NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F043555

Metagenome / Metatranscriptome Family F043555

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F043555
Family Type Metagenome / Metatranscriptome
Number of Sequences 156
Average Sequence Length 37 residues
Representative Sequence ALTVLSFAVHVLFSPWLLVAIAILAWIKFRPRRSHR
Number of Associated Samples 127
Number of Associated Scaffolds 156

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.71 %
% of genes near scaffold ends (potentially truncated) 78.21 %
% of genes from short scaffolds (< 2000 bps) 84.62 %
Associated GOLD sequencing projects 121
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.256 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(22.436 % of family members)
Environment Ontology (ENVO) Unclassified
(23.718 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.282 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 42.19%    β-sheet: 0.00%    Coil/Unstructured: 57.81%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 156 Family Scaffolds
PF04024PspC 5.13
PF01039Carboxyl_trans 2.56
PF01904DUF72 2.56
PF13191AAA_16 1.92
PF13474SnoaL_3 1.92
PF00903Glyoxalase 1.92
PF00440TetR_N 1.92
PF13160DUF3995 1.92
PF06224HTH_42 1.28
PF01243Putative_PNPOx 1.28
PF00027cNMP_binding 1.28
PF07045DUF1330 1.28
PF01565FAD_binding_4 1.28
PF05096Glu_cyclase_2 1.28
PF00406ADK 1.28
PF13649Methyltransf_25 1.28
PF00291PALP 1.28
PF13365Trypsin_2 1.28
PF00501AMP-binding 0.64
PF06441EHN 0.64
PF00196GerE 0.64
PF00582Usp 0.64
PF04471Mrr_cat 0.64
PF03795YCII 0.64
PF14833NAD_binding_11 0.64
PF01520Amidase_3 0.64
PF03364Polyketide_cyc 0.64
PF00583Acetyltransf_1 0.64
PF12680SnoaL_2 0.64
PF12441CopG_antitoxin 0.64
PF00805Pentapeptide 0.64
PF13549ATP-grasp_5 0.64
PF13565HTH_32 0.64
PF13714PEP_mutase 0.64
PF03176MMPL 0.64
PF13377Peripla_BP_3 0.64
PF00248Aldo_ket_red 0.64
PF13460NAD_binding_10 0.64
PF01381HTH_3 0.64
PF06769YoeB_toxin 0.64
PF04672Methyltransf_19 0.64
PF05638T6SS_HCP 0.64
PF09286Pro-kuma_activ 0.64
PF11139SfLAP 0.64
PF00999Na_H_Exchanger 0.64
PF01872RibD_C 0.64
PF09594GT87 0.64
PF08241Methyltransf_11 0.64
PF02781G6PD_C 0.64
PF02589LUD_dom 0.64
PF01513NAD_kinase 0.64
PF03466LysR_substrate 0.64
PF05685Uma2 0.64
PF00561Abhydrolase_1 0.64

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 156 Family Scaffolds
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 2.56
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 2.56
COG1801Sugar isomerase-related protein YecE, UPF0759/DUF72 familyGeneral function prediction only [R] 2.56
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 2.56
COG0563Adenylate kinase or related kinaseNucleotide transport and metabolism [F] 1.28
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 1.28
COG3823Glutamine cyclotransferasePosttranslational modification, protein turnover, chaperones [O] 1.28
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 1.28
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.64
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.64
COG0364Glucose-6-phosphate 1-dehydrogenaseCarbohydrate transport and metabolism [G] 0.64
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.64
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 0.64
COG0860N-acetylmuramoyl-L-alanine amidaseCell wall/membrane/envelope biogenesis [M] 0.64
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.64
COG1357Uncharacterized conserved protein YjbI, contains pentapeptide repeatsFunction unknown [S] 0.64
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.64
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.64
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.64
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.64
COG3157Type VI protein secretion system component Hcp (secreted cytotoxin)Intracellular trafficking, secretion, and vesicular transport [U] 0.64
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.64
COG4115Toxin component of the Txe-Axe toxin-antitoxin module, Txe/YoeB familyDefense mechanisms [V] 0.64
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 0.64
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.64
COG4934Serine protease, subtilase familyPosttranslational modification, protein turnover, chaperones [O] 0.64


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.26 %
UnclassifiedrootN/A39.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459023|GZGNO2B01D46RUNot Available537Open in IMG/M
3300005555|Ga0066692_10742954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae606Open in IMG/M
3300005614|Ga0068856_100835091Not Available940Open in IMG/M
3300005618|Ga0068864_102179697Not Available560Open in IMG/M
3300005764|Ga0066903_108974779Not Available506Open in IMG/M
3300005994|Ga0066789_10134476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Ea1.121054Open in IMG/M
3300005994|Ga0066789_10210673Not Available818Open in IMG/M
3300006028|Ga0070717_10230818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1629Open in IMG/M
3300006028|Ga0070717_10412328Not Available1214Open in IMG/M
3300006755|Ga0079222_12194772All Organisms → cellular organisms → Bacteria → PVC group549Open in IMG/M
3300006914|Ga0075436_100130555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1762Open in IMG/M
3300006914|Ga0075436_100424513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria966Open in IMG/M
3300006954|Ga0079219_11808763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae572Open in IMG/M
3300007258|Ga0099793_10497189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria606Open in IMG/M
3300009520|Ga0116214_1114356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria995Open in IMG/M
3300009522|Ga0116218_1085238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Allocatelliglobosispora → Allocatelliglobosispora scoriae1439Open in IMG/M
3300009522|Ga0116218_1485946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia550Open in IMG/M
3300009672|Ga0116215_1034262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces2332Open in IMG/M
3300009683|Ga0116224_10198213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria962Open in IMG/M
3300009698|Ga0116216_10549509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii697Open in IMG/M
3300009700|Ga0116217_10682430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii636Open in IMG/M
3300010043|Ga0126380_10654909Not Available837Open in IMG/M
3300010043|Ga0126380_11512396Not Available595Open in IMG/M
3300010046|Ga0126384_10993400Not Available764Open in IMG/M
3300010047|Ga0126382_10825559All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Labilitrichaceae → Labilithrix → Labilithrix luteola793Open in IMG/M
3300010358|Ga0126370_10116769All Organisms → cellular organisms → Bacteria → Terrabacteria group1882Open in IMG/M
3300010358|Ga0126370_11277427Not Available687Open in IMG/M
3300010358|Ga0126370_12539601Not Available511Open in IMG/M
3300010360|Ga0126372_13050504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum520Open in IMG/M
3300010361|Ga0126378_10303833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1699Open in IMG/M
3300010361|Ga0126378_11576412Not Available745Open in IMG/M
3300010361|Ga0126378_13431079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii503Open in IMG/M
3300010362|Ga0126377_11719604Not Available702Open in IMG/M
3300010371|Ga0134125_10369169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1592Open in IMG/M
3300010373|Ga0134128_11374542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria778Open in IMG/M
3300010375|Ga0105239_12734563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces576Open in IMG/M
3300010376|Ga0126381_102406629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia755Open in IMG/M
3300010376|Ga0126381_104113314All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300010379|Ga0136449_100749788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1625Open in IMG/M
3300010379|Ga0136449_102055876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea841Open in IMG/M
3300010379|Ga0136449_103237559Not Available628Open in IMG/M
3300010396|Ga0134126_12793162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales529Open in IMG/M
3300010876|Ga0126361_11107818Not Available973Open in IMG/M
3300010880|Ga0126350_12000517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia794Open in IMG/M
3300011270|Ga0137391_10980510Not Available688Open in IMG/M
3300012349|Ga0137387_10798677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium683Open in IMG/M
3300012350|Ga0137372_10058766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3358Open in IMG/M
3300012350|Ga0137372_10153996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1875Open in IMG/M
3300012359|Ga0137385_10569246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium954Open in IMG/M
3300012917|Ga0137395_10899805All Organisms → cellular organisms → Bacteria → Terrabacteria group640Open in IMG/M
3300012971|Ga0126369_11348044Not Available803Open in IMG/M
3300014654|Ga0181525_10328943All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300015371|Ga0132258_11113478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1996Open in IMG/M
3300016270|Ga0182036_10269485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1283Open in IMG/M
3300016270|Ga0182036_10885645Not Available731Open in IMG/M
3300016319|Ga0182033_10068676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2487Open in IMG/M
3300016319|Ga0182033_12174924Not Available506Open in IMG/M
3300016422|Ga0182039_10575514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia982Open in IMG/M
3300017937|Ga0187809_10210556All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300017955|Ga0187817_10271704All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300017959|Ga0187779_10340693Not Available967Open in IMG/M
3300018017|Ga0187872_10341061Not Available645Open in IMG/M
3300020081|Ga0206354_11160321Not Available512Open in IMG/M
3300020582|Ga0210395_10038672Not Available3497Open in IMG/M
3300021181|Ga0210388_10768992Not Available836Open in IMG/M
3300021377|Ga0213874_10241968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia662Open in IMG/M
3300021401|Ga0210393_11257005All Organisms → cellular organisms → Bacteria → Terrabacteria group595Open in IMG/M
3300021402|Ga0210385_10119011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1862Open in IMG/M
3300021405|Ga0210387_11477743All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300021407|Ga0210383_10955561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia728Open in IMG/M
3300021432|Ga0210384_11479398Not Available584Open in IMG/M
3300021433|Ga0210391_10154335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1808Open in IMG/M
3300021475|Ga0210392_10294136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → Curtobacterium flaccumfaciens1162Open in IMG/M
3300021559|Ga0210409_11250468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia618Open in IMG/M
3300021560|Ga0126371_11630654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia770Open in IMG/M
3300021560|Ga0126371_13132603All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300021560|Ga0126371_13513232Not Available529Open in IMG/M
3300025910|Ga0207684_11033026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia686Open in IMG/M
3300025910|Ga0207684_11516944Not Available545Open in IMG/M
3300025916|Ga0207663_10493950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium950Open in IMG/M
3300025919|Ga0207657_10523549Not Available928Open in IMG/M
3300025920|Ga0207649_10304702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1166Open in IMG/M
3300025929|Ga0207664_10209458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1686Open in IMG/M
3300025929|Ga0207664_10631726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium962Open in IMG/M
3300025932|Ga0207690_11425219Not Available579Open in IMG/M
3300025961|Ga0207712_10943139All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300026078|Ga0207702_10350446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae1413Open in IMG/M
3300026214|Ga0209838_1007722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1489Open in IMG/M
3300026310|Ga0209239_1191587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria752Open in IMG/M
3300026557|Ga0179587_10301323Not Available1033Open in IMG/M
3300027497|Ga0208199_1059191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia812Open in IMG/M
3300027505|Ga0209218_1093860Not Available625Open in IMG/M
3300027768|Ga0209772_10051251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1228Open in IMG/M
3300027824|Ga0209040_10064879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2152Open in IMG/M
3300027855|Ga0209693_10276628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia821Open in IMG/M
3300027855|Ga0209693_10408712Not Available655Open in IMG/M
3300027910|Ga0209583_10108481Not Available1081Open in IMG/M
3300029882|Ga0311368_10672852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia719Open in IMG/M
3300029922|Ga0311363_10716580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia944Open in IMG/M
3300029951|Ga0311371_12470756Not Available530Open in IMG/M
3300030007|Ga0311338_10929835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia851Open in IMG/M
3300030013|Ga0302178_10324983Not Available702Open in IMG/M
3300030056|Ga0302181_10025961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3284Open in IMG/M
3300030494|Ga0310037_10026017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2823Open in IMG/M
3300030503|Ga0311370_10620308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium roseum1291Open in IMG/M
3300030580|Ga0311355_10494062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1175Open in IMG/M
3300030969|Ga0075394_11575697All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium697Open in IMG/M
3300031231|Ga0170824_120594174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. L2C089B000685Open in IMG/M
3300031231|Ga0170824_126605612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia734Open in IMG/M
3300031236|Ga0302324_101782971Not Available783Open in IMG/M
3300031261|Ga0302140_10074851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3534Open in IMG/M
3300031545|Ga0318541_10679873Not Available575Open in IMG/M
3300031564|Ga0318573_10748870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300031572|Ga0318515_10172415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1156Open in IMG/M
3300031572|Ga0318515_10666305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces551Open in IMG/M
3300031640|Ga0318555_10612844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia589Open in IMG/M
3300031640|Ga0318555_10762737Not Available522Open in IMG/M
3300031681|Ga0318572_10098831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1645Open in IMG/M
3300031682|Ga0318560_10341806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK808Open in IMG/M
3300031719|Ga0306917_11081996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia625Open in IMG/M
3300031719|Ga0306917_11238956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces578Open in IMG/M
3300031751|Ga0318494_10684863Not Available600Open in IMG/M
3300031765|Ga0318554_10776384Not Available536Open in IMG/M
3300031778|Ga0318498_10244890Not Available809Open in IMG/M
3300031778|Ga0318498_10555592Not Available503Open in IMG/M
3300031796|Ga0318576_10404529Not Available645Open in IMG/M
3300031846|Ga0318512_10690467Not Available523Open in IMG/M
3300031912|Ga0306921_11636703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria698Open in IMG/M
3300031945|Ga0310913_10784958All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300031954|Ga0306926_10374302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1760Open in IMG/M
3300031959|Ga0318530_10303978Not Available659Open in IMG/M
3300032043|Ga0318556_10471805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia656Open in IMG/M
3300032044|Ga0318558_10423162Not Available663Open in IMG/M
3300032060|Ga0318505_10233143Not Available865Open in IMG/M
3300032065|Ga0318513_10460377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia622Open in IMG/M
3300032160|Ga0311301_10978432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1123Open in IMG/M
3300032515|Ga0348332_14551775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia735Open in IMG/M
3300032782|Ga0335082_10708700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia868Open in IMG/M
3300032805|Ga0335078_10218347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Alicyclobacillaceae → Alicyclobacillus2629Open in IMG/M
3300032892|Ga0335081_11719704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii683Open in IMG/M
3300034124|Ga0370483_0050362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1311Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.44%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil12.82%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil8.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.41%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.13%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.13%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.49%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.56%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.92%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.28%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.28%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.28%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.28%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.28%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.28%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.28%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.28%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.64%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.64%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.64%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.64%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.64%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.64%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.64%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.64%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.64%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.64%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.64%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.64%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.64%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.64%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.64%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.64%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.64%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459023Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition)EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026214Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030969Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FA3_017189402170459023Grass SoilLPSWPSIVLSVAVHVLFSPWVLLVGIAILAWIKFRPGRSHR
Ga0066692_1074295423300005555SoilIVAIAVLSFAVHLLFSPLLLVAVAVLAWIKFRPRRSRQ*
Ga0068856_10083509123300005614Corn RhizosphereALIVLSVAVHILFSPWVLLVGIGILAWIKFRPRRSHR*
Ga0068864_10217969713300005618Switchgrass RhizosphereVALIVLSAAVHILFSPWILLVGIGILAWIKFRPRRSHR*
Ga0066903_10897477923300005764Tropical Forest SoilLAVLGFAVHLLFSPWLLVAAIAILAWIKFRPRRSDR*
Ga0066789_1013447613300005994SoilLTVLSFAVHVLFSPWLLVAIAILAWIKFRPRRSYR*
Ga0066789_1021067313300005994SoilLTVLSFAVHVLFSPWLLVAIAILAWIKFRPRHSHR*
Ga0070717_1023081853300006028Corn, Switchgrass And Miscanthus RhizosphereAVAVLGFVLHILFSPWLLVAVAIVAWIKFRPRGSRQ*
Ga0070717_1041232843300006028Corn, Switchgrass And Miscanthus RhizosphereAVAVLGFVLHILFSPWLLVAVAIVAWIKLRPRGSRQ*
Ga0070717_1150534523300006028Corn, Switchgrass And Miscanthus RhizosphereAIVALAIFGFVAHILFSPWLLLVAVGILAWLMFSRRRSRR*
Ga0070716_10114473513300006173Corn, Switchgrass And Miscanthus RhizosphereLAIFGFVAHILFSPWLLLVAVGILAWLMFSRRRSRQ*
Ga0079222_1219477213300006755Agricultural SoilVALSIIGFAVHLLFSPWLLVAVAIVAWIKFRPRGAGR*
Ga0079221_1147000613300006804Agricultural SoilALAIFGFVAHILFSPWLLLVAVGILAWLMFSRRRSRR*
Ga0075436_10013055513300006914Populus RhizosphereAVLGFVLHILFSPWLLVAIAILAFIKFRPRRSRP*
Ga0075436_10042451313300006914Populus RhizosphereTVLGFALHILFSPWILVAIAIVAWIKFRPRGSRQ*
Ga0079219_1180876333300006954Agricultural SoilSILGFALHILFSPWILLAIAILAFIKFRPRRSRQ*
Ga0099793_1049718923300007258Vadose Zone SoilVAFAVLGFALHILFSPWLLVAIAILAFIKFRPRRSRQ*
Ga0116214_111435623300009520Peatlands SoilVALTVLSFAVHVLFSPWLLVAIAILTWIKFRPRRSRR*
Ga0116218_108523823300009522Peatlands SoilVALIVLSFALHVLFSPWLLVAVAVLAWIKFRPHRSHR*
Ga0116218_148594623300009522Peatlands SoilVALTVLGFVLHVLFSPWLLVAVAIVAWIKFRPSRSRQ*
Ga0116215_103426213300009672Peatlands SoilAIVALTVLGFVLHVLFSPWLLVAVAIVAWIKFRPSRSRQ*
Ga0116224_1019821333300009683Peatlands SoilLVALMVFGFAIHVLFSPWLLLAAVAIVAWIKFRPSRSRR*
Ga0116216_1054950913300009698Peatlands SoilLTVLGFALHILFSPWLLVVIAIVAWIKFRPSRSRR*
Ga0116217_1068243013300009700Peatlands SoilALVVVGLVVHLLFSPWLLVAAVAILAWIQFGPRRSVQ*
Ga0126380_1065490933300010043Tropical Forest SoilTVLSFTVHVLFSPWLLLVLIGILVWIKFRPGRSRQ*
Ga0126380_1151239623300010043Tropical Forest SoilAVLGFAVHILFSPWLLLVVIAVLAWVKFRPRRSQR*
Ga0126384_1066728713300010046Tropical Forest SoilSFAVHLLFSPLFLLLAAVGVLAWIKFRPRRSSRY*
Ga0126384_1099340023300010046Tropical Forest SoilALAVLSFTVHILFSPWLLVVAIAALAWIKFRPRRSQR*
Ga0126382_1082555913300010047Tropical Forest SoilIVALTVLGFVLHVLFSPWLLLVAVAIVAWIKFRPSRSRQ*
Ga0074044_1073612823300010343Bog Forest SoilMPDHVHLLFSPWLLLLAGVGILAWIKLRPRRSHQ*
Ga0126370_1011676933300010358Tropical Forest SoilLTVVGFAVHLLFSPWLLVAIAILAWIKFRPRRSHQ*
Ga0126370_1127742723300010358Tropical Forest SoilALTVLGIAAHILFSPWLLLVAIGVLVWIKFRPRRSRQ*
Ga0126370_1253960113300010358Tropical Forest SoilAVIVALIILSFAVHVLFSPWLLLVAIGVLAWIKFRPRRSVH*
Ga0126372_1305050413300010360Tropical Forest SoilLTVLGFAVHILFSPWLLLAVIGILAWVKFRPRRSRQ*
Ga0126378_1030383313300010361Tropical Forest SoilVILTVLSFTVHLLFSPWLLVAVAILALIKFWPRRSRQ*
Ga0126378_1157641223300010361Tropical Forest SoilVLSFAVHILFSPWLLLVAIGVLAWIGFRPRRSQR*
Ga0126378_1343107923300010361Tropical Forest SoilTVLGFAVHLLFSPWLLVAIAVLAWIKFRPGRSRQ*
Ga0126377_1171960413300010362Tropical Forest SoilLTVLSFTVHVLFSPWLLLVLIGILVWIKFRPGRSRQ*
Ga0134125_1036916923300010371Terrestrial SoilIVLSVAVHILFSPWVLLVGIGILAWIKFGPRRSHR*
Ga0134128_1137454213300010373Terrestrial SoilLSILGCALHILFSPWILLAIAIVALIKFRPRRSRQ*
Ga0105239_1273456333300010375Corn RhizosphereVLSAAVHILFSPWILLVGIGILAWIKFRPRRSHR*
Ga0126381_10060562513300010376Tropical Forest SoilIAAVAILGFALHALFSPLVLVAIAILAWIKFRPRHTNR*
Ga0126381_10240662913300010376Tropical Forest SoilALTVLGFAVHLLFSPWLLVAIAILAWIKFRPRRSRQ*
Ga0126381_10411331423300010376Tropical Forest SoilVAMTVVGFTLHLLFSPWLLVAIGVLVLIKFRPRRSRP*
Ga0136449_10074978823300010379Peatlands SoilVALIIVSFAVHVLFSPWLLVAVAIVAWIKFRPCRSQR*
Ga0136449_10203448943300010379Peatlands SoilAAIVALTVLGFALHILFSPWLLVVIAIVAWIKFRPSRSRQ*
Ga0136449_10205587633300010379Peatlands SoilAIVALTVLGFALHILFSPWLLVVIAIVAWIKFRPSRSRQ*
Ga0136449_10323755913300010379Peatlands SoilALTVLGFALHILFSPWLLVVIAIVAWIKFRPSRSRQ*
Ga0134126_1279316213300010396Terrestrial SoilALIVLSFAVHLLFTPWILVPLAIVAWVKFRPGRSRR*
Ga0126361_1110781813300010876Boreal Forest SoilIVLSFVVHVLFSPWLLVLAIGAIAWVKFRPRRSHR*
Ga0126350_1200051713300010880Boreal Forest SoilIVVSVLGFALHFLFSPWLLVAIAILAWIKFRPRRTRQ*
Ga0137391_1098051023300011270Vadose Zone SoilVALIVLSFAVHFLFSPWLLVALVILALIKFRPRRSHR*
Ga0137387_1079867713300012349Vadose Zone SoilAVLSFTVHFLFSPWLLVAIAVLVWIRFRPRRSRQ*
Ga0137372_1005876613300012350Vadose Zone SoilVALTVLSFTVHLLFSPWLLVALAILAWIKFRPRRSHR*
Ga0137372_1015399633300012350Vadose Zone SoilVALSVLSFTAHILFSPWLLLAIGILLWIKFRPRRSRQ*
Ga0137385_1056924633300012359Vadose Zone SoilLTVLSFAVHVLFSPWLLLVAIGILAWIKFRPRHSHQ*
Ga0137395_1089980523300012917Vadose Zone SoilVVALIVLSFAVHFLFSPWLLVALVVLALIKFRPRRSHR*
Ga0126369_1134804413300012971Tropical Forest SoilTVISFTVHFLLSPWLLVAIAILAWIRFRPRHSRR*
Ga0181525_1032894323300014654BogVWILSFAVHFLFSPWLLVVAVAVVAWIKLRPRHSQR*
Ga0132258_1111347833300015371Arabidopsis RhizosphereLSAAVPILFPPWILVVGIGLLAWIKFRPRRSHRY*
Ga0182036_1026948533300016270SoilAALAVLGAAVHLLFSPWLLAAIAVLAWIKFRPRRSQR
Ga0182036_1088564523300016270SoilALTVLGFAVHVLFSPWLLLAVIGVLAWVKFGPRRSRR
Ga0182033_1006867613300016319SoilLVALVVLSFVGHFLFSPWLLVAAIGVLAWIKFRPRRSRQ
Ga0182033_1217492413300016319SoilALTVLGFAVHVLFSPWLLLAVIGILAWVKFRPGRSHDRR
Ga0182035_1084920713300016341SoilAVAVLSFAAHILFSPLVLVALGILVWLKVRPRRSHQ
Ga0182039_1057551433300016422SoilALALLGFAAHILFSPWLLLAAAGILLWIKFRPRRSRQ
Ga0187809_1021055623300017937Freshwater SedimentAIVALIVLSAAVHILFSPWILLVGIGVLAWVKFRPGRSHR
Ga0187817_1027170423300017955Freshwater SedimentVALTILGFAVHVLFSPWLLLAVIGILAWVKFRPRRSRQ
Ga0187779_1034069313300017959Tropical PeatlandALAVLGFAVHFLFSPWLLVAAIAVLAWVKFRPRRSHR
Ga0187872_1034106113300018017PeatlandMVFGFAIHVLFSPWLLLAAVAIVAWIKFRPGRSPR
Ga0206354_1116032113300020081Corn, Switchgrass And Miscanthus RhizosphereLVIIALTVLGFAVHFLFSPWLLVAIAIVAWIKFRPRRTHQ
Ga0210395_1003867233300020582SoilVALTVLSVAVHVLVSPGLLVAVAILAWIKFRPRRSHR
Ga0210405_1058887123300021171SoilAIVALTVLGFAVHLLFSPLLLLAVIAVVAWIKFGPRRSRR
Ga0210388_1076899223300021181SoilFVALTVLGFALHILFSPWLLVVIAIVAWIKFRPSRSRQ
Ga0213874_1024196823300021377Plant RootsIVALIVVGFVVHFLFSPWLLVAVAIVAWIKFRPRRSRR
Ga0210393_1125700513300021401SoilVALTVLSLTMHFLFSPWLLVAVVILAWIRFRPRRSRQ
Ga0210385_1011901133300021402SoilVALTVLSVAVHVLVSPWLLAAVAILAWIKFRPRRSHR
Ga0210387_1147774313300021405SoilIIGLIVVSVVGFALHFLFSPWLLVAIAILAWIKFRPRRTRQ
Ga0210383_1095556113300021407SoilVSVLGFALHFLFSPWLLVAIAILAWIKFRPRRTRQ
Ga0210384_1147939813300021432SoilVALTVLGLAVHVLFSPWLLLAVIGILAWVKFRPRHSRQ
Ga0210391_1015433533300021433SoilVALAVLSFTVHVLFSPWLLAAIAIVAWIKFRPRRSRQ
Ga0210392_1029413633300021475SoilPDAIEQALTIVSFAVHILFSPWLLLAIGILIWLKFCPRRSQQ
Ga0210409_1125046813300021559SoilLTVLGVAVHVLFSPWLLVAVAILAWIKFRPRRSPR
Ga0126371_1163065423300021560Tropical Forest SoilALAAVSTAVHILFSPWLLLVAVGVFAWIKLRPRRSQR
Ga0126371_1313260313300021560Tropical Forest SoilVAMTVVGFTLHLLFSPWLLVAIGVLVLIKFRPRRSRP
Ga0126371_1351323223300021560Tropical Forest SoilVIVALVVLSIAVHILFSPWLLVAIAVLAWIKFRPRRSHQ
Ga0207684_1103302623300025910Corn, Switchgrass And Miscanthus RhizosphereVALAVLTFTVHVLFSPWLLVAIAIVAWIKFRARRFRR
Ga0207684_1151694413300025910Corn, Switchgrass And Miscanthus RhizosphereIVALTVVGFVMHFIFSPWLLVAIGILVWIKFRPRRSRQ
Ga0207663_1049395023300025916Corn, Switchgrass And Miscanthus RhizosphereIVAPAVPSVTVHVLFSSWLLVAIAILAWIKFRPRRSRR
Ga0207657_1052354923300025919Corn RhizosphereIVLSAAVHILFSPWILLVGIGILAWIKFRPRRSHR
Ga0207649_1030470223300025920Corn RhizosphereLTIVGFALHFLFSPWLLVAIAIVAWIKFRPRRSHQ
Ga0207664_1020945813300025929Agricultural SoilVAFAVLGFVLHILFSPWLLVAIAILAFIKFRPRRSHR
Ga0207664_1063172623300025929Agricultural SoilVIAALAVAGFALHFLFSPWLLVAVAIVAWIKFRPRGSRQ
Ga0207690_1142521913300025932Corn RhizosphereVALIVLSAAVHILFSPWILLVGIGILAWIKFRPRRSHR
Ga0207712_1094313913300025961Switchgrass RhizosphereVALTVLSFTVHILFSPWLLVALIAILAWIKFRPRRSHR
Ga0207702_1035044613300026078Corn RhizosphereLIVLSFAVHLLFTPWILVPLAIVAWVKFRPGRSRR
Ga0209838_100772213300026214SoilALIIVSFAVHFLFSPWLLVAVAIVAWIKFRPRRSQR
Ga0209239_119158713300026310Grasslands SoilLGVLGFALHILFSPWLLVAIAILAWIKFRPRRSRP
Ga0179587_1030132323300026557Vadose Zone SoilVALTILSFTVHFLFSPWLLVVIGILAWIKFRPRRSHQ
Ga0208199_105919123300027497Peatlands SoilVALTVLSFAVHVLFSPWLLVAIAILTWIKFRPRRSRR
Ga0209218_109386013300027505Forest SoilLVALTVLSFTAHLLFSPWVLVAIGILVWIKFRPRRSHQ
Ga0209772_1005125123300027768Bog Forest SoilVALAVLSFAVHFLFSPWLLVAIAILAWIKFWPCRSRR
Ga0209040_1006487953300027824Bog Forest SoilVALTVLGFVLHVLFSPWLLVAVAIVAWIKFRPSRSRQ
Ga0209693_1027662823300027855SoilVALTVLSVAVHVLVSPWLLVAVAILAWIKFRPRRSHR
Ga0209693_1040871213300027855SoilALIVISFAVHVLFSPWLLVAIAILAWVKFRPHRSHR
Ga0209583_1010848113300027910WatershedsALTIFGLAVHLLFSPWLLLVVIAVLAWIKFRPRQSRR
Ga0311368_1067285213300029882PalsaLIIVSFAVHFLFSPWLLVVVAIVAWIKFRPRHSQR
Ga0311363_1071658013300029922FenVALTVLSFAVHILFSPWLLVAIAILAWVKFRPRHSHR
Ga0311371_1247075613300029951PalsaLVALMVFGFVVHVLFSPWLLLAAVGIVAWIKFRPSRSRR
Ga0311338_1092983523300030007PalsaLIIVSFAVHLLFSPWLLLAVAIVALIKFRPRRSRR
Ga0302178_1032498323300030013PalsaAIVALTVLSFAVHVLFSPWLLVAIAILAWIKFRPRHSHR
Ga0302181_1002596153300030056PalsaVALSILSFSLHILFSPWLLLPAIGVLLWIKLRPRRSHQ
Ga0310037_1002601763300030494Peatlands SoilAIVALTVLGFVLHVLFSPWLLVAVAIVAWIKFRPSRSRQ
Ga0311370_1062030813300030503PalsaVALMVFGFVVHVLFSPWLLLAAVGIVAWIKFRPSRSRR
Ga0311355_1049406223300030580PalsaIVALIIVSFALHLLISPWLLVAVAIVAWIKFGPRRARR
Ga0075394_1157569723300030969SoilAIVALTVLSFAVHVLFSPWLLVAIAILAWIKFRPGRSHR
Ga0170824_12059417423300031231Forest SoilALTVLSFAVHVLFSPWLLVAIAILAWIKFRPRRSHR
Ga0170824_12660561223300031231Forest SoilVALAVLSFAVHFLFTPWLLVPLAILAWVKFRPGRSRR
Ga0302324_10178297123300031236PalsaSIVIGAAVHLLFSPWLLLAVAIVALIKFWPRRSRR
Ga0302140_1007485113300031261BogLTVLSFAVHVLFSPWLLVAIAILAWVKFRPRHSHR
Ga0318541_1067987323300031545SoilALAVLGLAVHLLFSPWLLVAAIAVLAWVKFRPRRSER
Ga0318573_1074887023300031564SoilLTILGFAVHFLFSPWLLVAIAVLAWLQFRTRRSHR
Ga0318515_1017241513300031572SoilVAVAVLGFAVHLLFSPWLWLVAIAILAWVKFRPGRSHDRR
Ga0318515_1066630513300031572SoilLAVLGFAVHLLFSPWLLVAAIAILAWIKFRPRRSSNGR
Ga0318555_1061284423300031640SoilVVLSFVGHFLFSPWLLVAAIGVLAWIKFRPRRSRQ
Ga0318555_1076273723300031640SoilALAVVGFAVHLLFSPWLLVAIAVLAWIKFRPRRSQR
Ga0318572_1009883113300031681SoilVLALAVLGLAVHLLFSPWLLVAAIAVLAWVKFRPRRSER
Ga0318560_1034180623300031682SoilMAIVALVMVSFAVHFLVSPWLMVAAAIVVWIKFRPRRSQR
Ga0306917_1108199623300031719SoilALAVLSITVHVLFSPWLLVAVAVLAWIKFRPRRSHR
Ga0306917_1123895613300031719SoilAIVALAVLGFAVHLLFSPWLLVAAIAILAWIKFRPRRSSNGR
Ga0318502_1003800313300031747SoilALVVLSFVAHFLFSPWLLLAAVGVLAWVKFRPRRSRQ
Ga0318494_1068486313300031751SoilALAILGAIVHILFSPWLLLVAVAVLAWIKFRPSRSHR
Ga0318554_1077638413300031765SoilLVALTILSIAVHVLFSPWLLLAVVGILAWVAFRPRRSRR
Ga0318546_1101668113300031771SoilAIVALAVLGFAAHLLFSPWLLVAAIAVLAWVKFRPRRSNNGR
Ga0318498_1024489013300031778SoilLVVLTITVHFLFSPWLLVVIAVLAWIKFRPRRSHQ
Ga0318498_1055559213300031778SoilAIAIVALVALSFAVHILFSPWLLVAVAILAWIKFRPRRSRL
Ga0318557_1025364223300031795SoilAIVALTVLGFAVHVLFSPWLLLAVIGVLAWVKFGPRRSRR
Ga0318576_1040452913300031796SoilVALAVLSATVHFLFSPWLLVVIAVLAWIKFRPRRSRR
Ga0318512_1069046713300031846SoilAIVALTVLSVTVHVLFSPWLLVAIAIVAWIKFRPRRSHR
Ga0306921_1163670323300031912SoilAVVALTILGFAVHFLFSPWLLVAIAVLAWLQFRTRRSHR
Ga0310913_1078495823300031945SoilTVLGFAVHVLFSPWLLLAVIGVLAWVKFGPRRSRQ
Ga0306926_1037430243300031954SoilLTVLGFAVHVLFSPWLLLAVIGVLAWVKFGPRRSRQ
Ga0318530_1030397823300031959SoilALFVLSITVHFLFSPWLLVVIAVLAWIKFRPRRSHE
Ga0318556_1047180523300032043SoilALVALVVLSFVAHFLFSPWLLLAAVGVLAWVKFRPRRSRQ
Ga0318558_1042316213300032044SoilAIVALAILGAVVHILFSPWLLLVAIAVLAWIKFRPSRSHR
Ga0318505_1023314313300032060SoilAILGAVAHILFSPWLLLVAIAVLAWIKFRPSRSHR
Ga0318513_1046037713300032065SoilLALLGFAAHILFSPWLLLAAAGILLWIKFRPRRSRQ
Ga0311301_1097843213300032160Peatlands SoilAAIVALTVLGFVLHVLFSPWLLVAVAIVAWIKFRPSRSRQ
Ga0307471_10125583613300032180Hardwood Forest SoilLVALIVVSFAVHLLFSPWLLLVAVAVLAWVALRPRRSRR
Ga0348332_1455177513300032515Plant LitterVVALIVISFAVHVLFSPWLLVAIAILAWVKFRPHRSHR
Ga0335082_1070870023300032782SoilVALIIIVGFAVHFLFSPGLLVAVAIVAWITFRPRRSRR
Ga0335078_1021834713300032805SoilLAIVGAALHLLFSPWLLVAAVAIVAWIKFRPRRSRQ
Ga0335081_1171970413300032892SoilAIVALVVLSFAVHILFSPWLLVAVAILAWIKFRPRRSRL
Ga0335072_1111844923300032898SoilAAIVAFAVLGFVLHVLFSPWLLVAVAIVAFIKFRPRRARQ
Ga0370483_0050362_1187_12943300034124Untreated Peat SoilMVFGFAIHVLFSPWLLLAAVAIVAWIKFRPSRSRR
Ga0373959_0123314_3_1103300034820Rhizosphere SoilAIFGFVAHILFSPWLLLVAVGILAWLMFSRRRSRQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.