Basic Information | |
---|---|
Family ID | F043115 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 157 |
Average Sequence Length | 42 residues |
Representative Sequence | MATHAAATRNISGLARALAQHGLMTEYEAETLQTQAQQAG |
Number of Associated Samples | 141 |
Number of Associated Scaffolds | 157 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 28.03 % |
% of genes near scaffold ends (potentially truncated) | 99.36 % |
% of genes from short scaffolds (< 2000 bps) | 92.99 % |
Associated GOLD sequencing projects | 133 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (82.166 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (6.369 % of family members) |
Environment Ontology (ENVO) | Unclassified (43.312 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.675 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.53% β-sheet: 0.00% Coil/Unstructured: 51.47% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 157 Family Scaffolds |
---|---|---|
PF03471 | CorC_HlyC | 90.45 |
PF01578 | Cytochrom_C_asm | 2.55 |
PF13519 | VWA_2 | 0.64 |
PF00886 | Ribosomal_S16 | 0.64 |
PF02978 | SRP_SPB | 0.64 |
PF00521 | DNA_topoisoIV | 0.64 |
COG ID | Name | Functional Category | % Frequency in 157 Family Scaffolds |
---|---|---|---|
COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.64 |
COG0228 | Ribosomal protein S16 | Translation, ribosomal structure and biogenesis [J] | 0.64 |
COG0541 | Signal recognition particle GTPase | Intracellular trafficking, secretion, and vesicular transport [U] | 0.64 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 82.17 % |
Unclassified | root | N/A | 17.83 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000854|WSSedB2T2DRAFT_1021266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 635 | Open in IMG/M |
3300001213|JGIcombinedJ13530_103533113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 645 | Open in IMG/M |
3300001213|JGIcombinedJ13530_107614149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 605 | Open in IMG/M |
3300004463|Ga0063356_104327080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 611 | Open in IMG/M |
3300004782|Ga0062382_10556859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 557 | Open in IMG/M |
3300005181|Ga0066678_10279927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1086 | Open in IMG/M |
3300005181|Ga0066678_10930841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 567 | Open in IMG/M |
3300005290|Ga0065712_10209261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1079 | Open in IMG/M |
3300005330|Ga0070690_100340446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1086 | Open in IMG/M |
3300005331|Ga0070670_100065524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3117 | Open in IMG/M |
3300005331|Ga0070670_101606959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 598 | Open in IMG/M |
3300005337|Ga0070682_101957533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
3300005356|Ga0070674_101244456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 662 | Open in IMG/M |
3300005364|Ga0070673_100505253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1094 | Open in IMG/M |
3300005437|Ga0070710_10660335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 734 | Open in IMG/M |
3300005458|Ga0070681_11339688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 639 | Open in IMG/M |
3300005539|Ga0068853_102204613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 534 | Open in IMG/M |
3300005543|Ga0070672_100750755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 856 | Open in IMG/M |
3300005543|Ga0070672_100779212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 840 | Open in IMG/M |
3300005564|Ga0070664_101652405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 607 | Open in IMG/M |
3300005569|Ga0066705_10936756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae | 514 | Open in IMG/M |
3300005578|Ga0068854_100144801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1827 | Open in IMG/M |
3300005615|Ga0070702_100341575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1051 | Open in IMG/M |
3300005615|Ga0070702_101374715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 576 | Open in IMG/M |
3300005618|Ga0068864_100281458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1552 | Open in IMG/M |
3300005719|Ga0068861_101008068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 795 | Open in IMG/M |
3300005764|Ga0066903_102566959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 987 | Open in IMG/M |
3300005886|Ga0075286_1054706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 565 | Open in IMG/M |
3300005995|Ga0066790_10077166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1433 | Open in IMG/M |
3300006046|Ga0066652_101600719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae | 599 | Open in IMG/M |
3300006163|Ga0070715_10357902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 799 | Open in IMG/M |
3300006224|Ga0079037_102221613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 548 | Open in IMG/M |
3300006578|Ga0074059_11535969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1498 | Open in IMG/M |
3300006579|Ga0074054_11833615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 739 | Open in IMG/M |
3300006604|Ga0074060_11557620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 536 | Open in IMG/M |
3300006806|Ga0079220_11944881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae | 523 | Open in IMG/M |
3300006953|Ga0074063_10200931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1100 | Open in IMG/M |
3300007076|Ga0075435_101685407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 556 | Open in IMG/M |
3300009137|Ga0066709_103783863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 549 | Open in IMG/M |
3300009177|Ga0105248_13255372 | Not Available | 516 | Open in IMG/M |
3300009509|Ga0123573_10422811 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1275 | Open in IMG/M |
3300009527|Ga0114942_1367991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 568 | Open in IMG/M |
3300010326|Ga0134065_10501278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 506 | Open in IMG/M |
3300010401|Ga0134121_11827438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 635 | Open in IMG/M |
3300010401|Ga0134121_13263398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 502 | Open in IMG/M |
3300011106|Ga0151489_1733500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 536 | Open in IMG/M |
3300012200|Ga0137382_10953280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 617 | Open in IMG/M |
3300012205|Ga0137362_11356322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 597 | Open in IMG/M |
3300012353|Ga0137367_11221572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 501 | Open in IMG/M |
3300012356|Ga0137371_11312619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 535 | Open in IMG/M |
3300012955|Ga0164298_10212924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1139 | Open in IMG/M |
3300012971|Ga0126369_11751971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 710 | Open in IMG/M |
3300013102|Ga0157371_11539526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 519 | Open in IMG/M |
3300013104|Ga0157370_10298043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1489 | Open in IMG/M |
3300013296|Ga0157374_10127400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 2461 | Open in IMG/M |
3300013296|Ga0157374_12337001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 562 | Open in IMG/M |
3300013306|Ga0163162_10276349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1812 | Open in IMG/M |
3300013307|Ga0157372_12231320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 629 | Open in IMG/M |
3300014319|Ga0075348_1013732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1599 | Open in IMG/M |
3300014324|Ga0075352_1300003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 512 | Open in IMG/M |
3300014968|Ga0157379_11303359 | Not Available | 701 | Open in IMG/M |
3300014969|Ga0157376_10291899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1540 | Open in IMG/M |
3300015190|Ga0167651_1099471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 546 | Open in IMG/M |
3300015255|Ga0180077_1111439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 577 | Open in IMG/M |
3300015371|Ga0132258_10786556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2398 | Open in IMG/M |
3300015374|Ga0132255_105549113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 534 | Open in IMG/M |
3300017959|Ga0187779_10192494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1273 | Open in IMG/M |
3300018060|Ga0187765_10779450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 636 | Open in IMG/M |
3300018071|Ga0184618_10504351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 507 | Open in IMG/M |
3300018476|Ga0190274_12730450 | Not Available | 590 | Open in IMG/M |
3300018920|Ga0190273_11959031 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera | 541 | Open in IMG/M |
3300020001|Ga0193731_1112682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 695 | Open in IMG/M |
3300020006|Ga0193735_1089767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 869 | Open in IMG/M |
3300020022|Ga0193733_1076769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 938 | Open in IMG/M |
3300021080|Ga0210382_10437752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 579 | Open in IMG/M |
3300021403|Ga0210397_11547460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 515 | Open in IMG/M |
3300021432|Ga0210384_10510207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1082 | Open in IMG/M |
3300021445|Ga0182009_10135661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1157 | Open in IMG/M |
3300022309|Ga0224510_10010915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4587 | Open in IMG/M |
3300022756|Ga0222622_10378609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 992 | Open in IMG/M |
3300023066|Ga0247793_1028200 | Not Available | 839 | Open in IMG/M |
3300025893|Ga0207682_10453764 | Not Available | 607 | Open in IMG/M |
3300025906|Ga0207699_10197160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1362 | Open in IMG/M |
3300025906|Ga0207699_10961875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 631 | Open in IMG/M |
3300025917|Ga0207660_10556038 | Not Available | 933 | Open in IMG/M |
3300025918|Ga0207662_10062758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2233 | Open in IMG/M |
3300025921|Ga0207652_10780324 | Not Available | 849 | Open in IMG/M |
3300025925|Ga0207650_10030292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3896 | Open in IMG/M |
3300025940|Ga0207691_10110584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2444 | Open in IMG/M |
3300025941|Ga0207711_11275417 | Not Available | 677 | Open in IMG/M |
3300025941|Ga0207711_11627882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 589 | Open in IMG/M |
3300025945|Ga0207679_10155562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1866 | Open in IMG/M |
3300025945|Ga0207679_10578384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1010 | Open in IMG/M |
3300025960|Ga0207651_12155764 | Not Available | 500 | Open in IMG/M |
3300025961|Ga0207712_11211373 | Not Available | 674 | Open in IMG/M |
3300025972|Ga0207668_11018792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 740 | Open in IMG/M |
3300025986|Ga0207658_11919791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 539 | Open in IMG/M |
3300025986|Ga0207658_12070867 | Not Available | 517 | Open in IMG/M |
3300026023|Ga0207677_10659667 | Not Available | 924 | Open in IMG/M |
3300026067|Ga0207678_10416212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1165 | Open in IMG/M |
3300026088|Ga0207641_10093741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2632 | Open in IMG/M |
3300026088|Ga0207641_11637774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 645 | Open in IMG/M |
3300026118|Ga0207675_101159082 | Not Available | 793 | Open in IMG/M |
3300026121|Ga0207683_10558677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1058 | Open in IMG/M |
3300026310|Ga0209239_1047163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1958 | Open in IMG/M |
3300027547|Ga0209864_1021244 | Not Available | 766 | Open in IMG/M |
3300027665|Ga0209983_1078668 | Not Available | 738 | Open in IMG/M |
3300027683|Ga0209392_1025128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1913 | Open in IMG/M |
3300027738|Ga0208989_10045174 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
3300027765|Ga0209073_10413310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 555 | Open in IMG/M |
3300027831|Ga0209797_10260526 | Not Available | 727 | Open in IMG/M |
3300027842|Ga0209580_10031963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2394 | Open in IMG/M |
3300027871|Ga0209397_10633820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 535 | Open in IMG/M |
3300027882|Ga0209590_11013738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 517 | Open in IMG/M |
3300027887|Ga0208980_10634923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 607 | Open in IMG/M |
3300027915|Ga0209069_10680817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 602 | Open in IMG/M |
3300028379|Ga0268266_10033540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4364 | Open in IMG/M |
3300028381|Ga0268264_10958353 | Not Available | 861 | Open in IMG/M |
3300028381|Ga0268264_11713163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 639 | Open in IMG/M |
3300028665|Ga0302160_10085816 | Not Available | 678 | Open in IMG/M |
3300028770|Ga0302258_1088232 | Not Available | 747 | Open in IMG/M |
3300028777|Ga0302290_10195377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 540 | Open in IMG/M |
3300028792|Ga0307504_10407457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 536 | Open in IMG/M |
3300030002|Ga0311350_10191322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1818 | Open in IMG/M |
3300030003|Ga0302172_10006648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3314 | Open in IMG/M |
3300030003|Ga0302172_10128094 | Not Available | 782 | Open in IMG/M |
3300030943|Ga0311366_11093764 | Not Available | 688 | Open in IMG/M |
3300031521|Ga0311364_12202564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 539 | Open in IMG/M |
3300031595|Ga0265313_10426761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 517 | Open in IMG/M |
3300031819|Ga0318568_10807627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 582 | Open in IMG/M |
3300031820|Ga0307473_10124112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1423 | Open in IMG/M |
3300031833|Ga0310917_11138368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 520 | Open in IMG/M |
3300031873|Ga0315297_11391104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 569 | Open in IMG/M |
3300031908|Ga0310900_11404221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 586 | Open in IMG/M |
3300031912|Ga0306921_10851344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1038 | Open in IMG/M |
3300031918|Ga0311367_10649976 | Not Available | 1074 | Open in IMG/M |
3300031918|Ga0311367_12087915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 545 | Open in IMG/M |
3300031997|Ga0315278_10521007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1222 | Open in IMG/M |
3300031997|Ga0315278_11358445 | Not Available | 690 | Open in IMG/M |
3300031999|Ga0315274_11155671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 772 | Open in IMG/M |
3300032075|Ga0310890_10629842 | Not Available | 833 | Open in IMG/M |
3300032256|Ga0315271_11021909 | Not Available | 714 | Open in IMG/M |
3300032397|Ga0315287_11277908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 841 | Open in IMG/M |
3300032770|Ga0335085_11401819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 732 | Open in IMG/M |
3300032782|Ga0335082_10212584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1830 | Open in IMG/M |
3300033414|Ga0316619_11101562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 697 | Open in IMG/M |
3300033418|Ga0316625_102770684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 501 | Open in IMG/M |
3300033433|Ga0326726_12469215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 504 | Open in IMG/M |
3300033434|Ga0316613_11286255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 504 | Open in IMG/M |
3300033475|Ga0310811_10674948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1009 | Open in IMG/M |
3300033482|Ga0316627_102985261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 503 | Open in IMG/M |
3300033483|Ga0316629_10606852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 814 | Open in IMG/M |
3300033487|Ga0316630_10614282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 909 | Open in IMG/M |
3300033805|Ga0314864_0028391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1203 | Open in IMG/M |
3300034147|Ga0364925_0199574 | Not Available | 736 | Open in IMG/M |
3300034157|Ga0370506_074788 | Not Available | 735 | Open in IMG/M |
3300034176|Ga0364931_0180665 | Not Available | 685 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 6.37% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.10% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.10% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.46% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.82% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.82% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.18% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.18% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 2.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.55% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.91% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.27% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.27% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.27% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.27% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.27% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.27% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.27% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.27% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.27% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.27% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.27% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.64% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.64% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.64% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.64% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.64% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.64% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.64% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.64% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.64% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.64% |
Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.64% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.64% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.64% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.64% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.64% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.64% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.64% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.64% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.64% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.64% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.64% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.64% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.64% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.64% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.64% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.64% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.64% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.64% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.64% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000854 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B2 Tule | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014319 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 | Environmental | Open in IMG/M |
3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015190 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface) | Environmental | Open in IMG/M |
3300015255 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10D | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300023066 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6 | Environmental | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300027547 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
3300028770 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_4 | Environmental | Open in IMG/M |
3300028777 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_3 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
3300034157 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18 | Environmental | Open in IMG/M |
3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
WSSedB2T2DRAFT_10212661 | 3300000854 | Wetland | MATHAASTRNISGLARALAQHGLMSEQEAENQQQAAHQAGVTFVEKILE |
JGIcombinedJ13530_1035331132 | 3300001213 | Wetland | MATHAATTRNISGLARAMAQHGVMTEYEAETLHNQAQLAGVTFVEQ |
JGIcombinedJ13530_1076141491 | 3300001213 | Wetland | MATHAATTRNISGLARAMAQHGLMSEYDAEALQSQA |
Ga0063356_1043270801 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MATHAASTRNISGLARALAQHGLMTEYEAETLQTQAAQAGVSFVDHVL |
Ga0062382_105568592 | 3300004782 | Wetland Sediment | MATHAASTRNISGLARALAQHGLMTEYEAETLQTQAQQAGATFVDHVLAGKRIT |
Ga0066678_102799271 | 3300005181 | Soil | MATHAATRTISGLARAMVQHGLLSEYDAETLQGQAQAANIGFVEQML |
Ga0066678_109308411 | 3300005181 | Soil | MATKAAVPSISGLARAMVQHGLLSEYDAETLQGQAQTASIGFVEQ |
Ga0065712_102092612 | 3300005290 | Miscanthus Rhizosphere | MATQAATRNISGLARAMVQQGLLSEYDADALHTQAKAANLGFVEQVLL |
Ga0070690_1003404462 | 3300005330 | Switchgrass Rhizosphere | MATHAASTRNISGLARALAQHGLMTEFEAEALQTQAQQAGTTFV |
Ga0070670_1000655241 | 3300005331 | Switchgrass Rhizosphere | MATQAAVRNISGLARAMVQQGLLSEFDADALQTQAKAANLGFVEQVLVSKRMTA |
Ga0070670_1016069591 | 3300005331 | Switchgrass Rhizosphere | MATHAATASRNISGLARALAQSGLMSEYEAEALQTQAQSA |
Ga0070682_1019575332 | 3300005337 | Corn Rhizosphere | MATQAAVRNISGLARAMVQQGLLSEFDADALQTQAKAASLGFVEQVLVSKRMTAQ |
Ga0070674_1012444562 | 3300005356 | Miscanthus Rhizosphere | MATHAASTRNITGLARALAQHGLMTEFEAEALQTQAQQAGVPFVDHVIT |
Ga0070673_1005052532 | 3300005364 | Switchgrass Rhizosphere | MATHVAATRNISGLARALAQHGVMSEHEAEAMQTQAQSSGV |
Ga0070710_106603352 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MATNAAARTISGLARAMVQHGLLSEYDAETLQSQAQAASIGFVEQ |
Ga0070681_113396881 | 3300005458 | Corn Rhizosphere | MATHAATRNISGLARALAQHGVMSEAEAEALQVQSQSSGIPF |
Ga0068853_1022046131 | 3300005539 | Corn Rhizosphere | MATHAATRNISGLARALAQSGLMSEYEAETLQTQAQAAGISFV |
Ga0070672_1007507551 | 3300005543 | Miscanthus Rhizosphere | MATQAAVRNISGLARAMVQQGLLSEFDADALQTQAKAANL |
Ga0070672_1007792121 | 3300005543 | Miscanthus Rhizosphere | MATHAAATRNISGLARALAQHGVMSEYEAEAMQTQAQSAGV |
Ga0070664_1016524052 | 3300005564 | Corn Rhizosphere | MATHAATRNISGLARALAQHGVMSEHEAEAMQAQAQTAGVA |
Ga0066705_109367561 | 3300005569 | Soil | MATHAATRNLSGLARALAQHGVMSEHEAEAMQTQAQS |
Ga0068854_1001448013 | 3300005578 | Corn Rhizosphere | MATHAATRNISGLARALAQSGLMTEYEAESLQTQAQVAGISFVE |
Ga0070702_1003415751 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MATHAATRNISGLARALAQHGVMSEHEAEALQTQAQTSGASFVE |
Ga0070702_1013747152 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MATHAATRNISGLARALAQHGVMSEAEAEALQVQSQSSGIPFVEQV |
Ga0068864_1002814582 | 3300005618 | Switchgrass Rhizosphere | MATHAATRNISGLARALAQSGLMSEFEAETLQTQAQQ |
Ga0068861_1010080682 | 3300005719 | Switchgrass Rhizosphere | MATHAATRNISGLARALAQSGLMSEYEAEALQTQAQT |
Ga0066903_1025669592 | 3300005764 | Tropical Forest Soil | MATTAATRNISGLARAMVQHGLLSENDAEALQTQAQATNIGFV |
Ga0075286_10547062 | 3300005886 | Rice Paddy Soil | MATHAAATRNISGLARALAQHGVMSESEAEALQLQSQSSGVPF |
Ga0066790_100771662 | 3300005995 | Soil | MATKAAAQNLSGLARAMVQHGLLSEYDAETLQGQAQTANIGFVE |
Ga0066652_1016007191 | 3300006046 | Soil | MATHAATRTISGLARAMVQHGLLSEYEAESLQGQAQAASIGFVEQMLL |
Ga0070715_103579021 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MATHAATRNISGLARALAQHGVMSEHEAEALQTQAQTSGASFVETV |
Ga0079037_1022216132 | 3300006224 | Freshwater Wetlands | MATHAASTRNISGLARALAQHGLMTEFEAEALQTQ |
Ga0074059_115359691 | 3300006578 | Soil | MATHAATRNISGLARALAQHGVMSEYEAETLQTQAQ |
Ga0074054_118336152 | 3300006579 | Soil | MATHAATRNISGLARALAQHGVMSEYEAETLQTQAQSTGASFV |
Ga0074060_115576201 | 3300006604 | Soil | MATHAATRNISGLARALAQHGIMSEYEAETLQTQAQS |
Ga0079220_119448811 | 3300006806 | Agricultural Soil | MATTAAARTISGLARAMVQHGLLSEYDAEAMQSQAQ |
Ga0074063_102009311 | 3300006953 | Soil | MATTAAPRTISGLARAMVQHGLLSEYDADALQTQAQAASIGFVEQVL |
Ga0075435_1016854071 | 3300007076 | Populus Rhizosphere | MATHAASTRNISGLARALAQHGLMTEYEAETLQTQAAQAGVSFVDHVLAGKR |
Ga0066709_1037838632 | 3300009137 | Grasslands Soil | MATHAASTRNITGLARALAQHGLMTEFEAEALQTQAQQAGVPFVD |
Ga0105248_132553722 | 3300009177 | Switchgrass Rhizosphere | MATHAASTRNLSGLARALAQHGLMTEFEAEALQTQAAQAGVTFVDH |
Ga0123573_104228112 | 3300009509 | Mangrove Sediment | MATPVTTPKISGLARALAQHGLLTENEAHGLQTQAATAGINFAEQIVL |
Ga0114942_13679911 | 3300009527 | Groundwater | MVTHEITRNISGLARALAQQGLVTEAEAEALQTQAQTAGVSF |
Ga0134065_105012782 | 3300010326 | Grasslands Soil | MATHVATRNISGLARALAQHGVMSEHEAEGMQSQAQSAGVTFVE |
Ga0134121_118274381 | 3300010401 | Terrestrial Soil | MATHAASTRNITGLARALAQHGLMTEFEAEALQTQAQQAGVPFVDHVITGKKIT |
Ga0134121_132633981 | 3300010401 | Terrestrial Soil | MATHAATRTISGLARAMVQHGLLSEYEAESLQSQAQAASIGF |
Ga0151489_17335001 | 3300011106 | Soil | MATHAASSRNISGLARALAQHRLMTEFEAETLQTQAA |
Ga0137382_109532802 | 3300012200 | Vadose Zone Soil | MATHAATRTISGLARAMVQHGLLSEYDAETLQGQA |
Ga0137362_113563221 | 3300012205 | Vadose Zone Soil | MATNAAVRTISGLARAMVQHGLLSEYDADTMQSQAQAASIGFVE |
Ga0137367_112215722 | 3300012353 | Vadose Zone Soil | MATHAATRTISGLARAMVQHGLLSEYDAETLQSQAQAAN |
Ga0137371_113126191 | 3300012356 | Vadose Zone Soil | MLLKMATKAATQNISGLARAMVQHGLLSEYDAETLQ |
Ga0164298_102129241 | 3300012955 | Soil | MATQAAVRNISGLARAMVQQGLLSEFDADALHTQAKAANLGFVEQVLVSKRMTASQ |
Ga0126369_117519712 | 3300012971 | Tropical Forest Soil | MATNAAPRTISGLARAMVQHGLVSEYDAETIQSQA* |
Ga0157371_115395261 | 3300013102 | Corn Rhizosphere | MATHAATRNLSGLARAFAQHGLLPESEADSLQTQAQSAGITFVEQVL |
Ga0157370_102980431 | 3300013104 | Corn Rhizosphere | MATHATTRNISGLARALASAGVMSEYDAEAMQLQSQQAGIT |
Ga0157374_101274001 | 3300013296 | Miscanthus Rhizosphere | MATQAAVRNISGLARAMVQQGLLSEFDADALQTQAKAANLGFVEQV |
Ga0157374_123370011 | 3300013296 | Miscanthus Rhizosphere | MATHAATRNISGLARALAQSGMMSDYEAETLQTQAQSANISF |
Ga0163162_102763493 | 3300013306 | Switchgrass Rhizosphere | MATHAATRNISGLARALAQHGVMSEHDAELLQSQAQTSNVTFV |
Ga0157372_122313202 | 3300013307 | Corn Rhizosphere | MATHVAATRNISGLARALAQHGVMSESEAEALQQQSQSSNV |
Ga0075348_10137322 | 3300014319 | Natural And Restored Wetlands | MATHAASTRDISGLARALAQHGLMTEFEAEALQTQAQQVGATFVEH |
Ga0075352_13000031 | 3300014324 | Natural And Restored Wetlands | MATHAASTRNISGLARALAQHGLMTEYEAETLQTQAQQ |
Ga0157379_113033592 | 3300014968 | Switchgrass Rhizosphere | MVSHEITRTISGLARALAQQGLMTESDAEALQSQAQTAGVSFVE |
Ga0157376_102918991 | 3300014969 | Miscanthus Rhizosphere | MATQAAVRNISGLARAMVQQGLLSEFDADALQTQAKAANLGFVEQVL |
Ga0167651_10994711 | 3300015190 | Glacier Forefield Soil | MATKAATQNLSGLARAMVQHGLLSEYDAETLQGQAQTGNIGFVE |
Ga0180077_11114392 | 3300015255 | Soil | MATHAATRNLSGLAHALAQQGVVSENDAAAIQSQAAQSSISFVEQLL |
Ga0132258_107865561 | 3300015371 | Arabidopsis Rhizosphere | MATHAAATRNLSGLARALAQHGMMTEYDAETLQTQAQQANVSF |
Ga0132255_1055491132 | 3300015374 | Arabidopsis Rhizosphere | MATHVAATRNISGLARALAQHGVMAESEAEALQQQS |
Ga0187779_101924942 | 3300017959 | Tropical Peatland | VATATTAVSRTVSGLARAMVQQGLLSEHDADALQGQAQ |
Ga0187765_107794501 | 3300018060 | Tropical Peatland | MATHVASTRNISGLARALAQHGLMTEYEAETLQTQAQQAGVSFVDHDAFGS |
Ga0184618_105043511 | 3300018071 | Groundwater Sediment | MLLTMATKAATQNISGLARAMVQHGLLSEYDAETLQG |
Ga0190274_127304502 | 3300018476 | Soil | MATHAATRNISGLARALAQHGVMSEAEAEAIQVQSQ |
Ga0190273_119590311 | 3300018920 | Soil | MATHAATRNLSGLARALAQQGLVTEGDADAIQSQAAQSGMTFVEQLLQNKR |
Ga0193731_11126822 | 3300020001 | Soil | MATKAATQNISGLARAMVQHGLLSEYDAETLQGQAQTASI |
Ga0193735_10897671 | 3300020006 | Soil | MLLTMATKAATQNISGLARAMVQHGLLSEYDAETLQ |
Ga0193733_10767692 | 3300020022 | Soil | MATKAATQNISGLARAMVQHGLLSEYDAETLQGQA |
Ga0210382_104377522 | 3300021080 | Groundwater Sediment | MATHAATRTISGLARAMVQHGLLSEYDAEALQSQAQA |
Ga0210397_115474601 | 3300021403 | Soil | MATHATTRNISGLARALAQAGVMSEFDAEAMQLQSQQAGIT |
Ga0210384_105102072 | 3300021432 | Soil | MATKAAVPSISGLARAMVQHGLLSEYDAETLQGQAQTASIGF |
Ga0182009_101356612 | 3300021445 | Soil | MATHAATTRNISGLARALAQHGLMSEGDAEAAQAQART |
Ga0224510_100109156 | 3300022309 | Sediment | MATHAAQRNLSGLARALAQQGLVSEADADAIQSQAV |
Ga0222622_103786092 | 3300022756 | Groundwater Sediment | MATHAATRNISGLARALAQHGVMSEHDAEALQSQAQ |
Ga0247793_10282001 | 3300023066 | Soil | MATHAATRNLSGLARAFAQHGLMPESEADSFQTQAQSAGIT |
Ga0207682_104537641 | 3300025893 | Miscanthus Rhizosphere | MATHAATRNISGLARALAQHGVMSEAEAEAIQVQS |
Ga0207699_101971602 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MATQAATRNISGLARAMVQQGLLSEYDADALHTQAKA |
Ga0207699_109618752 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MATHAAATRNISGLARALAQNGVMSEYEAEAMQTQA |
Ga0207660_105560381 | 3300025917 | Corn Rhizosphere | MATHAATRNISGLARALAQHGVMSESEAEALQVQSQS |
Ga0207662_100627583 | 3300025918 | Switchgrass Rhizosphere | MATHAATRNISGLARALAQSGLMTEYEAESLQTQAQVAGISF |
Ga0207652_107803242 | 3300025921 | Corn Rhizosphere | MATHAATRNISGLARALAQHGVMSESEAEALQVQDR |
Ga0207650_100302921 | 3300025925 | Switchgrass Rhizosphere | MATHAASTRNLSGLARALAQHGLMTEFEAEALQTQAAQAGA |
Ga0207691_101105843 | 3300025940 | Miscanthus Rhizosphere | MATHAASTRNLSGLARALAQHGLMTEFEAEALQTQA |
Ga0207711_112754172 | 3300025941 | Switchgrass Rhizosphere | MATHAASTRNISGLARALAQHGLMTEFEAEALQTQAQQAGTTFVDHV |
Ga0207711_116278822 | 3300025941 | Switchgrass Rhizosphere | MATHAATRNISGLARALAQSGLMSEYEAEALQTQAQTAGVSF |
Ga0207679_101555623 | 3300025945 | Corn Rhizosphere | MATHAATRNLSGLARALAQHGVMSEHEAEALQTQAQSSGVTF |
Ga0207679_105783841 | 3300025945 | Corn Rhizosphere | MATHATATRNISGLARALAQHGVMSEYEAEAMQTQAQSSGV |
Ga0207651_121557641 | 3300025960 | Switchgrass Rhizosphere | MATHAASTRNITGLARALAQHGLMTEFEAEALQTQAQQAGVPFVDHVITGKKITAT |
Ga0207712_112113731 | 3300025961 | Switchgrass Rhizosphere | MATHAATRNISGLARALAQHGVMSEHEAEALQTQAQTSGA |
Ga0207668_110187922 | 3300025972 | Switchgrass Rhizosphere | MATHAATRNISGLARALAQHGVMSEAEAEALQTQSQSSGVP |
Ga0207658_119197912 | 3300025986 | Switchgrass Rhizosphere | MATHAATRNISGLARALAQSGMMSDYEAETLQTQAQSANISFVEQ |
Ga0207658_120708672 | 3300025986 | Switchgrass Rhizosphere | MATHAATRNISGLARALAQHGVMSEAEAEALQTQSQSSGVPFVEQV |
Ga0207677_106596672 | 3300026023 | Miscanthus Rhizosphere | MATHAASTRNLSGLARALAQHGLMTEFEAEALQTQAAQAGV |
Ga0207678_104162123 | 3300026067 | Corn Rhizosphere | MATHAASTRNISGLARALAQHGLMTEFEAEALQTQAQQAGT |
Ga0207641_100937414 | 3300026088 | Switchgrass Rhizosphere | MATHAATRNISGLARALAQSGLMSEFEAETLQTQAQSA |
Ga0207641_116377742 | 3300026088 | Switchgrass Rhizosphere | MATHAASTRNITGLARALAQHGLMTEFEAEALQTQAQQAGVPFVDHVITGK |
Ga0207675_1011590822 | 3300026118 | Switchgrass Rhizosphere | MATHAATRNISGLARALAQSGLMSEYEAEALQTQAQ |
Ga0207683_105586771 | 3300026121 | Miscanthus Rhizosphere | MATHAAATRNISGLARALAQHGLMTEYEAETLQTQAQ |
Ga0209239_10471633 | 3300026310 | Grasslands Soil | MATKAAVPSISGLARAMVQHGLLSEYDAETLQGQAQT |
Ga0209864_10212441 | 3300027547 | Sand | MATHAASTRNISGLARALAQHGLMTEFEAEALQTQAQQVGATFVDHV |
Ga0209983_10786681 | 3300027665 | Arabidopsis Thaliana Rhizosphere | MATHAATRNLSGLARALAQHGLMPEVEADSFQTQAASAGI |
Ga0209392_10251283 | 3300027683 | Freshwater Sediment | MATHAAQRNLSGLARALAQQGLVSEADADAIQSQA |
Ga0208989_100451743 | 3300027738 | Forest Soil | MATKAAVSSVSGLARAMVQHGLLSEYDAETFQGQAQTASIGFVEQL |
Ga0209073_104133101 | 3300027765 | Agricultural Soil | MATTAAARTISGLARAMVQHGLLSEYDAEAMQSQAQSANIGF |
Ga0209797_102605261 | 3300027831 | Wetland Sediment | MATHAASTRNISGLARALAQHGLMTEYEAETLQTQAQQAGASFVDHVLA |
Ga0209580_100319631 | 3300027842 | Surface Soil | MMATHAATRNISGLARALAQHGVMSEQEAEALQVQSQ |
Ga0209397_106338202 | 3300027871 | Wetland | MATHAASTRNLSGLARALAQHGLLSEYDAEALQSQAQSAG |
Ga0209590_110137381 | 3300027882 | Vadose Zone Soil | MATHAATRTISGLARAMVQHGLLSEYDAETLQGQAQAANIGF |
Ga0208980_106349231 | 3300027887 | Wetland | MATHAATTRNLSGLARALAQHGLLSEYDADAIHTQ |
Ga0209069_106808171 | 3300027915 | Watersheds | MATHAATRNISGLARALAQHGVMSEHEAEALQSQAQSSGASFV |
Ga0268266_100335401 | 3300028379 | Switchgrass Rhizosphere | MATHAASTRNITGLARALAQHGLMTEFEAEALQTQAQQAGVPFVDHVITG |
Ga0268264_109583532 | 3300028381 | Switchgrass Rhizosphere | MATHAATRNISGLARALAQHGVMSEAEAEALQTQSQ |
Ga0268264_117131632 | 3300028381 | Switchgrass Rhizosphere | MATHAATRNISGLARALAQHGLMTEYDAEALQTQSQQAGVSF |
Ga0302160_100858161 | 3300028665 | Fen | MATHAATRNISGLARALAQHGVMSEHEAESLQTQAQSSGASFVE |
Ga0302258_10882322 | 3300028770 | Fen | MATHAATRNISGLARALAQHGVMSEHEAESLQTQSESTGV |
Ga0302290_101953771 | 3300028777 | Fen | MATHAATRNISGLARALAQHGVMSEHEAESLQTQSEST |
Ga0307504_104074571 | 3300028792 | Soil | MATHAATRTLSGLARAMVQHGLLSEYDAETLQTQAQ |
Ga0311350_101913223 | 3300030002 | Fen | MATHAAATRNLSGLARALAQHGLMTEFDAEALQTQAQQANVSFVEQL |
Ga0302172_100066484 | 3300030003 | Fen | MATHAATRNISGLARALAQHGVMSEHEAESLQTQAQSSGASFVETV |
Ga0302172_101280942 | 3300030003 | Fen | MATHAAATRNLSGLARAFAQHGLMTEFDAEALQTQAQQANVSFVEQ |
Ga0311366_110937641 | 3300030943 | Fen | MATTTGTSGPRNINGLARAMVQHGLLTEHDANTLQGQAQAANIGFVEQ |
Ga0311364_122025642 | 3300031521 | Fen | MATHAATRNISGLARALAQQGFMSEHEAETMQSQAQTSGAS |
Ga0265313_104267611 | 3300031595 | Rhizosphere | MATQAAATRNLSGLARALAQHGLMTESDAEALQTQAQQGNI |
Ga0318568_108076271 | 3300031819 | Soil | MATHAAATRNISGLARALAQHGLMTEYEAETLQTQAQQAG |
Ga0307473_101241121 | 3300031820 | Hardwood Forest Soil | MATHAASTRNISGLARALAQHGLMTEYEAETLQTQ |
Ga0310917_111383682 | 3300031833 | Soil | MATHAAATRNISGLARALAQHGLMTEYEAETLQTQA |
Ga0315297_113911041 | 3300031873 | Sediment | MATHAASTRNISGLARALAQHGLMTEFEAETLQVQAQQAGTTFVDHVLAG |
Ga0310900_114042212 | 3300031908 | Soil | MATHAASTRNLSGLARALAQHGLMTEFEAEALQTQAQQAG |
Ga0306921_108513442 | 3300031912 | Soil | MATHAASTRNISGLARALAQHGLMTEYEAETLQTQAQQAGVS |
Ga0311367_106499762 | 3300031918 | Fen | MATHAATRNISGLARALAQHGVMSEHEAETLQSQAQSTGASF |
Ga0311367_120879151 | 3300031918 | Fen | MVSHEITRNISGLARALAQQGLMTEQEAETLQTQAHTAGV |
Ga0315278_105210072 | 3300031997 | Sediment | MATHAASTRNISGLARALAQHGLMTEFEAETLQVQAQQAGTTFVDHV |
Ga0315278_113584451 | 3300031997 | Sediment | MATHAASTRNISGLARALAQHGLMTEFEAEALQTQA |
Ga0315274_111556711 | 3300031999 | Sediment | MATHAASTRNISGLARALAQHGLMTEFEAEALQTQAQQAGATFVD |
Ga0310890_106298422 | 3300032075 | Soil | MATHAATRNISGLARALAQHGVMSEAEAEALQTQSQSS |
Ga0315271_110219092 | 3300032256 | Sediment | MATHAASTRNISGLARALAQHGLMTEFEAEALQTQAQQVGATFVDHVIAS |
Ga0315287_112779081 | 3300032397 | Sediment | MATHAASTRNISGLARALAQHGLMTEYEAETLQTQAQQA |
Ga0335085_114018192 | 3300032770 | Soil | MATHAAPRNISGLARAMVQHGLLSEYDAETLQNQAQAANVG |
Ga0335082_102125841 | 3300032782 | Soil | MATHVASTRNISGLARALAQHGLMTEYEAETLQTQAQQAGVSFVDH |
Ga0316619_111015622 | 3300033414 | Soil | MATHAASTRNISGLARALAQHGLMTEYEAETLQTQAQQAGTTF |
Ga0316625_1027706842 | 3300033418 | Soil | MATHAASTRNLSGLARALAQHGLMTEFEAEALQTQAQQAGTA |
Ga0326726_124692151 | 3300033433 | Peat Soil | MATHPATRDLSGLARAMVQHGLLSEYDADALQSQAHAAN |
Ga0316613_112862552 | 3300033434 | Soil | MATHAATRNLSGLARALAQQGLVSESDADAMQTQAAASGITFAEQF |
Ga0310811_106749481 | 3300033475 | Soil | MATHAATRNISGLARALAQHGVMSEAEAEALQTQSQSSG |
Ga0316627_1029852611 | 3300033482 | Soil | MATQAATTRNISGLARAMAQHGLMSEYEAEALQTQAQQGGITFV |
Ga0316629_106068522 | 3300033483 | Soil | MATHAATRNLSGLARALAQQGLVSEPDADAMQTQAAASGITFAEQFLQ |
Ga0316630_106142821 | 3300033487 | Soil | MATHEITRNLSGLARALAQQGLMGEHEADALQTQA |
Ga0314864_0028391_3_134 | 3300033805 | Peatland | MATHAATRDLSGLARAMVQHGLLSEYDAETLQTQATAASIGFVE |
Ga0364925_0199574_1_111 | 3300034147 | Sediment | MATHAATRNISGLARALAQHGVMSEHEAEALQTQAQT |
Ga0370506_074788_615_734 | 3300034157 | Untreated Peat Soil | MATHAATRTISGLARALAQSGVMSDYEAETLQSQAQASGV |
Ga0364931_0180665_2_133 | 3300034176 | Sediment | MATHPATRDLSGLARAMVQHGLLSEYDADALQSQAQAANVGFVE |
⦗Top⦘ |