miscanthus Rhizosphere | EAQKMPLLFYFPLIIWMGMMEIAHDEMRVPVNDRTRTPARR |
Ga0207690_112197292 | 3300025932 | Corn Rhizosphere | MPLLFYFPLIVWMGMLGALQDEMRVPATVKARREV |
Ga0207706_101425482 | 3300025933 | Corn Rhizosphere | MPLLFYFPLIIWMGMMEIAQDEMRAPVNVRTPTPARR |
Ga0207670_110981141 | 3300025936 | Switchgrass Rhizosphere | MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQ |
Ga0207669_103133402 | 3300025937 | Miscanthus Rhizosphere | KKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR |
Ga0207704_103477332 | 3300025938 | Miscanthus Rhizosphere | MPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPPSQR |
Ga0207665_100272824 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLLFYFPLIIWMGMMEIAHDEMRVPVNVRTRTPARR |
Ga0207689_104014952 | 3300025942 | Miscanthus Rhizosphere | MKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARTPSQR |
Ga0207668_102309582 | 3300025972 | Switchgrass Rhizosphere | MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTSQR |
Ga0207668_103929701 | 3300025972 | Switchgrass Rhizosphere | TGREAQKMPLLFYFPLIIWMGMMEIAHDEMRVPVNGRTRTTARR |
Ga0207668_104290032 | 3300025972 | Switchgrass Rhizosphere | ARKKMPLLFYFPLIIWMGVLEAMQDEMRVAATAKARR |
Ga0207648_112524631 | 3300026089 | Miscanthus Rhizosphere | MPLLFYFPFIVWMGMMEIAQDEMRAPVRVKAQTPSQR |
Ga0207439_1019032 | 3300026740 | Soil | PQREKKMPLLFYFPLIIWMGVLEAMQDEMRVAATAKARR |
Ga0207576_1021521 | 3300026745 | Soil | QREKKMPLLFYFPLIIWMGVLEAMQDEMRVAATAKARR |
Ga0207497_1061432 | 3300026786 | Soil | IQKMPLLFYFPLIVWMGMLEAMQDEMRVPATAKPRR |
Ga0307287_101727402 | 3300028796 | Soil | MPLLFYFPYIIWMGMMEIVQDEMRAPVKIKAQTPARR |
Ga0307503_100020511 | 3300028802 | Soil | MPLLLYFPLIIWMGMLEVARSEIRSPAEAKVRVPTRR |
Ga0308203_10371241 | 3300030829 | Soil | KMPLLFYFPFIVWMGLMEIAQDEMRVPVRVKTRSTSQH |
Ga0075377_111015082 | 3300030844 | Soil | MPLLFYFPLIIWMGMMEIAHDEMRVPVNVRTPTPARR |
Ga0307497_100092653 | 3300031226 | Soil | MPLLFYFPFIVWMGLIEVVQDEMRIPVKVKARPTSQR |
Ga0310888_100558853 | 3300031538 | Soil | MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTAQR |
Ga0318534_100323833 | 3300031544 | Soil | MPLLFYFPFIVWMGLMEVAQDEMRVPVRVKTRTPTQR |
Ga0310887_101085141 | 3300031547 | Soil | RTDARYMKMPLLFYFPFIVWMGLIEVVQDEMRIPVKVKARPTSQR |
Ga0310813_101338083 | 3300031716 | Soil | EAQKMPLLFYFPLIIWMGMLEVAHDEMRVPVNVRTRTPARR |
Ga0310813_110976042 | 3300031716 | Soil | RYKKMPLLFYFPFIVWMGLMEVAQDEMRIPIKVKARPPSQR |
Ga0306919_100788291 | 3300031879 | Soil | ARYKKMPLLFYFPFIVWMGLMEVAQDEMRVPVRVKTRTPTQR |
Ga0310901_100499452 | 3300031940 | Soil | MKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTSQR |
Ga0310884_104693512 | 3300031944 | Soil | TVTRDTKMPLLFYFPLIVWMGMLEAMQDEMRVPVTAKPRR |
Ga0308176_111231442 | 3300031996 | Soil | MPLLLYFPLIVWVSMMEIVQQEMHIPVRVKAQVRQR |
Ga0310895_100016881 | 3300032122 | Soil | ITRDTKMPLLFYFPLIVWMGMLEAMQDEMRVPVTAKPRR |
Ga0307472_1003356613 | 3300032205 | Hardwood Forest Soil | MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPSSQR |
Ga0335085_100418637 | 3300032770 | Soil | MPLLLYFPLIIWMGMVEIVQGEMRVPAKTRVPTQPRR |
Ga0335084_100432724 | 3300033004 | Soil | MPLLFYFPLIIWMGMLEIVQDEMRVPARVRVPPQR |
Ga0335084_111892242 | 3300033004 | Soil | MPLLLYFPLIIWMGMLEAMQDEMRVPVTAKASAKSELS |
Ga0335084_113202292 | 3300033004 | Soil | MPLLLYFPLIVWMGMMEFAHQEMRVPVKVKAQSPQR |
Ga0310810_101614663 | 3300033412 | Soil | MPLLFYFPLIIWMGMLEVAHDEMRVPVNVRTRTPARR |
Ga0326726_100015452 | 3300033433 | Peat Soil | MPLLFYLPLIIWMGMVEIVQEEMRVPARVRVPPQRRRDA |
Ga0326726_102407693 | 3300033433 | Peat Soil | MPLLFYFPLIIWMGMVEIMHDELRVFAKAKVGTPARL |
Ga0316628_1018314112 | 3300033513 | Soil | MPLLFYFPLIVWMGMMEIMQDEMRVPAKIKARRSEQR |
Ga0373948_0028991_1000_1104 | 3300034817 | Rhizosphere Soil | MPLLFYFPLIIWMGMMEIAHDEMRVPVNVRTRTPA |
⦗Top⦘ |