NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F043540

Metagenome / Metatranscriptome Family F043540

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F043540
Family Type Metagenome / Metatranscriptome
Number of Sequences 156
Average Sequence Length 71 residues
Representative Sequence AELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAKEFATKRDKKTVKAKARKTAA
Number of Associated Samples 119
Number of Associated Scaffolds 156

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.04 %
% of genes near scaffold ends (potentially truncated) 85.90 %
% of genes from short scaffolds (< 2000 bps) 88.46 %
Associated GOLD sequencing projects 111
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.103 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(14.103 % of family members)
Environment Ontology (ENVO) Unclassified
(36.538 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.872 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 68.75%    β-sheet: 0.00%    Coil/Unstructured: 31.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 156 Family Scaffolds
PF01545Cation_efflux 2.56
PF13495Phage_int_SAM_4 2.56
PF11453DUF2950 1.28
PF00248Aldo_ket_red 1.28
PF13560HTH_31 1.28
PF13413HTH_25 1.28
PF12762DDE_Tnp_IS1595 1.28
PF02518HATPase_c 1.28
PF01139RtcB 1.28
PF13378MR_MLE_C 1.28
PF13020NOV_C 0.64
PF03167UDG 0.64
PF13646HEAT_2 0.64
PF13545HTH_Crp_2 0.64
PF04966OprB 0.64
PF11319VasI 0.64
PF13620CarboxypepD_reg 0.64
PF13429TPR_15 0.64
PF00230MIP 0.64
PF02954HTH_8 0.64
PF02086MethyltransfD12 0.64
PF04956TrbC 0.64
PF13431TPR_17 0.64
PF07505DUF5131 0.64
PF01638HxlR 0.64
PF13650Asp_protease_2 0.64
PF13444Acetyltransf_5 0.64
PF00082Peptidase_S8 0.64
PF10088DUF2326 0.64
PF13649Methyltransf_25 0.64
PF12840HTH_20 0.64
PF07730HisKA_3 0.64
PF01878EVE 0.64
PF11185DUF2971 0.64
PF00376MerR 0.64
PF02899Phage_int_SAM_1 0.64
PF01797Y1_Tnp 0.64
PF04397LytTR 0.64

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 156 Family Scaffolds
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 2.56
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 2.56
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 2.56
COG1690RNA-splicing ligase RtcB, repairs tRNA damageTranslation, ribosomal structure and biogenesis [J] 1.28
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.64
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.64
COG0338DNA-adenine methylaseReplication, recombination and repair [L] 0.64
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 0.64
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.64
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.64
COG1673Predicted RNA-binding protein, contains PUA-like EVE domainGeneral function prediction only [R] 0.64
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.64
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.64
COG2947Predicted RNA-binding protein, contains EVE domainGeneral function prediction only [R] 0.64
COG3392Adenine-specific DNA methylaseReplication, recombination and repair [L] 0.64
COG3659Carbohydrate-selective porin OprBCell wall/membrane/envelope biogenesis [M] 0.64
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 0.64
COG3838Type IV secretory pathway, VirB2 component (pilin)Intracellular trafficking, secretion, and vesicular transport [U] 0.64
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.64
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.64
COG4422Bacteriophage protein gp37Mobilome: prophages, transposons [X] 0.64
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.64
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.64


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.10 %
UnclassifiedrootN/A10.90 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001174|JGI12679J13547_1001607All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1207Open in IMG/M
3300004104|Ga0058891_1514472All Organisms → cellular organisms → Bacteria1196Open in IMG/M
3300004152|Ga0062386_101437575All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae574Open in IMG/M
3300005538|Ga0070731_10807599All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae622Open in IMG/M
3300005541|Ga0070733_11167108All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae516Open in IMG/M
3300005712|Ga0070764_10256159All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae998Open in IMG/M
3300005712|Ga0070764_10793188All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae588Open in IMG/M
3300005921|Ga0070766_10454740All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae846Open in IMG/M
3300006047|Ga0075024_100805007All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae526Open in IMG/M
3300006102|Ga0075015_100345992All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae828Open in IMG/M
3300006162|Ga0075030_100102255All Organisms → cellular organisms → Bacteria2336Open in IMG/M
3300006162|Ga0075030_100916831All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae691Open in IMG/M
3300006174|Ga0075014_100293764All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae854Open in IMG/M
3300009088|Ga0099830_11744838All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae520Open in IMG/M
3300009523|Ga0116221_1049140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1976Open in IMG/M
3300009624|Ga0116105_1012099Not Available1760Open in IMG/M
3300009637|Ga0116118_1240091All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae559Open in IMG/M
3300009638|Ga0116113_1211976All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae504Open in IMG/M
3300009665|Ga0116135_1096918All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1065Open in IMG/M
3300009665|Ga0116135_1399094All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae557Open in IMG/M
3300009700|Ga0116217_10222937All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300010339|Ga0074046_10342060All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300010343|Ga0074044_10842193All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae599Open in IMG/M
3300010379|Ga0136449_100281003All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae3056Open in IMG/M
3300010379|Ga0136449_102589651All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae724Open in IMG/M
3300010379|Ga0136449_103040537All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae653Open in IMG/M
3300012361|Ga0137360_11867906Not Available506Open in IMG/M
3300012363|Ga0137390_12031373All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae500Open in IMG/M
3300012683|Ga0137398_10929029All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300014155|Ga0181524_10377856All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae624Open in IMG/M
3300014158|Ga0181521_10029631All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4213Open in IMG/M
3300014158|Ga0181521_10258344All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae915Open in IMG/M
3300014158|Ga0181521_10299001All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. NZS11827Open in IMG/M
3300014162|Ga0181538_10392733All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300014162|Ga0181538_10418930All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae712Open in IMG/M
3300014162|Ga0181538_10438175All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae693Open in IMG/M
3300014162|Ga0181538_10456669All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae676Open in IMG/M
3300014162|Ga0181538_10517881All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae627Open in IMG/M
3300014164|Ga0181532_10623991All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae584Open in IMG/M
3300014167|Ga0181528_10108056All Organisms → cellular organisms → Bacteria1511Open in IMG/M
3300014169|Ga0181531_10169071All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1324Open in IMG/M
3300014200|Ga0181526_10530976All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae744Open in IMG/M
3300014200|Ga0181526_10765298All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae608Open in IMG/M
3300014201|Ga0181537_10989164Not Available569Open in IMG/M
3300014489|Ga0182018_10012609All Organisms → cellular organisms → Bacteria → Acidobacteria5937Open in IMG/M
3300014493|Ga0182016_10834719All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae511Open in IMG/M
3300014495|Ga0182015_10360583All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae942Open in IMG/M
3300014495|Ga0182015_10997748All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae519Open in IMG/M
3300014501|Ga0182024_11651995All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae724Open in IMG/M
3300014638|Ga0181536_10090224All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1778Open in IMG/M
3300014654|Ga0181525_10029575All Organisms → cellular organisms → Bacteria3285Open in IMG/M
3300014838|Ga0182030_10322656All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1679Open in IMG/M
3300015193|Ga0167668_1052193All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium852Open in IMG/M
3300017823|Ga0187818_10236234All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae798Open in IMG/M
3300017942|Ga0187808_10473946Not Available578Open in IMG/M
3300017946|Ga0187879_10574211All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae626Open in IMG/M
3300017948|Ga0187847_10069643All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1968Open in IMG/M
3300017948|Ga0187847_10681579All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica577Open in IMG/M
3300017975|Ga0187782_11182180All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae598Open in IMG/M
3300017988|Ga0181520_10422891All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae961Open in IMG/M
3300018020|Ga0187861_10087440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Io17-Chloro-G41527Open in IMG/M
3300018023|Ga0187889_10168003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Io17-Chloro-G41028Open in IMG/M
3300018025|Ga0187885_10409188All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae607Open in IMG/M
3300018033|Ga0187867_10640110All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae581Open in IMG/M
3300018034|Ga0187863_10248423Not Available989Open in IMG/M
3300018034|Ga0187863_10683513All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae579Open in IMG/M
3300018037|Ga0187883_10529721All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae608Open in IMG/M
3300018037|Ga0187883_10640189All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae553Open in IMG/M
3300018042|Ga0187871_10132651Not Available1416Open in IMG/M
3300018043|Ga0187887_10786328All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae563Open in IMG/M
3300018043|Ga0187887_10978708All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae500Open in IMG/M
3300018044|Ga0187890_10499454All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae684Open in IMG/M
3300018044|Ga0187890_10835779All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae521Open in IMG/M
3300018047|Ga0187859_10364334All Organisms → cellular organisms → Bacteria → Acidobacteria789Open in IMG/M
3300018047|Ga0187859_10411760All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae743Open in IMG/M
3300018057|Ga0187858_10147798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1568Open in IMG/M
3300018057|Ga0187858_10307566All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1003Open in IMG/M
3300018085|Ga0187772_10990761All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae613Open in IMG/M
3300019786|Ga0182025_1352471All Organisms → cellular organisms → Bacteria → Proteobacteria2588Open in IMG/M
3300019787|Ga0182031_1158538All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1008Open in IMG/M
3300019787|Ga0182031_1395587All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1862Open in IMG/M
3300020579|Ga0210407_10068283All Organisms → cellular organisms → Bacteria → Acidobacteria2666Open in IMG/M
3300020579|Ga0210407_10799983All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300020583|Ga0210401_10425537All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium1190Open in IMG/M
3300021168|Ga0210406_10649620All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae818Open in IMG/M
3300021170|Ga0210400_10662014All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300021180|Ga0210396_10998520All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300021404|Ga0210389_10504887Not Available951Open in IMG/M
3300021405|Ga0210387_10093497All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum2502Open in IMG/M
3300021407|Ga0210383_10195172All Organisms → cellular organisms → Bacteria1730Open in IMG/M
3300021407|Ga0210383_10529654All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1017Open in IMG/M
3300022500|Ga0242643_124683All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae505Open in IMG/M
3300023090|Ga0224558_1045526All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1838Open in IMG/M
3300025507|Ga0208188_1119079All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300026552|Ga0209577_10515326All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium786Open in IMG/M
3300026557|Ga0179587_10637687All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300027604|Ga0208324_1039555All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1399Open in IMG/M
3300027625|Ga0208044_1152217All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300027812|Ga0209656_10383346All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae633Open in IMG/M
3300027855|Ga0209693_10241850All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae885Open in IMG/M
3300027862|Ga0209701_10564681All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae609Open in IMG/M
3300027869|Ga0209579_10742686All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae530Open in IMG/M
3300027879|Ga0209169_10719061All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae517Open in IMG/M
3300027889|Ga0209380_10710045All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae576Open in IMG/M
3300027905|Ga0209415_10054461All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5058Open in IMG/M
3300027905|Ga0209415_10221250All Organisms → cellular organisms → Bacteria → Acidobacteria1751Open in IMG/M
3300027908|Ga0209006_10260514Not Available1490Open in IMG/M
3300027908|Ga0209006_11428100Not Available528Open in IMG/M
3300028536|Ga0137415_10005350All Organisms → cellular organisms → Bacteria12711Open in IMG/M
3300028776|Ga0302303_10022096All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae2744Open in IMG/M
3300028795|Ga0302227_10116822All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1084Open in IMG/M
3300028874|Ga0302155_10521066All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae504Open in IMG/M
3300028877|Ga0302235_10057756All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1844Open in IMG/M
3300029883|Ga0311327_10166281All Organisms → cellular organisms → Bacteria → Acidobacteria1544Open in IMG/M
3300029907|Ga0311329_11018532All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae512Open in IMG/M
3300029917|Ga0311326_10398663All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae683Open in IMG/M
3300029922|Ga0311363_10463439All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1310Open in IMG/M
3300029945|Ga0311330_10321897All Organisms → cellular organisms → Bacteria1321Open in IMG/M
3300029955|Ga0311342_10547234All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300029992|Ga0302276_10285712All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300030007|Ga0311338_11941322All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae525Open in IMG/M
3300030013|Ga0302178_10159215All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1113Open in IMG/M
3300030045|Ga0302282_1080377All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1394Open in IMG/M
3300030503|Ga0311370_11452629All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae721Open in IMG/M
3300030503|Ga0311370_12471781All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae500Open in IMG/M
3300030518|Ga0302275_10118982All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1719Open in IMG/M
3300030813|Ga0265750_1029286All Organisms → cellular organisms → Bacteria → Acidobacteria750Open in IMG/M
3300031234|Ga0302325_11711119All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae794Open in IMG/M
3300031236|Ga0302324_100623503All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1541Open in IMG/M
3300031236|Ga0302324_101233327All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae993Open in IMG/M
3300031261|Ga0302140_10500489All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae943Open in IMG/M
3300031525|Ga0302326_11361169All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345962Open in IMG/M
3300031708|Ga0310686_104798489Not Available1945Open in IMG/M
3300031708|Ga0310686_107414520All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1468Open in IMG/M
3300031708|Ga0310686_108366944All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae559Open in IMG/M
3300031708|Ga0310686_109465780All Organisms → cellular organisms → Bacteria → Acidobacteria850Open in IMG/M
3300031708|Ga0310686_116976365All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae550Open in IMG/M
3300031788|Ga0302319_11033840All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae779Open in IMG/M
3300031962|Ga0307479_12141203All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae507Open in IMG/M
3300032160|Ga0311301_11421943All Organisms → cellular organisms → Bacteria → Acidobacteria863Open in IMG/M
3300032160|Ga0311301_12377181All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae599Open in IMG/M
3300032515|Ga0348332_10129697All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300032515|Ga0348332_13776613All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1876Open in IMG/M
3300032783|Ga0335079_11965112All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae564Open in IMG/M
3300032805|Ga0335078_11804362All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae665Open in IMG/M
3300032828|Ga0335080_12137258All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae539Open in IMG/M
3300032829|Ga0335070_11814691All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae551Open in IMG/M
3300034124|Ga0370483_0052598All Organisms → cellular organisms → Bacteria1285Open in IMG/M
3300034282|Ga0370492_0431514All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae534Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland14.10%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog11.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.69%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil7.05%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa7.05%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog6.41%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.49%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.85%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.21%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.21%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.56%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.56%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.92%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.92%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.28%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.28%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.28%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.28%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.28%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.28%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.28%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.28%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.28%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.64%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.64%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001174Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1EnvironmentalOpen in IMG/M
3300004104Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015193Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream)EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300022500Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027625Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300028874Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029992Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030045Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300030813Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12679J13547_100160713300001174Forest SoilDEAELCKLLLEISLLDSAYQRSTVSRDDVLMDAAKRYRVDTEKLQKAVAEELAAKQDKKTKATAKPKGRKTAA*
Ga0058891_151447223300004104Forest SoilMSELSKLLLEISLLDSAYQRSTASRDDALMDAAKRYRVDTQKLQKAVAKEFATQPDKKTNKSKARKTPA*
Ga0062386_10143757513300004152Bog Forest SoilKYQEADLCKLLLEISLLDSAYQRSGTSDDFLTDAAKRYRVDGEKLQKAVAAEFAAKKERSKAKAKSKSVA*
Ga0070731_1080759933300005538Surface SoilESELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKAVAKELASKRDKKTVKPKTSKTAA*
Ga0070733_1116710813300005541Surface SoilAKQVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKAVVEDLAVKREKVTKAKPKARGKTGLAS*
Ga0070764_1025615923300005712SoilKQVSKYDESELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKAVAEELAAKRDKKTKGKAKPKSHRTGV*
Ga0070764_1079318813300005712SoilLLLEISLLDSAYQRSTSSRDDVLMDAAKRYRVDAEKLQKAVAAELAAKRDKKTKAEAKPENRKTV*
Ga0070766_1045474033300005921SoilDAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAEELAAKRDKKTKATAKPKGRKTAA*
Ga0075024_10080500713300006047WatershedsESELCKLLLEISLLDSAYQRSTASRNDVLMDAAKRYRVDTEKLQKAVAREFAAKRDKKTIKPKGRKAAA*
Ga0075015_10034599223300006102WatershedsAKQVSKYDESELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKVQKAVAKEFAAKRDRKTLKAKTRKTAA*
Ga0075030_10010225533300006162WatershedsKQVSKYDESELCKLLLEISLLDSAYQRGTSSRDDALMDVAKRYRVDAEKLQKAVAEELAAKRDKKTKVGAKPKSRKTA*
Ga0075030_10091683123300006162WatershedsVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVLADAAKRYRVDVEKLQKAVAKEFAAKRDKKTIKAKPRKTVA*
Ga0075014_10029376423300006174WatershedsKLLLEISLLDSAYRRSTSSREDVLMEAAKRYRVDAEKLQIAVAKEFAVKRDKKTIKPKGRKAAG*
Ga0099830_1174483813300009088Vadose Zone SoilLTATPEAELCKLVLEISLLDSAYQRSTASRDDILIDAAKRYRVDTEKLQKAVAKEFAAKRDQKAIKQKVRKTAD*
Ga0116221_104914043300009523Peatlands SoilGTYDEAELCKLLLEISLLDSAYQRSTSSRDDVLMDASKRYRVDAEKLQKTVAAELAAKRDKKTNAKAKPKSRKAAA*
Ga0116105_101209913300009624PeatlandKLLLEISLLDSAYQRSTASSDDVLMDAAKRYRVDTEKLQKAVAKEFAAKRDKKTVKAKTRKAA*
Ga0116118_124009113300009637PeatlandHYDEAELCKLLLEISPLDSAYQRSTSSRDDVLMDAAKRYRVDTEKLQKAAAKEFAAKRDKKTRIKPMGPNKTAA*
Ga0116113_121197613300009638PeatlandLCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAAELAAKQDRTTKAGAKPKTHKTA*
Ga0116135_109691813300009665PeatlandAYDEPELCKLLLEISLLDSAYQRATAGRDDVLMDAAKRYRVDADKLQEAVAKEFAAKRGKKTIKPKTRKTAA*
Ga0116135_139909423300009665PeatlandLLLEISLLDSAYQRPTASRDDVLMDVAKRYRVDAEKLQKAVAEDLAVKREKATKAKPKGRGKMGSAS*
Ga0116217_1022293723300009700Peatlands SoilAELCKLLLEISLLDSAYQRSTASHDDVLMDAAKRYRVDAEKLQKAVAKEFAAKRDKKTLKAKPRKTT*
Ga0074046_1034206023300010339Bog Forest SoilCKLLLEISLLDSAYQRSTASREDALMDAAKRYRVDTEKVQKAVAKEFASKRDKKTVKPKARAVAG*
Ga0074044_1084219313300010343Bog Forest SoilEISLLDSAYQRSTGSRDDVLMDAAKRYRVDTDKLQKAVAKEFAAKRDKKKASPRSVRQ*
Ga0136449_10028100333300010379Peatlands SoilELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLEQSVAKEFRAKREERKVKAKTTGRGAA*
Ga0136449_10258965113300010379Peatlands SoilVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAEELSAKRDKKAIKSKARKTSA*
Ga0136449_10304053723300010379Peatlands SoilAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAKEFATKRDKKTVKAKARKTAA*
Ga0137360_1186790613300012361Vadose Zone SoilELCKLLLEMSLLHSAYQRSSISRDDVLMEAAKRYRVDAEKLQKAVAKEFAAKRDKKTIKPKSGKAAA*
Ga0137390_1141568223300012363Vadose Zone SoilLLLEISLLDSAYQRSDSSADVLMEAAKRYRVDTEKIQKAVAKDFAAKQKSKTQVAKKAKAATAKV*
Ga0137390_1203137313300012363Vadose Zone SoilLLDSAYQRSGSSGDLLMDAAKRYRVDTEKLEKAVAADFAAKRKRKTSVAKKIKAAVART*
Ga0137398_1092902913300012683Vadose Zone SoilVGTYDESELSKLLLEISLLDSAYQRSTASRDDILFDAAKRYRVDTEKLQKSVAKEFAAKRDKKAVKPKVRRSAA*
Ga0181524_1037785613300014155BogLLLEISLLDSAYQRSIASREDVLMDAAKRYRVDAEKLQKTVAKEFAAKRDKKSLKAKGRKTAA*
Ga0181521_1002963173300014158BogYDESELCKLLLEISLLDSAYQRSIASRDDVLMDAAKRYRVDTEKLQKAVAREFAAKRDKKTIKPKGRTAAA*
Ga0181521_1025834413300014158BogKQVGTYDEAELCNLLLEISLLDSAYQRSTGSRDDVLMDAAKRYRVDAEKLQKAVAKEFAAKRDKKTVKAKVRKTAA*
Ga0181521_1029900113300014158BogKQVGKYEEADLCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAEELAAKRDKKTKATAKPKGRKTAA*
Ga0181538_1039273313300014162BogEAELCNLLLEISLLDSAYQRSTGSRDDVLMDAAKRYRVDAEKLQKAVAKEFAAKREKKTIKPKTRKTAA*
Ga0181538_1041893023300014162BogAKQVGTYDEAELCKLLLEISLLDSAHQRSTASQDDVLMDAAKRYRVDTEKLQKAVADELSAKREKKTKA*
Ga0181538_1043817513300014162BogELLAKQVSKYDESELCKLLLEISVLDSAYQRSTASRGDVLMDAAKRYRVDTEKLQKAVAKEFAAKRDKKTIKPKGRTAAA*
Ga0181538_1045666913300014162BogDEAELCKLLLEISLLDSAYQRTATTRDDVLMDAAKRYRVDAEKLQKAVATEFVAKRDKKTKVTSKPRNKTAG*
Ga0181538_1051788123300014162BogGYDEAELCKLLLEISLLDSAYQRSTTSRDDVLMDAAKRYRVDAEKLQKAVAGELAAKRDAKTKAKTMPKSRKTAA*
Ga0181532_1062399113300014164BogLLAKQVGTYDEPELCKLLLEISLLDSAYQRSTATRDDILMDAAKRYRVDAEKLQKAVAKEFAAKRDKKTVKAKPRKTAA*
Ga0181528_1010805633300014167BogLLEISLLDSAYQRSTASRDDILIDTAQRYRVDTEKLQKAVVKEFATKRDKKTVKPKGRRSAD*
Ga0181531_1016907113300014169BogLVKQVSTYDESELCKLLLEISLLDSAYHRTTTTRDDVLMDTAKRYRVDTEKLQKAVADEIAAKRDKTTKAKTKPKNRKPAA*
Ga0181526_1053097613300014200BogSTYDEAELCKLLLEVSLLDSAYQRSTSRRDDVLMDAAKRYRVDTEKLQKAVAEELVAKRDKKTMAKAKPKSRKTAT*
Ga0181526_1076529813300014200BogKLLLEISLLDSAYQRTATTRADVLMDAAKRYRVDAEKLQKAVAREFVAKRDKKTKVTSKPRNKAAG*
Ga0181537_1098916423300014201BogAKQVSTYDEAELCKLLLEVSLLDSAYQRSTSRRDDVLMDAAKRYRVDTEKLQKAVAEELVAKRDKKTMAKAKPKSRKTAT*
Ga0182018_1001260913300014489PalsaLCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAEELAAKRDKKTKATAKPKGRKTAA*
Ga0182016_1083471923300014493BogLAKQVGTYDEAELCKLLLEISLLDSAYQRSAASRNDVLMDAAKRYRVDTEKLQKAVAKEFAAKRDQKAIKQKVRKTAD*
Ga0182015_1036058323300014495PalsaVGKYEEAELCKLLLEISLLDSAYQRSTASRDDVLMSAAKRYRVDAEKLQKAVAEDLAAKRDKKTKAEAKPKARNTVG*
Ga0182015_1099774823300014495PalsaELCKLLLEISLLDSAYQRSSASRNDVLMDAAKRYRVDAEKLQIAVAKEFAVKRDKKTIKPKGRKAAG*
Ga0182024_1165199513300014501PermafrostDDELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKTVAEELAARREKKTKTKIKPKARRTAA*
Ga0181536_1009022413300014638BogKQVTTYDEAELCKLLLEISLLDSAYQRSTASRDDILIDAAKRYRVDVEKLQKAVAAEFTAKKERSKVKVKAKGKPVA*
Ga0181525_1002957533300014654BogVGACDEADLCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKPQKAVAEELAAKRDKRTKAGAKPKNRQTA*
Ga0182030_1032265623300014838BogCKLLLEISLLDSAYQRSTARRDDVLTDAAKRYRVDTDKVQKAVAKEFAAKRDRKTLKAKTRKTAA*
Ga0167668_105219313300015193Glacier Forefield SoilVPLCNLLLEISLLDSAYQRSTTSLDGILIDAAIPYRVDTEKLQKAVAKEFAAKRDKKTTTAKTRQRAN*
Ga0187818_1023623423300017823Freshwater SedimentEAELCKLLLEISLLDSAYQRSTARRDDVLMDAAKRYRVDVEKLQKAVAAEFTAKTEKRKVKGKGKDVG
Ga0187808_1047394613300017942Freshwater SedimentLLLEISLLDSAYQRSTASRDDVLMDAAKRFRVDAEKLQKAVAHELAAKRDKKTKAKGKPKAGKTAA
Ga0187879_1057421113300017946PeatlandGTYDEAELCKLLLEISLLDSAYQRSTTSRDDVLMDAAKRYRVDAEKLQKAVAKEFAAKRDKKTVKPKTRTIAA
Ga0187847_1006964313300017948PeatlandELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTDKLQKAVAEELAAKRDKKTMGKAKPKSRRTAV
Ga0187847_1068157913300017948PeatlandKQVGTYDESELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKGVAEELAVKREKATKAKPKARGKTGLAS
Ga0187782_1118218013300017975Tropical PeatlandESELCKLLLEISLLDSAYQRSKGGRDDVLADAAKRYRVDAEKLQKAVAEELAVKREKTVKAKPKARGKTAAVAS
Ga0181520_1042289123300017988BogLVKQVAEFDESELSKLLLEISLLDSAYQRTATTRDDVLMDAAKRYRVDAEKLQKAVATEFVAKRDKKTKVTSKPRNKTAG
Ga0187861_1008744013300018020PeatlandLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKAVAKEFAAKRDRKTLKAKTRKMAA
Ga0187889_1016800313300018023PeatlandYDESELCKLLLEISLLDSAYQRSTASRDDVLTDAAKRYRADTEKVQKAVAKEFAAKRDRKTLKAKTRKMAA
Ga0187885_1040918823300018025PeatlandEFDESELSKLLLEISLLDSAYQRTATTRDDVLMDAAKRYRVDTEKLQKAVTAEIVAKREKKPKVKPERARKPTT
Ga0187867_1064011013300018033PeatlandLAKQVSKFDESELCKLLLEISLLDSAYQRPTASRDDVLMDAAKRYRVDTEKVQKAVSKEFAAKRDKKTIKPKGRKEAA
Ga0187863_1024842313300018034PeatlandLLLEISLLDSAYQRSTASRDDILIDTAKRYSVDTEKLQKAVAKEFAAKRDNKTVKPKGRRSAD
Ga0187863_1068351313300018034PeatlandEAELCKLLMEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKAVAKEFAAKRDKKTLKPKIRKGAA
Ga0187883_1052972123300018037PeatlandCKLLLEISLLDSAYQRSTASHDDVLMDAAKRYRVDMDKLQKAVTKEFAAKRDKKTSKMKVRKAVA
Ga0187883_1064018913300018037PeatlandEAELCKLLLEISLLDSAYQRSIASRDDVLMDAAKRYRVDTEKLQKAVAEELVAKRDKKTMAKAKPKSRKTAT
Ga0187871_1013265123300018042PeatlandSELCKLLLEISLLDSAYQRSTASSDDVLMDAAKRYRVDTEKLQKAVAKEFAAKRDKKTVKAKTRKAA
Ga0187871_1023575613300018042PeatlandLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDSEKLQKAVAGELAAKRAKKTNNEKARRT
Ga0187887_1045908313300018043PeatlandLCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDSEKLQKAVAGELAAKRAKKTNNEKARRT
Ga0187887_1078632823300018043PeatlandCKLLLEISLLDSAYQRSTASRDDILIDTAKRYSVDTEKLQKAVVKELAAKRDKKTVKPKGRRSAD
Ga0187887_1097870823300018043PeatlandKQVGTYDESELCKLLLEISLLDSAYLRSTAGRDDVLMDAAKRYRVDTEKLQKAVAEELAAKRDKKTKATAKPKGRKTAA
Ga0187890_1049945423300018044PeatlandEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAAELAAKQDRTTKAGAKPKTHKTA
Ga0187890_1083577913300018044PeatlandCKLLLEISLLDSAYQRSAASRDDVLMDAAKRYRVDAERLQKLVAKEFAAKRDRKTKTTAKPKGRKTAA
Ga0187859_1036433433300018047PeatlandKQVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAEELAAKRDKKTKATAKPKGRKTAA
Ga0187859_1041176013300018047PeatlandEADLCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKPQKAVAEELAAKRDKRTKAGAKPKNRQTA
Ga0187858_1014779823300018057PeatlandLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDIEKLQKAVAAEVSAKRDKKTKAKAKPKGRATAA
Ga0187858_1030756613300018057PeatlandTYDEAELCKLLLEISLLNSAYQRSTARRDDVLMDAAKRYRVDTEKLQKAVTAEIVAKREKKPKVKPERARKPTA
Ga0187772_1099076113300018085Tropical PeatlandELLIKQVGTYDESELCKLLLEVSLLDWAYQRSSANGTDVLMSAAKRYRVDAEKLQKAAAEEFAAKLDRRQQRPDERKNTTV
Ga0182025_135247143300019786PermafrostELLAKQVSKYDDAELCKLLLEISLLDSAYQRSSASRDDVLMDAAKRYRVDAEKLQKAVAKELAAKREKKATKENVRKTAD
Ga0182031_115853833300019787BogLEISLLDSAYQRSTTSRDDVLMDAAKRYRVDSEKLQKAVAEELAGKREKKAKLKPNARTKTTG
Ga0182031_139558733300019787BogLLLEISLLDSAYQRSTASRGDVLADAAKRYRVDAEKLQKAVAEDLAVKREKATKAKPKARSKTA
Ga0210407_1006828323300020579SoilMSELSKLLLEISLLDSAYQRSTASRDDALMDAAKRYRVDTQKLQKAVAKEFATQPDKKTNKSKARKTPA
Ga0210407_1079998323300020579SoilLEISLLDSAYQRSTASRSDVLMEAAKYYRVDTEKLQKAVAKEFAAKRDKKTRVNPKSRNKTAA
Ga0210401_1042553713300020583SoilLCKLLLEISLLDSAYQRSTGSRDDVLMDAAKRYRVDTERLQKAVAKEFAAKQDKKTLKPKPRKTGA
Ga0210406_1064962013300021168SoilQVSRYDEAELCKLLLEISLLDSAYQRSTASRDDILIDAAKRYRVDTEKLQKAVAKEFAAKRDQKAIKQKVRKTAD
Ga0210400_1066201423300021170SoilLLEVSLLDSAYQRSTASRDDVLMDAAKRFRVDAEKLQKAVAKEFAAKRDKKTLKAKPRKTAA
Ga0210396_1099852023300021180SoilVGIYDESERCKLLLEIRLLDSAYRRSTASRSDFLRDAAKCYRLDTEMLQKAVAKEFAAKREKKTL
Ga0210389_1050488733300021404SoilKYDESELCKLLLEISLLDSAYQRSAASRDDVLMDAAKRYRVDTDQLQKAVAKEFAAKRDKKTIKPKGRTAAA
Ga0210387_1009349733300021405SoilVGTYEEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAKEFAAKRDKKTIKPKTRKTSA
Ga0210383_1019517213300021407SoilVGACDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKPQKAVAEELAAKRDKRTKAGAKPKNRQTV
Ga0210383_1052965413300021407SoilEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRFRVDAEKLQKTAAKEFAAKRDNKTLKAKPRKTTA
Ga0210390_1041239033300021474SoilVGACDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDIEKVQKVVAKEFMAKRDRKTLK
Ga0242643_12468313300022500SoilLEVSLLDSAYQRSNASRGDVLMDAAKRFRVDTEKLQKAVAKEFVAKRDKKTIKPKGRTAA
Ga0224558_104552613300023090SoilLAKQVSKYDDAELCKLLLEISLLDSAYQRSAASRDDVLMDTAKRYRVDTEKLQKAVTAEFVAKGMKKPKAQPHGVRKTAV
Ga0208188_111907923300025507PeatlandLVGTYDEADLCKLLLEISLLDSAYQRSSTSRDDVLMDAAKRYRVDAEKLQKAVAKEFAGKQDKKTIKPKGGTVAG
Ga0209577_1051532623300026552SoilASQPSRARANAKDSLGGKYGEAELGKLLLEISLLDSAYQRSTTSRDDVLMDAAKRFRVDTEKLRKAVAKEFAAKRDKKAIKPKVRNATT
Ga0179587_1063768723300026557Vadose Zone SoilLCKLLLEISLLDSAYQRSSTSRDDVLMDAAKRYRVDAEKLQKTVAKEFAAKRDKKAVKPKTRRSAA
Ga0209421_106061413300027432Forest SoilFDDAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDSEKLQKAVAGELAAKRAKKTNNEKARRT
Ga0208324_103955533300027604Peatlands SoilLLAKQVGTYDEAELCKLLLEISLLDSAYQRSTTSRDDVLMDAAKRYRVDAEKLQKAVAKEFAAKRDKKTLKPKVRKGAA
Ga0208044_115221713300027625Peatlands SoilLTKQVGTYDESELCKLLLEISLLDSAYQRSTASRDDILIDAAKRYRVDTEKLQKAVAKEFAAKRDEKAIKQKVRKTAD
Ga0209656_1038334613300027812Bog Forest SoilLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAEELATKRDKKTKAGAKPKNRKTA
Ga0209693_1024185023300027855SoilPRRRRTFWPSKSAKFDDAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKAVAKEFAAKRDKKTVKSKARKTAA
Ga0209701_1056468113300027862Vadose Zone SoilTYDEAELCKLVLEISLLDSAYQRSTASRDDILIDAAKRYRVDTEKLQKAVAKEFAAKRDQKAIKQKVRKTAD
Ga0209579_1074268613300027869Surface SoilESELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKAVAKELASKRDKKTVKPKTSKTAA
Ga0209169_1071906123300027879SoilLLLEISLLDSAYQRSTSSRDDVLMDAAKRYRVDAEKLQKAVAAELAAKRDKKTKAEAKPENRKTV
Ga0209380_1071004513300027889SoilQVGNYDESELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAEELTAKREKKTKVGTKPKTRKTA
Ga0209415_1005446163300027905Peatlands SoilDEAELCKLLLEISLLDSAYQRSTSSGDDILMDAAKRYRVDAEKLQKAVSVELAAKRGNKTKTTAKPQDRKTAA
Ga0209415_1022125053300027905Peatlands SoilDEAELCKLLLEISLLDSAYQRSTSSRDDVLMDAAKRYRVDAEKLQKAVAAEFVVKRGKKPRAKLDGVRKTAV
Ga0209006_1026051413300027908Forest SoilYDETELCKLLLEISLLDSAYQRSTASRDDVLMDTAKRYRVDAEKLQKAVAKEFAAKRGKKTNKPKTPKTAA
Ga0209006_1142810023300027908Forest SoilYDESELCKLLLEITLLDSAYLRSTASHDNVLTDAAKRYRVDADKIQKAVAAEFVAKHLKKTKAKPGGVRKAV
Ga0137415_10005350143300028536Vadose Zone SoilVGTYDESELCKLLLEMSLLDSAYQRSSISRDDVLMEAAKRYRVDAEKLQKAVAKEFAAKRDKKTIKPKSGKAAA
Ga0302303_1002209613300028776PalsaVLAKQVGKYEEAELCKLLLEISLLDSAYQRSTGSREDVLMDAAKRYRVDGAKLHKAVAEELAAKREKTTKSKTDTRSKATL
Ga0302227_1011682223300028795PalsaELCKLLLEISLMDSAYQRSTGSRDDVLMDAAKRYRVDADKLQEAVAKEFAAKRGKKTIKPKTRKTAA
Ga0302155_1052106623300028874BogVDMYDEADLCKLLLEISLLDSAYQRSTARRGDVLMDAAKRYRVDAEKLQKAVAKEFAAKQTEKTSKPKVRKAEA
Ga0302235_1005775613300028877PalsaLLAKQVSKYDDAELCKLLLEISLLDSAYQRSTASSDDVLMDVAKRYRVDTEKLQKAVALELATKREKKTKGKAKPKSRTATT
Ga0311327_1016628123300029883BogLCKLLLEISLVDSAYQRSTENRDDGLMDAAKRYRVDTEKLQKAVAKEFATKRDKKTIKPKGRTAAA
Ga0311329_1101853213300029907BogTNDEAELCKLLLEISLVDSAYQRSTENRDDGLMDAAKRYRVDTEKLQKAVAKEFATKRDKKTIKPKGRTAAA
Ga0311326_1039866323300029917BogVGKYEEAELCKLVLEISLLDSAYQRSATSRDDVLMDAAKRYRVDTDRLQKAVAQGLTAKRDKKTKATPKPKGQKTTA
Ga0311363_1046343913300029922FenLEISLLDSAYQRSTASLDDVLMDAAKRYRVDTDKLQKAVAEELAAKRDKKTMGKAKPKSRRTAV
Ga0311330_1032189713300029945BogKCGATYDEAELCKLLLEISLVDSAYQRSTENRDDGLMDAAKRYRVDTEKLQKAVAKEFATKRDKKTIKPKGRTAAA
Ga0311342_1054723413300029955BogLGKCGATYDEAELCKLLLEISLVDSAYQRSTENRDDGLMDAAKRYRVDTEKLQKAVAKEFATKRDKKTIKPKGRTAAA
Ga0302276_1028571213300029992BogGKCGATYDEAELCKLLLEISLVDSAYQRSTENRDDGLMDAAKRYRVDTEKLQKAVAKEFATKRDKKTIKPKGRTAAA
Ga0311338_1194132223300030007PalsaLEISLLDSAYQRSTSSRDDILMDAAKRYRVDTEKLQKAVAVELAAKRDRTKTKAKPKARKTTG
Ga0302178_1015921523300030013PalsaLLLEISLLDSAYQRSTASSDDVLMDVAKRYRVDTEKLQKAVALELATKREKKTKGKAKPKSRTATT
Ga0302282_108037723300030045FenAFDESELSKLLLEISLLDSAYQRSTTSRDDVLTDAAKRYRVDIEKLHKAVAKEFATKQDKKTIKPKTPKTAT
Ga0311370_1145262913300030503PalsaQVGTYDEAELCKLLLEISLLDSAYQGSTASRDDVLMDAAKRYRVDAEKLQKAVAKEFAAKRDKKTLKAKPRKTTA
Ga0311370_1247178113300030503PalsaMTSPNSASCFSISLLDSAYQRFTGSRNDVLMDAAKRYRVDTEKLRTTVAEELAAKRDKKTKARAKPKNRKTA
Ga0302275_1011898233300030518BogLGKQVGKYEEAELCKLVLEISLLDSAYQRSATSRDDVLMDAAKRYRVDTDRLQKAVAQGLTAKRDKKTKATPKPKGQKTTA
Ga0265750_102928623300030813SoilLCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKAVAKELATKREKKTTKPKGQGGRLNPIGF
Ga0302325_1171111913300031234PalsaELCKLLLEISLLDSAYQRSTARRDDVLMDAAKRYRVDTEKLQKDVAKEFAAKGQKKTRVKPKARSKTEA
Ga0302324_10062350313300031236PalsaTYDESELCKLLLEVSLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAKEFTAKRDKKTIKPKGRTAAT
Ga0302324_10123332723300031236PalsaDEAELCKLLLEISLLDSAYQRSTSSRDDVLMEAAKRYRVDTEKVQKAVAKEFAAKRDKKTVKAKARKTAA
Ga0302140_1050048913300031261BogESELSKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDADKLQKAVAREFVVKRDRKTKVTPKPRNKMAG
Ga0302326_1136116923300031525PalsaLLLEISLVDSAYQRSTENRDDGLMDAAKRYRVDTEKLQKAVAKEFATKRDKKTIKPKGRTAAA
Ga0310686_10479848933300031708SoilELCKLLLEISLLDSAYQRSAASRDDVLMDAAKRYRVDTAKLQKAVAEELAAKRDKKTIKPKIRKATV
Ga0310686_10741452023300031708SoilVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAEELSAKRDKKAIKSKARKTSA
Ga0310686_10836694423300031708SoilLEISLLDSAYQRSTSSRDDVLMDASKRYRVDAEKLQKAVADELAVKRDKTTKAKAKTKARKTAA
Ga0310686_10940541213300031708SoilLLEISLLDSAYQRSRSSRDDLLMDAAKRYRVDSEKLQKAVAGELAAKRTKKTDNGKARRT
Ga0310686_10946578013300031708SoilLLAKQVGTYDEAELCKLLLEISLLDSAYERSTGSRNDVLMDAAKRYRVDTEKLQKAVANEFAAKRDKKTIRPKGRKASA
Ga0310686_11697636513300031708SoilTYDEAELCKLLLEISLLDSAYQRSTASRDDVLAGAAKRYRVDAEKLQKAVAEDLAVKREKATKAKPKARSKTGLAS
Ga0307476_1115045113300031715Hardwood Forest SoilVGCYDDADLCKLLLEISLLDSAYQRGTVSRTMFMDAAKSYRVDSEKLQKTVAKELATKREKKADEPKARKTPA
Ga0302319_1103384013300031788BogQVSTYDEAELCKLLLEISLLDSAYQRSTSSRDDVLADAAKRYRVDAEKLQRAVAKELAATREKKAKSKANARRTTAA
Ga0307479_1214120313300031962Hardwood Forest SoilYDEAELCKLLVEISLLDSAYQRSGSSREDVLMDAAKRYRVDGDKVQKAVAHELATKREKKRPKARTHTKISA
Ga0311301_1142194323300032160Peatlands SoilGKYEEAELCKLLLEISLLDSAYQRSIAGRDDILMDAAKRYRVDTEKLQKAVAKELATKRDKKTLKPKVRKATA
Ga0311301_1237718113300032160Peatlands SoilKPLAKRINKFDESEVRKMLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAKEFAAKRDKKTIKPKGRTAAA
Ga0348332_1012969723300032515Plant LitterAKQVGTYDESELCKLLLEVSLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKAVAKEFAAKRDKKTIRPKVRKGQPESNHS
Ga0348332_1377661313300032515Plant LitterVSTYDESELCKLLLEMSLLDSAYQRSSTSRDDVFIDAAKRYRVDAEKLQKAVAKEFAAKRDQKAIKQKVRKTAD
Ga0335079_1196511213300032783SoilELLAKQVGTYDEAELCKLLLEISLLDSAYQRSTTSHDDVLMDAAKRYRVDAEKLQKAVAKEFAAKRDKKTVKPKTRTTAA
Ga0335078_1180436213300032805SoilLCKLLLEIGLLDSAYQRSTASRDDILMDAAKRYRVDTEKLQKAVAKEFAMKRDKKAAKPRARKTVD
Ga0335080_1213725813300032828SoilKQMGTYDEAELCKLLLEISLLESAYQRSTASRDDVLMDVAKRYRVDVEKLQKAVSAEFTAKKQRSKAKGKAVA
Ga0335070_1181469123300032829SoilYDEAELCKLLIEISLLDSAYQRSTTSRDDVLMDAAKRYRVDAEKLQTAVAEELAAKRDKKTKAKAKPKNHKTAV
Ga0370483_0052598_1081_12843300034124Untreated Peat SoilELCRLVLEISLLDSAYQRSTASRDDVLMEAAKRYRVDAEKLQKTVAREFAAKRDKKTIKPNRRKAAD
Ga0370492_0431514_317_5323300034282Untreated Peat SoilESELCKLLLEISLLDSAYQRTTATRDDVLMDTAKRYRVDTEKLQKAAAEELAAKRDQTKAKARPKNRRPAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.