NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F043043

Metagenome / Metatranscriptome Family F043043

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F043043
Family Type Metagenome / Metatranscriptome
Number of Sequences 157
Average Sequence Length 43 residues
Representative Sequence AIRRDIELFYVKDDPEFDRAGNIAALLRFRADQSKGGGLRAAS
Number of Associated Samples 137
Number of Associated Scaffolds 157

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.45 %
% of genes from short scaffolds (< 2000 bps) 91.08 %
Associated GOLD sequencing projects 129
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.178 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(14.013 % of family members)
Environment Ontology (ENVO) Unclassified
(23.567 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.503 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.17%    β-sheet: 0.00%    Coil/Unstructured: 71.83%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 157 Family Scaffolds
PF01112Asparaginase_2 40.13
PF03320FBPase_glpX 2.55
PF02321OEP 1.91
PF02661Fic 1.27
PF12973Cupin_7 1.27
PF04397LytTR 1.27
PF02195ParBc 0.64
PF01850PIN 0.64
PF01135PCMT 0.64
PF14534DUF4440 0.64
PF09723Zn-ribbon_8 0.64
PF00484Pro_CA 0.64
PF02518HATPase_c 0.64
PF00069Pkinase 0.64
PF12867DinB_2 0.64
PF01464SLT 0.64
PF01541GIY-YIG 0.64
PF05016ParE_toxin 0.64
PF00365PFK 0.64
PF07681DoxX 0.64
PF02885Glycos_trans_3N 0.64
PF13174TPR_6 0.64

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 157 Family Scaffolds
COG1446Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamilyAmino acid transport and metabolism [E] 40.13
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 3.82
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.55
COG1494Fructose-1,6-bisphosphatase/sedoheptulose 1,7-bisphosphatase or related proteinCarbohydrate transport and metabolism [G] 2.55
COG02056-phosphofructokinaseCarbohydrate transport and metabolism [G] 0.64
COG0288Carbonic anhydraseInorganic ion transport and metabolism [P] 0.64
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.64
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.64
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.64
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 0.64
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.64
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.64


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.18 %
UnclassifiedrootN/A3.82 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_108787433All Organisms → cellular organisms → Bacteria → Acidobacteria846Open in IMG/M
3300002245|JGIcombinedJ26739_101130434All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis671Open in IMG/M
3300002560|JGI25383J37093_10009155All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3219Open in IMG/M
3300004091|Ga0062387_100043991All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2088Open in IMG/M
3300004631|Ga0058899_12066328All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300005181|Ga0066678_10689980All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter680Open in IMG/M
3300005337|Ga0070682_101462735All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter586Open in IMG/M
3300005446|Ga0066686_10270772All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1150Open in IMG/M
3300005447|Ga0066689_10279419All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1032Open in IMG/M
3300005467|Ga0070706_100132248All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2328Open in IMG/M
3300005468|Ga0070707_101470837All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter648Open in IMG/M
3300005538|Ga0070731_11024933All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300005542|Ga0070732_10863234All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300005557|Ga0066704_10599823All Organisms → cellular organisms → Bacteria → Acidobacteria708Open in IMG/M
3300005559|Ga0066700_10038026All Organisms → cellular organisms → Bacteria2875Open in IMG/M
3300005559|Ga0066700_11169294All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300005587|Ga0066654_10500596All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300005598|Ga0066706_11189662All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter579Open in IMG/M
3300005615|Ga0070702_100092901All Organisms → cellular organisms → Bacteria → Acidobacteria1833Open in IMG/M
3300005841|Ga0068863_101681682All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter644Open in IMG/M
3300006050|Ga0075028_100392338All Organisms → cellular organisms → Bacteria → Acidobacteria792Open in IMG/M
3300006102|Ga0075015_100355838All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300006173|Ga0070716_100217192All Organisms → cellular organisms → Bacteria1282Open in IMG/M
3300006176|Ga0070765_100567371All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300006176|Ga0070765_101455569All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300006354|Ga0075021_10601058All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300006794|Ga0066658_10684558All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300006797|Ga0066659_10273280All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1276Open in IMG/M
3300006871|Ga0075434_100482115All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1261Open in IMG/M
3300006893|Ga0073928_10112973All Organisms → cellular organisms → Bacteria → Acidobacteria2254Open in IMG/M
3300007076|Ga0075435_100004539All Organisms → cellular organisms → Bacteria9544Open in IMG/M
3300009036|Ga0105244_10526207Not Available545Open in IMG/M
3300009089|Ga0099828_10604889All Organisms → cellular organisms → Bacteria → Acidobacteria987Open in IMG/M
3300009089|Ga0099828_10954740All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4765Open in IMG/M
3300009792|Ga0126374_10058856All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1995Open in IMG/M
3300009824|Ga0116219_10176204All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1230Open in IMG/M
3300009839|Ga0116223_10606698All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium632Open in IMG/M
3300010046|Ga0126384_10869149All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia812Open in IMG/M
3300010320|Ga0134109_10072814All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300010326|Ga0134065_10005419All Organisms → cellular organisms → Bacteria → Acidobacteria3228Open in IMG/M
3300010343|Ga0074044_10802900All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300010358|Ga0126370_10680289All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300010358|Ga0126370_11687403All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300010358|Ga0126370_11857153All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300010361|Ga0126378_10449177All Organisms → cellular organisms → Bacteria1403Open in IMG/M
3300010361|Ga0126378_10460855All Organisms → cellular organisms → Bacteria1385Open in IMG/M
3300010366|Ga0126379_10040227All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3755Open in IMG/M
3300010375|Ga0105239_13411761Not Available517Open in IMG/M
3300010376|Ga0126381_101695525All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300010379|Ga0136449_104522045All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4511Open in IMG/M
3300010400|Ga0134122_10918163All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300010401|Ga0134121_10652024All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium992Open in IMG/M
3300011120|Ga0150983_14388326All Organisms → cellular organisms → Bacteria → Acidobacteria737Open in IMG/M
3300011269|Ga0137392_10379012All Organisms → cellular organisms → Bacteria1173Open in IMG/M
3300011271|Ga0137393_10605255All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium940Open in IMG/M
3300012208|Ga0137376_11274035All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300012212|Ga0150985_110790819All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1752Open in IMG/M
3300012285|Ga0137370_10316882All Organisms → cellular organisms → Bacteria → Acidobacteria934Open in IMG/M
3300012285|Ga0137370_10607142All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300012361|Ga0137360_11832572All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300012501|Ga0157351_1015495All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300012582|Ga0137358_10104185All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1923Open in IMG/M
3300012918|Ga0137396_10453750All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300012929|Ga0137404_12024958All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300012960|Ga0164301_11057736All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300012986|Ga0164304_10885184All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300013296|Ga0157374_11770889All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300013306|Ga0163162_13343250All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300015245|Ga0137409_10323865All Organisms → cellular organisms → Bacteria1349Open in IMG/M
3300015261|Ga0182006_1104854All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300015372|Ga0132256_100406522All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1464Open in IMG/M
3300016294|Ga0182041_11410141All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300016319|Ga0182033_12086125All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300016357|Ga0182032_11398875All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300017924|Ga0187820_1187252All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4640Open in IMG/M
3300017939|Ga0187775_10050784All Organisms → cellular organisms → Bacteria → Acidobacteria1265Open in IMG/M
3300017974|Ga0187777_11042340All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M
3300017995|Ga0187816_10485464All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300018001|Ga0187815_10288528All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300018022|Ga0187864_10271355All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4769Open in IMG/M
3300018034|Ga0187863_10664260All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300018086|Ga0187769_11324031All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300018433|Ga0066667_11344646All Organisms → cellular organisms → Bacteria → Acidobacteria625Open in IMG/M
3300018433|Ga0066667_12322365All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300019789|Ga0137408_1180302All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300020581|Ga0210399_10024956All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4750Open in IMG/M
3300021168|Ga0210406_10505349All Organisms → cellular organisms → Bacteria → Acidobacteria955Open in IMG/M
3300021178|Ga0210408_10467008All Organisms → cellular organisms → Bacteria → Acidobacteria1004Open in IMG/M
3300021178|Ga0210408_10860439All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium707Open in IMG/M
3300021401|Ga0210393_10946496All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300021401|Ga0210393_11601846Not Available516Open in IMG/M
3300021402|Ga0210385_10435558Not Available988Open in IMG/M
3300021404|Ga0210389_10321232All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella1214Open in IMG/M
3300021405|Ga0210387_10648261All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium937Open in IMG/M
3300021406|Ga0210386_11442981All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300021420|Ga0210394_10655787All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium921Open in IMG/M
3300021479|Ga0210410_10115829All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella2373Open in IMG/M
3300021479|Ga0210410_10182967All Organisms → cellular organisms → Bacteria1875Open in IMG/M
3300021479|Ga0210410_11365163All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300021559|Ga0210409_11406657All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4573Open in IMG/M
3300022507|Ga0222729_1026888All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae711Open in IMG/M
3300022557|Ga0212123_10941189All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300022726|Ga0242654_10322837All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4574Open in IMG/M
3300022732|Ga0224569_104598All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300025901|Ga0207688_10463730Not Available791Open in IMG/M
3300025906|Ga0207699_10873787All Organisms → cellular organisms → Bacteria → Acidobacteria663Open in IMG/M
3300025910|Ga0207684_11120726All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300025911|Ga0207654_10506631All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium853Open in IMG/M
3300025928|Ga0207700_10312345All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1360Open in IMG/M
3300025937|Ga0207669_11140071All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300025939|Ga0207665_10840551All Organisms → cellular organisms → Bacteria → Proteobacteria727Open in IMG/M
3300025941|Ga0207711_11043713All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium757Open in IMG/M
3300025949|Ga0207667_11728573All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300025949|Ga0207667_11733544All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300026322|Ga0209687_1013355All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2721Open in IMG/M
3300026322|Ga0209687_1314457All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300026325|Ga0209152_10350246All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300026469|Ga0257169_1020283All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300026537|Ga0209157_1180273All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium917Open in IMG/M
3300027559|Ga0209222_1090535All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium591Open in IMG/M
3300027725|Ga0209178_1153066All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium797Open in IMG/M
3300027795|Ga0209139_10178163All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300027846|Ga0209180_10401172All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4777Open in IMG/M
3300027867|Ga0209167_10358965All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300027867|Ga0209167_10363886All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4787Open in IMG/M
3300027884|Ga0209275_10352476All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium825Open in IMG/M
3300027894|Ga0209068_10580147All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300028665|Ga0302160_10128701All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4576Open in IMG/M
3300028906|Ga0308309_11194521All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300030494|Ga0310037_10021404All Organisms → cellular organisms → Bacteria3123Open in IMG/M
3300030706|Ga0310039_10243441All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300031090|Ga0265760_10104870All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium896Open in IMG/M
3300031708|Ga0310686_106708605All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1302Open in IMG/M
3300031753|Ga0307477_10006227All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis8439Open in IMG/M
3300031754|Ga0307475_10589293All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300031754|Ga0307475_11004559All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae656Open in IMG/M
3300031770|Ga0318521_10255145All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1024Open in IMG/M
3300031792|Ga0318529_10228853All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium864Open in IMG/M
3300031820|Ga0307473_10902383All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300031912|Ga0306921_10827387Not Available1056Open in IMG/M
3300031962|Ga0307479_10899638All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium857Open in IMG/M
3300031962|Ga0307479_11031962All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300031962|Ga0307479_11296637All Organisms → cellular organisms → Bacteria → Acidobacteria689Open in IMG/M
3300032035|Ga0310911_10641507All Organisms → cellular organisms → Bacteria → Acidobacteria616Open in IMG/M
3300032094|Ga0318540_10614851All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300032160|Ga0311301_12920090All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4517Open in IMG/M
3300032180|Ga0307471_103868254All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300032205|Ga0307472_100450610All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1094Open in IMG/M
3300032515|Ga0348332_13772203All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium770Open in IMG/M
3300032782|Ga0335082_11429050All Organisms → cellular organisms → Bacteria → Acidobacteria562Open in IMG/M
3300032783|Ga0335079_10148742All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2629Open in IMG/M
3300033158|Ga0335077_10752681All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300033158|Ga0335077_11658006All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300033475|Ga0310811_10480032All Organisms → cellular organisms → Bacteria1313Open in IMG/M
3300033475|Ga0310811_10683410All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300034090|Ga0326723_0060084All Organisms → cellular organisms → Bacteria → Acidobacteria1616Open in IMG/M
3300034818|Ga0373950_0079935All Organisms → cellular organisms → Bacteria682Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.01%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.73%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.73%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.82%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.82%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.55%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.55%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.55%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.55%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.55%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.91%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.91%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.27%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.27%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.27%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.27%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.27%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.27%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.27%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.27%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.64%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.64%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.64%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.64%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.64%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.64%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.64%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.64%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.64%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.64%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.64%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.64%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.64%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cmEnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012501Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610EnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015261Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022507Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022732Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300027559Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028665Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10878743333300000955SoilELFYIKGDREFDKVGNIAALLRFRADQARTPIAASA*
JGIcombinedJ26739_10113043423300002245Forest SoilEDVCEAIVPAAIRRDIELLYVKDEPGLDQVGNIAALLRFRADQSKGAMSAAS*
JGI25383J37093_1000915553300002560Grasslands SoilIRRDVELLYVRDEPEFDRVGNIAALLRFRADQSRGGAVVA*
Ga0062387_10004399113300004091Bog Forest SoilLEDACDAIIPIAILRDIELFYVKDDPEFDSAGNIAALLRFRADQSRGSALSVAS*
Ga0058899_1206632823300004631Forest SoilIEDVCDAVIPIAIRRDVELFYVKDDLEFDSAGNIAALLRFRADKSGSHIAVAS*
Ga0066678_1068998013300005181SoilSDGIIPAAIRRDVELLYVRDDPDFDRVGNIAALLRFRADRGRGGTAVA*
Ga0070682_10146273523300005337Corn RhizosphereAIHRDIELFYVKNDPELDRVGNIAALLRFRADQNTPSKVSAA*
Ga0066686_1027077223300005446SoilPAAIRRDVELFYVKNDPEFDRVGNIAALLRFRADQNRSGEISAAS*
Ga0066689_1027941913300005447SoilSDGIIPAAIRRDVELLYVRDDPDFDRVGNIAALLRFRADQSRGGTAVA*
Ga0070706_10013224833300005467Corn, Switchgrass And Miscanthus RhizosphereRDVELFYVKDDPEFDRVGNIAALLRFRADQNRSGQISAAS*
Ga0070707_10147083723300005468Corn, Switchgrass And Miscanthus RhizosphereEDVCDAIIPATIRRDIELFYVDGDPEFDKVGNIAALLRFRADRSKGGGVAVAS*
Ga0070731_1102493313300005538Surface SoilELFYVKNNPEFDKVGNVAALLRFRADQSKPQMAAAS*
Ga0070732_1086323423300005542Surface SoilAMIPLAIRRDIELFYVKNNPEFDKVGNIAALLRFRADQAKTPAAASA*
Ga0066704_1059982313300005557SoilRDIELFYVKDNPEFDKVGNIAALLRFRADQARTPVAASA*
Ga0066700_1003802613300005559SoilAMIPLAIRRDIELFYVKDNPEFDKVGNIAALLRFRADQARVPVAASA*
Ga0066700_1116929413300005559SoilIVPAAIRRDVELFYVKNDPEFDRVGNIAALLRFRADQNRSGQISAAS*
Ga0066654_1050059623300005587SoilIRRDVELLYVRDDPEFDRIGNIAALLRFRTDQSRGGTAVA*
Ga0066706_1118966223300005598SoilPAAILRDIELLYVPPLPELDHVGNIAALLRFRADQSKGGMATVS*
Ga0070702_10009290133300005615Corn, Switchgrass And Miscanthus RhizosphereRDIELFYVKKQPEFDKVGNIAALLRFRVDQVRPAPLLAAS*
Ga0068863_10168168223300005841Switchgrass RhizosphereTAIHRDIELFYVKNDPELDRVGNIAALLRFRADQNTPSKVSAA*
Ga0075028_10039233833300006050WatershedsFYVKDDEEFDQAGNIAALLRFRADRSKGARIAVAS*
Ga0075015_10035583823300006102WatershedsDAIIPAAIRRDVELLYVKEEPEFDRVGSIAALLRFRADQNKGGIAIAS*
Ga0070716_10021719213300006173Corn, Switchgrass And Miscanthus RhizosphereIRRDVELLYVRDEPEFDRVGNIAALLRFRTGQNRGTAIA*
Ga0070765_10056737113300006176SoilRRDIELFYVKDDPEFDSAGNIGALLRFRADQSNGRALSVAS*
Ga0070765_10145556913300006176SoilRDIELFYVKDDPEFDSAGNIAALLRFRADQSKGSALSAAS*
Ga0075021_1060105813300006354WatershedsIELFFVKDEPALDHVGNIAALLRFRSDQSKGRLAVAS*
Ga0066658_1068455813300006794SoilRRDIELFYVKDNPEFDKVGNIAALLRFRADQARVPVAASA*
Ga0066659_1027328013300006797SoilRRDVELFYVKNDPEFDRVGNIAALLRFRADQNRSGEISAAS*
Ga0075434_10048211523300006871Populus RhizosphereVELFFVRNEPALDQVGNIAALLRFRADQSKGRLAAAS*
Ga0073928_1011297313300006893Iron-Sulfur Acid SpringAIVPAAIRRDVELVYVKDEPEFDQVGSIAALLRFRADQRKGGAAVAS*
Ga0075435_100004539113300007076Populus RhizosphereVELIYVKNEPKLDMAGNIAALLRFRADQNKNGQLAAS*
Ga0105244_1052620723300009036Miscanthus RhizosphereYVKKQPEFDKVGNIAALLRFRVDQVRPAPLLAAS*
Ga0099828_1060488913300009089Vadose Zone SoilYVKDDPEFDQVGNIAALLRFRTDQSKGSRITAAS*
Ga0099828_1095474013300009089Vadose Zone SoilFYVKDDPEFDQVGNIAALLRFRTDQSKGSRITAAS*
Ga0126374_1005885633300009792Tropical Forest SoilRDIELFYVKNDPEFDKVGNIAALLRFRADKSGTHIAVAS*
Ga0116219_1017620443300009824Peatlands SoilYVKDDPEFDRAGNIAALLRFRTDQSKGRGMRAAS*
Ga0116223_1060669823300009839Peatlands SoilRDIELFYVKDDPEFDRAGNIAALLRFRADQSKGGGLHAAS*
Ga0126384_1086914933300010046Tropical Forest SoilLFYVKNNPELDRVGNIGALLRFRADQNTPSKVAIA*
Ga0134109_1007281423300010320Grasslands SoilAAIRRDVELLYVRDEPEFDRVGNIAALLRFRADQSRGGAFVA*
Ga0134065_1000541943300010326Grasslands SoilIPAAIRRDVELLYVRDEPEFDRVGNIAALLRFRADQSRGGAVVA*
Ga0074044_1080290013300010343Bog Forest SoilDIELFYVKDDPKFDAAGNIAALLRFRADQNTNAGLRAVS*
Ga0126370_1068028923300010358Tropical Forest SoilCDAIIPIAIRRDIELFYVDSADLDSAGNIAALLRFRADQTKGSALGIAV*
Ga0126370_1168740313300010358Tropical Forest SoilENVCEAMIPIAIQRDIELFYVKSDSEFDHVGNIAAMLRFRADQSRAPQVAVA*
Ga0126370_1185715313300010358Tropical Forest SoilIRRDIELFYVKNDEEFDHAGNIAALLRFRADQPRSFGIAVAS*
Ga0126378_1044917713300010361Tropical Forest SoilDIELFYVKNDEEFDHAGNIAALLRFRADQPRAVGIAVAS*
Ga0126378_1046085513300010361Tropical Forest SoilLFYVKGDPEFDHVGNIAALLRFRADQTRASQLAAAS*
Ga0126379_1004022753300010366Tropical Forest SoilQAIDRDIELFYVKEDPELDRVGNIAALLRFRADQNKPAILAAS*
Ga0105239_1341176123300010375Corn RhizosphereAIRRDVELMYVKDEPEFENVGGIAALLRFRAGQKKNGMAVAS*
Ga0126381_10169552523300010376Tropical Forest SoilAAAIRRDIELFYVKNDEEFDHAGNIAALLRFRADQPRSFGIAVAS*
Ga0136449_10452204513300010379Peatlands SoilIPAAIRRDVELFYVKDDPEFDRAGNIAALLRFRTDQSKGRGMRAAS*
Ga0134122_1091816313300010400Terrestrial SoilIRRDVELVYVKDEPEFENVGGIAALLRFRAGQKKNGMAVAS*
Ga0134121_1065202413300010401Terrestrial SoilGVELFFVRNEPALDQVGNIAALLRFRADQSKGRLAAAS*
Ga0150983_1438832623300011120Forest SoilMIPMAIRRDIELFYVKDNAEFDKVGNIAALLRFRADQSKPQMAAAS*
Ga0137392_1037901213300011269Vadose Zone SoilPAAIRRDVELVYVRDEPEFDQVGSIAALLRFRADQRKGGAAVAS*
Ga0137393_1060525513300011271Vadose Zone SoilPAAIRRDVELLYVNEDPAFDRVGSIAALLRFRSDQNKGGMAVAS*
Ga0137376_1127403523300012208Vadose Zone SoilAIRRDVELLYVRDDPDFDRVGNIAALLRFRADRSRGGTAVA*
Ga0150985_11079081913300012212Avena Fatua RhizosphereIPMAIRRDVELIYVKDQPEFDRVGNIGALLRFRADQSAGGITSRAS*
Ga0137370_1031688213300012285Vadose Zone SoilTIRRDIELFYVDGDPEFDKVGNIAALLRFRADQSKGGGVAVAS*
Ga0137370_1060714223300012285Vadose Zone SoilVELLYVRDDPDFDRVGNIAALLRFRADRSRGGTAVA*
Ga0137360_1183257223300012361Vadose Zone SoilCEAIVPAAIRRGIELFYVKDEPALDHVGNIAALLRFRADQSKGRLVRAS*
Ga0157351_101549513300012501Unplanted SoilVCEALVPVAIRRDIELFYVKKPPEFDKVGNIAALLRFRVDQVRPAPLLAAS*
Ga0137358_1010418513300012582Vadose Zone SoilVCDAIVPAAIRRDIELVYVKDEPALDHVGNIAALLRFRADQSKGRVTAAS*
Ga0137396_1045375023300012918Vadose Zone SoilAIQRDIELFYVKDDPAFDRVGNIGALLRFRADQSTPSRNAVA*
Ga0137404_1202495813300012929Vadose Zone SoilIELFYVDGDPEFDKVGNIAALLRFRADQSKGSGMAAVS*
Ga0164301_1105773613300012960SoilRDIELFYVKNDPELDRVGNIAALLRFRADQNTPSKVSAA*
Ga0164304_1088518413300012986SoilDVCEALVPAAIRRDVELVYVKDEPEFENVGGIAALLRFRAGQKKGGMAVAS*
Ga0157374_1177088923300013296Miscanthus RhizosphereVAIRRDIELFYVKKQPEFDKVGNIAALLRFRVDQAKPRQISAAS*
Ga0163162_1334325023300013306Switchgrass RhizosphereVAIRRDIELFYVKKQPEFDKVGNIAALLRFRVDQVKPRQISAAS*
Ga0137409_1032386523300015245Vadose Zone SoilLEDVGDAIIPAAIRRDIELLYVKDDPALDRVGNIAAILRFRAEASRGMAAAS*
Ga0182006_110485413300015261RhizosphereHRDIELFYVKNDPELDRVGNIAALLRFRADQNTPSKVSAA*
Ga0132256_10040652233300015372Arabidopsis RhizosphereRRDIELFYVKNDPEFDKVGNIAALLRFRADKSGTHVAVAS*
Ga0182041_1141014113300016294SoilDIELYYVKDDQEFDHAGNIAALLRFRADQPRSLGIAVAS
Ga0182033_1208612513300016319SoilDVCEAMIPVAIRRDIEFFAVKDHPEFDRAGNIAALLRFRADQSRAAPMAAAS
Ga0182032_1139887533300016357SoilFYVKDDPEFDKVGNIAAMLRFRADRGKAPQMAVAS
Ga0187820_118725213300017924Freshwater SedimentRDIELFYVKDDPDFDGAGNIAALLRFRADQSKGSGLRAAS
Ga0187775_1005078413300017939Tropical PeatlandRDIELFYVKNEAEFDKVGNIAAVLRFRADQPRVPRVAAAS
Ga0187777_1104234023300017974Tropical PeatlandAIRRDIELFYVKNDPEFDHVGNIAALLRYRADKKTAQPMAAAS
Ga0187816_1048546413300017995Freshwater SedimentLFYVKDEPEFEQAGNIAALLRFRSDQNKSGETRAS
Ga0187815_1028852823300018001Freshwater SedimentELFYVSDEPEFDSAGNIAALLRFRADQSKGNVTSVAS
Ga0187864_1027135523300018022PeatlandRDIELFYVKDDPEFDRAGNIAALLRFRADQSKGRDMLAAS
Ga0187863_1066426023300018034PeatlandRDLELFYIKDNPEFDGAGNIAALLRFRADQNTNSALRAAS
Ga0187769_1132403113300018086Tropical PeatlandDAIIPIAIRRDIELLYVKDDPEFDSAGNIAALLRFRADQTTSGPMAVAS
Ga0066667_1134464613300018433Grasslands SoilIVPATIRRDIELFYVDGDPEFDKVGNIAALLRFRADQSKGGGVAVAS
Ga0066667_1232236523300018433Grasslands SoilAIRRDVELLYVRDDPDFDRVGNIAALLRFRADQSRGGTAVA
Ga0137408_118030223300019789Vadose Zone SoilVELVFVKDEPEFDRVGSIAALLRFRVDQKKSGMAAAS
Ga0210399_1002495663300020581SoilVELVYVKDEPEFDQVGSIAALLRFRADQRKGGAAVAS
Ga0210406_1050534913300021168SoilRELEDVCEAMIPVAIKRDIELFYVKDDPEFDKVGNIAAMLRFRADRGKAPQMAVAS
Ga0210408_1046700813300021178SoilMIPMAIRRDIELFYVKGNDEFDKVGNIAALLRFRADQAKPPVAASA
Ga0210408_1086043913300021178SoilLFYVKNNPEFDKVGNIAALLRFRADQARTPAAASA
Ga0210393_1094649613300021401SoilAMIPVAIRRDIELFYVKNDAEFDTVGNIAALLRFRADQGRSPQMAVAS
Ga0210393_1160184623300021401SoilLFYIRDNSEFDGAGNIGALLRFRADQNTNMTLRAAS
Ga0210385_1043555813300021402SoilIRRDIELFYVKNHPEFDRVGNIAALLRFRADQSRPQIAAAS
Ga0210389_1032123233300021404SoilFYVKDDPEFDRAGNIAALLRFRADQSKGSGLRAAS
Ga0210387_1064826123300021405SoilAIIPAAIRRDIELFYVKDDPEFDRAGNIAALLRFRADQSKGSGLRAAS
Ga0210386_1144298123300021406SoilIELLYVKDDPEFDRAGNIAALLRFRADQSKGEIRAAS
Ga0210394_1065578723300021420SoilAAIRRDIELFYVKDDPEFDRAGNIAALLRFRADQSKGSGLRAAS
Ga0210410_1011582943300021479SoilAIIPAAIRRDIELFYVKDDPEFDRAGNIAALLRFRADQSKGGSLRAAS
Ga0210410_1018296713300021479SoilEAIIPAAIQRDIELLYVKDDPDFDRAGNIAALLRYRADQSKGRETRVAS
Ga0210410_1136516323300021479SoilEAIIPAAIRRDIEVFYVKDEPDFDRVGNIAALLRFRADQSKNGLAVAS
Ga0210409_1140665713300021559SoilELFYVKDDPEFDSAGNIAALLRFRADQSNGHALSVAS
Ga0222729_102688823300022507SoilLFYVKNNPEFDKVGNIAALLRFRADQARTPVAASA
Ga0212123_1094118913300022557Iron-Sulfur Acid SpringAIRRDVELVYVKDEPEFDQVGSIAALLRFRADQRKGGAAVAS
Ga0242654_1032283723300022726SoilRDVELFYVKDDSEFDRAGNIAALLRFRADQSKGGMLAAS
Ga0224569_10459813300022732RhizosphereIIPAAIRRDVELFYVKDDPEFDRAGNIAALLRFRADQSKGRGMRAAS
Ga0207688_1046373033300025901Corn, Switchgrass And Miscanthus RhizosphereQKLEDVCEALVPAAIRRDVELMYVKDEPEFENVGGIAALLRFRAGQKKNGMAVAS
Ga0207699_1087378713300025906Corn, Switchgrass And Miscanthus RhizosphereDAMIPLAIRRDIELFYVKNNPEFDKVGNIAALLRFRADQARTPVAASA
Ga0207684_1112072613300025910Corn, Switchgrass And Miscanthus RhizosphereDVELLYVRDDPDFDRVGNIAALLRFRADQSRGGTAVA
Ga0207654_1050663113300025911Corn RhizosphereVPAAIRRDVELVYVKDEPEFDRIGSIAALLRFRADQKRGGIAVAS
Ga0207700_1031234513300025928Corn, Switchgrass And Miscanthus RhizosphereDVCDAIIPMAIRRDIELFYIKNSPEFDKVGNVGALLRFRADQARTPVAASA
Ga0207669_1114007123300025937Miscanthus RhizosphereLEDVCEALVPAAIRRDVELMYVKDEPEFENVGGIAALLRFRAGQKKNGMAVAS
Ga0207665_1084055113300025939Corn, Switchgrass And Miscanthus RhizosphereIRRDVELLYVRDEPEFDRVGNIAALLRFRTGQNRGTAIA
Ga0207711_1104371323300025941Switchgrass RhizosphereIHRDIELFYVKNDPELDRVGNIAALLRFRADQNTPSKVSAA
Ga0207667_1172857313300025949Corn RhizosphereELFYVKNDPELDRVGNIAALLRFRADQNTPSKVSAA
Ga0207667_1173354423300025949Corn RhizosphereIVRGAIRRDVELMYVREDPEFDHVGGIAALLRFRADGKSKKAAVAS
Ga0209687_101335513300026322SoilRATRELEDVCEAIIPMAIRRDVELIYVKDQPEFDRVGNIGALLRFRADQSAGGSTSRAS
Ga0209687_131445713300026322SoilLFYVKDDAELDRVGNIAALLRFRADQNTPARIFAAS
Ga0209152_1035024613300026325SoilRRDIELFYVKDNPEFDKVGNIAALLRFRADQARVPVAASA
Ga0257169_102028323300026469SoilLFFVKDEPALDHVGNIAALLRFRADQSKGGLAAAS
Ga0209157_118027323300026537SoilPAAIRRDVELFYVKNDPEFDRVGNIAALLRFRADQNRSGEISAAS
Ga0209222_109053523300027559Forest SoilDVELFYVKDDPDFDRAGNIAALLRFRADQSKGGGLRAAS
Ga0209178_115306623300027725Agricultural SoilVELVYVKDEPEFENVGGIAALLRFRSGQKKNGMAVAS
Ga0209139_1017816313300027795Bog Forest SoilIELFYVKDDPEFDRAGNIAALLRFRADQSKGRGLQAAS
Ga0209180_1040117213300027846Vadose Zone SoilPITIHRNIELFYVKDDPEFDQVGNIAALLRFRTDQSKGSRITAAS
Ga0209167_1035896523300027867Surface SoilAAIRRDIELFYVKDDPEFDRAGNIAALLRFRADQSKGGGLRAAS
Ga0209167_1036388623300027867Surface SoilVELFYVKDDPEFDRAGNIAALLRFRTDQSKGGMLAAS
Ga0209275_1035247633300027884SoilAIRRDIELFYVKDDPEFDRAGNIAALLRFRADQSKGGSLRAAS
Ga0209068_1058014713300027894WatershedsIELFFVKDEPALDHVGNIAALLRFRSDQSKGRLAVAS
Ga0302160_1012870113300028665FenELFYVKDDPEFEQAGNIAALLRFRADQNKGEAAMAS
Ga0308309_1119452123300028906SoilIRRDIELFYVKDDPEFDSAGNIAALLRFRADQSKGSALSAAS
Ga0310037_1002140443300030494Peatlands SoilFYVKDDPEFDRAGNIAALLRFRADQSKGREMLAAS
Ga0310039_1024344113300030706Peatlands SoilACDAMIPIAIRRDIELFYVKDDPEFDSAGNIAALLRFRADQNHGRAMSAAS
Ga0265760_1010487033300031090SoilAIRRDIELFYVKDDPEFDRAGNIAALLRFRADQSKGGGLRAAS
Ga0310686_10670860513300031708SoilIRRDIELFYVKDDPEFDRAGNIAALLRFRADQSKGRGILAAS
Ga0307477_1000622793300031753Hardwood Forest SoilIRRDIEVFYVKDEPDFDRVGNIAALLRFRADQSKNGLAVAS
Ga0307475_1058929313300031754Hardwood Forest SoilACDAIIPMAIRRDIELFYVKNNPEFDKVGNIAALLRFRADQARTPAAASA
Ga0307475_1100455923300031754Hardwood Forest SoilIPLAIRRDIELFYVKNNPEFDKVGNIAALLRFRADQARTPVAASA
Ga0318521_1025514523300031770SoilAMIPMAIRRDIELFYVKNDPEFDRVGNIAALLRFRADQTKTGPVAAAS
Ga0318529_1022885323300031792SoilPMAIRRDIELFYVKNDPEFDRVGNIAALLRFRADQTKTGPVAAAS
Ga0307473_1090238313300031820Hardwood Forest SoilDAIVPAAIRRDVELVYVKDEPEFDRIGSIAALLRFRADQKRGGIAVAS
Ga0306921_1082738713300031912SoilDAMIPMAIRRDIELFYVKPDPEFDKVGNIAALLRFRTDQARTPIAAAS
Ga0307479_1089963813300031962Hardwood Forest SoilAIRRDIELFYVKNDEEFDKVGNIAALLRFRADKSGSHVAVAS
Ga0307479_1103196223300031962Hardwood Forest SoilAIRRDIEVFYVKDEPDFDRVGNIAALLRFRADQSKNGLAVAS
Ga0307479_1129663713300031962Hardwood Forest SoilAIRRDIELFYVKDNLEFDRAGNIAALLRFRADQSKGGMLAAS
Ga0310911_1064150723300032035SoilMIPMAIRRDIELFYVKPDPEFDKVGNIAALLRFRTDQARTPIAAAS
Ga0318540_1061485113300032094SoilLEDVCEAMIPVAIKRDIELFYVKDDPEFDKVGNIAAMLRFRADRGKAPQMAVAS
Ga0311301_1292009013300032160Peatlands SoilRRDVELFYVSDEPEFDRAGNIAALLRFRADQSKGSVIAAAS
Ga0307471_10386825413300032180Hardwood Forest SoilRRDVELVYVKDEPEFDHVGGIAALLRFRSGQKKGAIAVAS
Ga0307472_10045061013300032205Hardwood Forest SoilIIPAAIRRDIELFYVKDDPEFDRAGNIAALLRFRADQGKGRGLPAAS
Ga0348332_1377220333300032515Plant LitterEAIIPAAIRRDIELFYVKDDPEFDRAGNIAALLRFRADQSKGGSLRAAS
Ga0335082_1142905013300032782SoilEAMIPIAIQRDIELFYVKNDAEFDHVGNIAALLRFRADQSRASQMAVAS
Ga0335079_1014874233300032783SoilSGAIRRDIELLYVKNDPEFDQAGNIGALLRFRVDQSRAGGGFAVAS
Ga0335077_1075268123300033158SoilDAIIPLAISRDVELFYIKDDTEFDRSGNIAALLRFRADQSKGNLTQKAS
Ga0335077_1165800623300033158SoilIRRDIELFYVKDDPEFDSAGNIAALLRFRADQSKGNVVRAAS
Ga0310811_1048003223300033475SoilAAIRRDVELMYVKDEPEFENVGGIAALLRFRAGQKKNGMAVAS
Ga0310811_1068341023300033475SoilDAIIPQAIRRDIELFYVKDDPELDRVGNIGALLRFRADQNKPAILAAS
Ga0326723_0060084_1442_15943300034090Peat SoilMDAVIPAAIQRDIELFYVKDEPEFDSAGNIAALLRFRADRSTGARMVAAS
Ga0373950_0079935_16_1773300034818Rhizosphere SoilLEDVCEALVPAAIRRDVELMYVKDEPEFENVGGIAALLRFRSGQKKNGMAVAS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.