NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F043032

Metagenome Family F043032

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F043032
Family Type Metagenome
Number of Sequences 157
Average Sequence Length 50 residues
Representative Sequence MKIFFFDIETVPTDKSLQENGLLEEQIKLDEAELIKKLSLSAATAKII
Number of Associated Samples 146
Number of Associated Scaffolds 157

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 51.59 %
% of genes near scaffold ends (potentially truncated) 98.09 %
% of genes from short scaffolds (< 2000 bps) 91.72 %
Associated GOLD sequencing projects 138
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.363 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(10.828 % of family members)
Environment Ontology (ENVO) Unclassified
(38.217 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(36.306 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.32%    β-sheet: 0.00%    Coil/Unstructured: 73.68%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 157 Family Scaffolds
PF12705PDDEXK_1 71.34
PF13361UvrD_C 20.38
PF03104DNA_pol_B_exo1 1.27
PF00580UvrD-helicase 0.64
PF01019G_glu_transpept 0.64

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 157 Family Scaffolds
COG0417DNA polymerase B elongation subunitReplication, recombination and repair [L] 1.27
COG0210Superfamily I DNA or RNA helicaseReplication, recombination and repair [L] 0.64
COG0405Gamma-glutamyltranspeptidaseAmino acid transport and metabolism [E] 0.64
COG10743’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 0.64
COG3973DNA helicase IVReplication, recombination and repair [L] 0.64

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.36 %
UnclassifiedrootN/A0.64 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918013|NODE_2454_length_1260_cov_9.802381All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae1292Open in IMG/M
2228664022|INPgaii200_c1051295All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium536Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101764513All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1379Open in IMG/M
3300000550|F24TB_13615636All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium684Open in IMG/M
3300000891|JGI10214J12806_10138351All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium957Open in IMG/M
3300000955|JGI1027J12803_103892927All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium512Open in IMG/M
3300002104|C687J26621_10192892All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium608Open in IMG/M
3300002121|C687J26615_10198836All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium510Open in IMG/M
3300002128|JGI24036J26619_10059153All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium753Open in IMG/M
3300002899|JGIcombinedJ43975_10035460All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium820Open in IMG/M
3300003994|Ga0055435_10030041All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1216Open in IMG/M
3300003998|Ga0055472_10281651All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300004156|Ga0062589_102260525All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium558Open in IMG/M
3300004463|Ga0063356_104770694All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium583Open in IMG/M
3300004463|Ga0063356_105573722All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300004479|Ga0062595_101438215All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium631Open in IMG/M
3300004480|Ga0062592_101601958All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300005093|Ga0062594_100719544All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium905Open in IMG/M
3300005183|Ga0068993_10014156All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1885Open in IMG/M
3300005218|Ga0068996_10217863All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300005332|Ga0066388_103240175All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium832Open in IMG/M
3300005332|Ga0066388_107370442All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium552Open in IMG/M
3300005335|Ga0070666_10084332All Organisms → cellular organisms → Bacteria2174Open in IMG/M
3300005340|Ga0070689_100944823All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium765Open in IMG/M
3300005345|Ga0070692_10386814All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium879Open in IMG/M
3300005406|Ga0070703_10220238All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium755Open in IMG/M
3300005440|Ga0070705_100859905All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium726Open in IMG/M
3300005441|Ga0070700_101066036All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium668Open in IMG/M
3300005467|Ga0070706_101907021All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300005536|Ga0070697_100528665All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1033Open in IMG/M
3300005549|Ga0070704_100185115All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1669Open in IMG/M
3300005563|Ga0068855_101336641All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium740Open in IMG/M
3300005616|Ga0068852_102844780All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300005843|Ga0068860_101095461All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium816Open in IMG/M
3300005844|Ga0068862_101264651All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium738Open in IMG/M
3300005890|Ga0075285_1022444All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium759Open in IMG/M
3300006049|Ga0075417_10051019All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1786Open in IMG/M
3300006173|Ga0070716_100956559All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium674Open in IMG/M
3300006358|Ga0068871_101753821All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300006844|Ga0075428_100285620All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1775Open in IMG/M
3300006844|Ga0075428_102387101All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300006845|Ga0075421_100753099All Organisms → cellular organisms → Bacteria1126Open in IMG/M
3300006847|Ga0075431_101462657All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium642Open in IMG/M
3300006853|Ga0075420_101409083All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium598Open in IMG/M
3300006865|Ga0073934_10504159All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium723Open in IMG/M
3300006871|Ga0075434_101071186All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium820Open in IMG/M
3300006903|Ga0075426_10541508All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium867Open in IMG/M
3300006904|Ga0075424_100678341All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300006904|Ga0075424_100687417All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1093Open in IMG/M
3300006969|Ga0075419_10903078All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium637Open in IMG/M
3300007004|Ga0079218_11281625All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium769Open in IMG/M
3300009053|Ga0105095_10396103All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium762Open in IMG/M
3300009088|Ga0099830_10005918All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis7086Open in IMG/M
3300009100|Ga0075418_10850769All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300009137|Ga0066709_102886411All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium635Open in IMG/M
3300009153|Ga0105094_10824243All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300009157|Ga0105092_10208406All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1093Open in IMG/M
3300009157|Ga0105092_10233990All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1030Open in IMG/M
3300009157|Ga0105092_10276560All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium945Open in IMG/M
3300009545|Ga0105237_11832263All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium614Open in IMG/M
3300009792|Ga0126374_11376204All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium573Open in IMG/M
3300009816|Ga0105076_1003699All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae2366Open in IMG/M
3300010335|Ga0134063_10006505All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis4404Open in IMG/M
3300010366|Ga0126379_12294214All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium640Open in IMG/M
3300010373|Ga0134128_11821808All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium670Open in IMG/M
3300010391|Ga0136847_11230662All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1761Open in IMG/M
3300010399|Ga0134127_10941414All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium921Open in IMG/M
3300010399|Ga0134127_12301569All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium618Open in IMG/M
3300011417|Ga0137326_1142505All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium553Open in IMG/M
3300011420|Ga0137314_1187503All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300011423|Ga0137436_1132544All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium666Open in IMG/M
3300011427|Ga0137448_1203689All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300011438|Ga0137451_1150525All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium728Open in IMG/M
3300011440|Ga0137433_1255603All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium572Open in IMG/M
3300011442|Ga0137437_1219738All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium660Open in IMG/M
3300011443|Ga0137457_1341334All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300012034|Ga0137453_1004356All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1801Open in IMG/M
3300012160|Ga0137349_1019527All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1060Open in IMG/M
3300012166|Ga0137350_1074082All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium680Open in IMG/M
3300012179|Ga0137334_1073040All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium752Open in IMG/M
3300012189|Ga0137388_10311539All Organisms → cellular organisms → Bacteria1445Open in IMG/M
3300012200|Ga0137382_10517937All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium848Open in IMG/M
3300012207|Ga0137381_11217672All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium646Open in IMG/M
3300012208|Ga0137376_10038425All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis3851Open in IMG/M
3300012672|Ga0137317_1027042All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium564Open in IMG/M
3300012911|Ga0157301_10366598All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium548Open in IMG/M
3300012916|Ga0157310_10238185All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium682Open in IMG/M
3300012930|Ga0137407_11335557All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium681Open in IMG/M
3300012930|Ga0137407_11413154All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium661Open in IMG/M
3300012948|Ga0126375_11182275All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium635Open in IMG/M
3300012985|Ga0164308_10061227All Organisms → cellular organisms → Bacteria2487Open in IMG/M
3300014265|Ga0075314_1104898All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium615Open in IMG/M
3300014296|Ga0075344_1039077All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium817Open in IMG/M
3300014305|Ga0075349_1140695All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium559Open in IMG/M
3300014315|Ga0075350_1131246All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium618Open in IMG/M
3300014872|Ga0180087_1099776All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300014873|Ga0180066_1080107All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium668Open in IMG/M
3300014876|Ga0180064_1054919All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium803Open in IMG/M
3300014885|Ga0180063_1216416All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium615Open in IMG/M
3300015200|Ga0173480_11087331All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300015241|Ga0137418_10423040All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1082Open in IMG/M
3300015372|Ga0132256_100745377All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1096Open in IMG/M
3300015373|Ga0132257_100432337All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1605Open in IMG/M
3300015374|Ga0132255_102007029All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium880Open in IMG/M
3300015374|Ga0132255_102579939All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium776Open in IMG/M
3300017997|Ga0184610_1097363All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium929Open in IMG/M
3300018052|Ga0184638_1043858All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1626Open in IMG/M
3300018053|Ga0184626_10022882All Organisms → cellular organisms → Bacteria2547Open in IMG/M
3300018073|Ga0184624_10363290All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium648Open in IMG/M
3300018076|Ga0184609_10318465All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium727Open in IMG/M
3300018077|Ga0184633_10513644All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300018078|Ga0184612_10162474All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1167Open in IMG/M
3300018079|Ga0184627_10171795All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1148Open in IMG/M
3300018422|Ga0190265_10485444All Organisms → cellular organisms → Bacteria1346Open in IMG/M
3300019377|Ga0190264_10354526All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium923Open in IMG/M
3300019878|Ga0193715_1024778All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1302Open in IMG/M
3300019885|Ga0193747_1067945All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium880Open in IMG/M
3300020001|Ga0193731_1163559All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium538Open in IMG/M
3300021063|Ga0206227_1117598All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300022898|Ga0247745_1061020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium609Open in IMG/M
3300024055|Ga0247794_10219193All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium619Open in IMG/M
3300025165|Ga0209108_10180829All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1099Open in IMG/M
3300025313|Ga0209431_11220845All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300025322|Ga0209641_10406513All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium981Open in IMG/M
3300025326|Ga0209342_10736746All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium784Open in IMG/M
3300025580|Ga0210138_1051882All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium945Open in IMG/M
3300025903|Ga0207680_10078539All Organisms → cellular organisms → Bacteria2067Open in IMG/M
3300025915|Ga0207693_10095945Not Available2325Open in IMG/M
3300025917|Ga0207660_10181626All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1634Open in IMG/M
3300025918|Ga0207662_11074487All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300025935|Ga0207709_10401130All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1048Open in IMG/M
3300025938|Ga0207704_10217640All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1410Open in IMG/M
3300026025|Ga0208778_1005856All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1128Open in IMG/M
3300026118|Ga0207675_100256505All Organisms → cellular organisms → Bacteria1694Open in IMG/M
3300027364|Ga0209967_1031936All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium789Open in IMG/M
3300027722|Ga0209819_10000609All Organisms → cellular organisms → Bacteria → Proteobacteria10609Open in IMG/M
3300027722|Ga0209819_10063702All Organisms → cellular organisms → Bacteria1273Open in IMG/M
3300027748|Ga0209689_1259219All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium703Open in IMG/M
3300027873|Ga0209814_10118619All Organisms → cellular organisms → Bacteria1128Open in IMG/M
3300027907|Ga0207428_10195126All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1525Open in IMG/M
3300027909|Ga0209382_10679929All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1110Open in IMG/M
3300028380|Ga0268265_12217404All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300030606|Ga0299906_10095886All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2360Open in IMG/M
3300030606|Ga0299906_10761358All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium723Open in IMG/M
(restricted) 3300031197|Ga0255310_10074399All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium898Open in IMG/M
3300031852|Ga0307410_10100237All Organisms → cellular organisms → Bacteria2075Open in IMG/M
3300031946|Ga0310910_10572249All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium896Open in IMG/M
3300031954|Ga0306926_11270808All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium861Open in IMG/M
3300032002|Ga0307416_102943186All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300032013|Ga0310906_10530836All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium801Open in IMG/M
3300032157|Ga0315912_10827332All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium737Open in IMG/M
3300032174|Ga0307470_10138592All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1468Open in IMG/M
3300032829|Ga0335070_10193592All Organisms → cellular organisms → Bacteria2029Open in IMG/M
3300033004|Ga0335084_10696991All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300033811|Ga0364924_170379All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium519Open in IMG/M
3300034147|Ga0364925_0333844All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium570Open in IMG/M
3300034819|Ga0373958_0200079All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium523Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil10.83%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.64%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.73%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.10%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.10%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment4.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.82%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.55%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.55%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil2.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.55%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.91%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.27%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.27%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.27%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.27%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.27%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.27%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.27%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.27%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.64%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.64%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.64%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.64%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.64%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.64%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.64%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.64%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.64%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.64%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.64%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.64%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.64%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.64%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.64%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918013Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)EnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002104Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2EnvironmentalOpen in IMG/M
3300002121Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1EnvironmentalOpen in IMG/M
3300002128Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5EnvironmentalOpen in IMG/M
3300002899Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607)EnvironmentalOpen in IMG/M
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005218Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005890Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009816Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011417Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2EnvironmentalOpen in IMG/M
3300011420Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300011427Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300011443Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2EnvironmentalOpen in IMG/M
3300012034Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2EnvironmentalOpen in IMG/M
3300012160Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2EnvironmentalOpen in IMG/M
3300012166Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2EnvironmentalOpen in IMG/M
3300012179Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012672Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT266_2EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300014265Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2EnvironmentalOpen in IMG/M
3300014296Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300014305Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1EnvironmentalOpen in IMG/M
3300014315Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1EnvironmentalOpen in IMG/M
3300014872Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10DEnvironmentalOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300014876Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10DEnvironmentalOpen in IMG/M
3300014885Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10DEnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300021063Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025580Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026025Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027364Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033811Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Iowa-Corn-GraphCirc_001489502140918013SoilMKIFYFDIETVPTEKALEENGLLDAQIKLDEPELIXXXXXX
INPgaii200_105129512228664022SoilMKILFFDIETVPTQQSLQDNNLLEAQMVLNEAEIIKKL
INPhiseqgaiiFebDRAFT_10176451323300000364SoilMKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYAMEPPLDSFVE
F24TB_1361563613300000550SoilMKICFLDIETVPTDRSLEENGLLEPQIQLDESEIIKKLSLSAATAKIICICYAI
JGI10214J12806_1013835123300000891SoilMKILFFDIETVPTEPSLQENGLLEEQIRLDEAEVLKKLSLSAATAKIICLCYAIEPSVSG
JGI1027J12803_10389292713300000955SoilMKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYA
C687J26621_1019289223300002104GroundwaterMKIFFFDIETVPTEQSLQDNGLLESQIKLDEAELLKKLSLSAATARILCLA
C687J26615_1019883613300002121SoilMKIFFFDIETVPTEQSLQDNGLLESQIKLDEAELLKKLSLSAATARIL
JGI24036J26619_1005915313300002128Corn, Switchgrass And Miscanthus RhizosphereMKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKK
JGIcombinedJ43975_1003546013300002899SoilMKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLLKKLSLSATTAKILCLCYATEPAAQPAIEVLDGDE
Ga0055435_1003004123300003994Natural And Restored WetlandsMKIMYLDIETVPTDKALQENGLLESQIQLDEAELIKKLSLSAATAK
Ga0055472_1028165113300003998Natural And Restored WetlandsMNVFFFDIETVPTDRALKDNGLLDPQLKLEEPELIKKLSLSGATA
Ga0062589_10226052513300004156SoilMKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTAKILCLC
Ga0063356_10477069413300004463Arabidopsis Thaliana RhizosphereMKIFYFDIETVPTDKSLQDNGLLEPQIKLDEAEIIKKLSLSAITAKIICLCYAT
Ga0063356_10557372223300004463Arabidopsis Thaliana RhizosphereMKTLFLDIETVPTDRALAESGILEPQIQLEENEIIKKLSLSAATAKILCIGYAIEPPVGAEVQVL
Ga0062595_10143821513300004479SoilMKILFFDIETVPTDQSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYALEPP
Ga0062592_10160195813300004480SoilMSSMKIFFFDIETIPTDQSVLDNNLLAAQMRLDEPEIIKKLSLSAATARILCLAYAIE
Ga0062594_10071954413300005093SoilMKICFFDIETVPTEPSLQENGLLEEQIRLDEAEILKKLSLSAATAK
Ga0068993_1001415613300005183Natural And Restored WetlandsMKIFYFDIETVPTDHALKENGLLDAQIKLDEPELIKKLSLSAATAKIICLCYAFEPSL
Ga0068996_1021786313300005218Natural And Restored WetlandsMKIFYFDIETVPTDQSLKENGLLDAQIKLDEPELIKRLSLSAATAKIICLCYAFE
Ga0066388_10324017513300005332Tropical Forest SoilMKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLLKKLSLSATTAKILCLCY
Ga0066388_10737044223300005332Tropical Forest SoilMKVIFLDIETVPTDQALLEHGLLEPQLQFNEAELIKKLSLSATTAKIVCLCYA
Ga0070666_1008433213300005335Switchgrass RhizosphereMKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTAKILCL
Ga0070689_10094482313300005340Switchgrass RhizosphereMKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAMEPAVHTAIEVLD
Ga0070692_1038681413300005345Corn, Switchgrass And Miscanthus RhizosphereMKILFFDIETVPTEPSLQENGLLEEQIRLDEAEVLKKLSLSAATAKIICLCYAIEPSV
Ga0070703_1022023813300005406Corn, Switchgrass And Miscanthus RhizosphereMKVILLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAM
Ga0070705_10085990513300005440Corn, Switchgrass And Miscanthus RhizosphereMKIFFFDIETVPTNKSLQENGLLEEQIKLDEPELIKKLSLSAATAKIICL
Ga0070700_10106603613300005441Corn, Switchgrass And Miscanthus RhizosphereMAMKIIFLDIETVPTDLSLQENGLLEPQIQLNETELIKKLSLSAA
Ga0070706_10190702123300005467Corn, Switchgrass And Miscanthus RhizosphereMKILFFDIETVPTEPSLQENGLLEEQIRLDEAEVLKKLSLSAATAKIICLCYAIEPSVSGTIE
Ga0070697_10052866513300005536Corn, Switchgrass And Miscanthus RhizosphereMKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAMEPAVHTAIEVLDGDEREII
Ga0070704_10018511523300005549Corn, Switchgrass And Miscanthus RhizosphereMKILFFDIETVPTEPSLQENGLLEEQIRLDEAEVLKKLSLSAATAKIICL
Ga0068855_10133664123300005563Corn RhizosphereMKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAMEPAVHTAIEVLDGDERE
Ga0068852_10284478013300005616Corn RhizosphereMKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKKLSLSATTAKIL
Ga0068860_10109546113300005843Switchgrass RhizosphereMAMKIIFLDIETVPTDLSLQENGLLEPQIQLNETELIKKLSLSAATAKILCLCYAIEPS
Ga0068862_10126465123300005844Switchgrass RhizosphereMKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTA
Ga0075285_102244423300005890Rice Paddy SoilMDIETVPTDRSLEENGLLEAQLQLDEGDLIKKLSLSAAT
Ga0075417_1005101923300006049Populus RhizosphereMPMKIIFLDIETVPTDLSLQENGLLEAQIQLNETELLKKLSLSAVT
Ga0070716_10095655923300006173Corn, Switchgrass And Miscanthus RhizosphereMKTIFLDIETVPTDPSLQENGLLEAQIQLNEAELLKKLSLSAVTAKIICI
Ga0068871_10175382123300006358Miscanthus RhizosphereMRIFFFDIETVPTERSLEECGLLDKEVTPENTELLKRLSLSAATAKILCLAYAVEPPGDAPVQILHGDEREIL
Ga0075428_10028562013300006844Populus RhizosphereMKILFFDIETVPTERSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYALEPPL
Ga0075428_10238710123300006844Populus RhizosphereMKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSL
Ga0075421_10075309923300006845Populus RhizosphereMKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLA
Ga0075431_10146265713300006847Populus RhizosphereMKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLLKKLSLSATTAKILCLCYATEPAAQP
Ga0075420_10140908323300006853Populus RhizosphereMKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAG
Ga0073934_1050415913300006865Hot Spring SedimentMKILFFDIETIPTEQFLRENGVLEAQMQLDEAEIIKRLSLSA
Ga0075434_10107118623300006871Populus RhizosphereMKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAAATSR
Ga0075426_1054150823300006903Populus RhizosphereMKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAMEPAVHTAIEVLDGDE
Ga0075424_10067834123300006904Populus RhizosphereMKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSL
Ga0075424_10068741723300006904Populus RhizosphereMKILFFDIETVPTDQSLQDNGLLESQIRLDEAEIIKKLSLAA
Ga0075419_1090307823300006969Populus RhizosphereMKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLLKKLSLSATTAKILCLCYATEPAAQPAI
Ga0079218_1128162513300007004Agricultural SoilMKIIFFDIETVPTDQALQASGLLESQMQLDEADLIKRLSLSAMTAKICCLGYAVEPPLDSTVEVLH
Ga0105095_1039610313300009053Freshwater SedimentMKIFYFDIETVPTDKALQENGLLDAQIKLDEPELIKKLSLSAVTAKIICL
Ga0099830_1000591833300009088Vadose Zone SoilMKILFLDIETVPTPEALAESGLLDSQIQLDEQEIIKRL
Ga0075418_1085076923300009100Populus RhizosphereMKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKL
Ga0066709_10288641123300009137Grasslands SoilMKILFFDIETVPTEQSLQHSGLLEAQMQLDEAEIIKRLSL
Ga0105094_1082424323300009153Freshwater SedimentMKIFYFDIETVPTDKALQENGLLDAQIKLDEAELIKKLSLSAATAKI
Ga0105092_1020840613300009157Freshwater SedimentMKVLFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAY
Ga0105092_1023399013300009157Freshwater SedimentMKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYAL
Ga0105092_1027656013300009157Freshwater SedimentMKILFFDIETVPTEQSLQDNGLLESQIKLDEAEIIKKLSLAAATSRILCLAYALEPPFD
Ga0105237_1183226323300009545Corn RhizosphereMKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAMEPAV
Ga0126374_1137620413300009792Tropical Forest SoilMRILFFDIETVPTEQSLQDNGLLETQLKLDEAEIVKKLSLSGATARILCL
Ga0105076_100369933300009816Groundwater SandMKILFFDIETVPTEQALQDNGLLESQIRLDEAEIIKKLSLAAATA
Ga0134063_1000650513300010335Grasslands SoilMKILFFDIETVPTEQSLQHSGLLEAQMQLDEAEIIKRLSLSAATARILCLAYALEPPADS
Ga0126379_1229421423300010366Tropical Forest SoilMKVIFLDIETVPTDQALLEHGLLEPQLQFNEAELIKKLSLSATTAKIVCLCY
Ga0134128_1182180823300010373Terrestrial SoilMKICFLDIETVPTERSLEENGLLEPQIHLDEAELIKKLSLSAATAKILCICYAI*
Ga0136847_1123066213300010391Freshwater SedimentMKIFYFDIETVPTEHALKENGLLDSQIKLDEPELI
Ga0134127_1094141413300010399Terrestrial SoilMKICFLDIETVPTDRSLEENGLLDAQIQLDEADLIKKLSLSA
Ga0134127_1230156923300010399Terrestrial SoilMKIFFFDIETVPTNKSLQENGLLEEQIKLDEPELIKKLSLSAATAKIICLCYA
Ga0137326_114250523300011417SoilMKIFYFDIETVPTDKALQENGLLDEQIKLDEAEII
Ga0137314_118750313300011420SoilMKIFFFDIETVPTDKALQENGLLDAQIKLDEAEIIKK
Ga0137436_113254423300011423SoilMKIFYFDIETVPTDKALQENGLLDEQIKLDEAEIIKKLSLSAATAKI
Ga0137448_120368923300011427SoilMKIFFFDIETVPTEQSLQDNGLLESQIKLDEAELLKKLSLSAATA
Ga0137451_115052513300011438SoilMKIFYFDIETVPTDKALQENGLLDEQIKLDEAEIIKKLSL
Ga0137433_125560313300011440SoilMKIFYFDIETVPTDKALQENGLLDEQIKLDEAEIIKKLSLSAATAKIICLC
Ga0137437_121973823300011442SoilMKIFFFDIETVPTDQSLQDNGLLESQIKLDEAELLKKLSLSAATARILCLAY
Ga0137457_134133413300011443SoilMKIFYFDIETVPTDKALQENGLLDAQIKLDEAEIIKKLSLSAVTAKII
Ga0137453_100435623300012034SoilMKIFFFDIETVPTDKSLQENGLLDSQIKLDEAELI
Ga0137349_101952723300012160SoilMKILFFDIETVPTQQSLHDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYALE
Ga0137350_107408223300012166SoilMKIFYFDIETVPTDKALQENGLLDEQIKLDEAEIIKKLSLSAATAKIICLCYAFEPSVSG
Ga0137334_107304013300012179SoilMKIFFFDIETVPTDESLRDNGLLDAQIKLDEAELLKKLSLSAATAKIICLGYAIDPPADS
Ga0137388_1031153913300012189Vadose Zone SoilMKILFFDIETVPTEQSLQDNGLLEAQMQLDEAAIIKKLSLAAATSRILCLAYALEP
Ga0137382_1051793723300012200Vadose Zone SoilMAMKIIFLDIETVPTDLSLQENGLLEPQIQLNETELIKKLSLSA
Ga0137381_1121767223300012207Vadose Zone SoilMAMKIIFLDIETVPTDLSLQENGLLEPQIQLNETELIKKLSLSAATAKILCLCYAIE
Ga0137376_1003842533300012208Vadose Zone SoilMKTIFLDIETVPTDQSLKENGLLDLQMQLDEAELIKKLSLS
Ga0137317_102704223300012672SoilMKIFFFDIETVPTEKSLQENGLLEEQIKLDEPELIKKLSLSAA
Ga0157301_1036659823300012911SoilMKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKKLSLSATTAK
Ga0157310_1023818513300012916SoilMKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKK
Ga0137407_1133555723300012930Vadose Zone SoilMKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYALE
Ga0137407_1141315413300012930Vadose Zone SoilMKILFFDIETVPTDQSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYALE
Ga0126375_1118227523300012948Tropical Forest SoilMKILFLDIETVPTEQSLQDNGLFEPQLKLDEAEIIKKLSLSGATARILCLAYALEPP
Ga0164308_1006122713300012985SoilMKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYA
Ga0075314_110489813300014265Natural And Restored WetlandsMKIFFFDIETVPTERALRDNGLLDSQIKLDEAEVIKKLSLSAATAKIFCIAYAIEPPPDSPVNV
Ga0075344_103907723300014296Natural And Restored WetlandsMKVLFFDIETVPTEQSLKDNGLREAQIKLDEAEIIKKLSLSAATSRILCLAYALEPPMDS
Ga0075349_114069523300014305Natural And Restored WetlandsMKIFYFDIETVPTEKALQENGLLEAQIKLDEAEIIKKLSLSAVTAKIICLCYTIEPSVSGTIEVL
Ga0075350_113124613300014315Natural And Restored WetlandsMKIFYFDIETVPTEKALQENGLLEAQIKLDEAEIIKKLSLSAVTAKIICLCYTIEPSVSG
Ga0180087_109977623300014872SoilMKILFFDIETVPTEQSLKDNGLLESQIKLDEADIIKKLSLAGATSRILCLAYALE
Ga0180066_108010723300014873SoilMKIFFFDIETVPTDKSLQDNGLLDSQIKLDEAELIKKLSLS
Ga0180064_105491923300014876SoilMKIFYFDIETVPTDKALQENGLLDEQIKLDEAEIIKKLSLSAATAKII
Ga0180063_121641613300014885SoilMKICFLDIETVPTDQSLQENGLLDSQIKIDEAELIKKLSLS
Ga0173480_1108733123300015200SoilMKIFFFDIETVPTDKSLQENGLLEEQIKLDEAELIKKLSLSAATAKII
Ga0137418_1042304023300015241Vadose Zone SoilMKTIFLDIETVPTDPSLQENGLLEAQIQLNEAELLKKLSLS
Ga0132256_10074537723300015372Arabidopsis RhizosphereMKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCY
Ga0132257_10043233713300015373Arabidopsis RhizosphereMKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAM
Ga0132255_10200702923300015374Arabidopsis RhizosphereMKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLI
Ga0132255_10257993913300015374Arabidopsis RhizosphereMKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAMEPAVH
Ga0184610_109736313300017997Groundwater SedimentMKTIFLDIETVPTDQSLKENGLLESQIQLDEAELIKKLSLS
Ga0184638_104385823300018052Groundwater SedimentMKILFFDIETVPTEQSLHDNGLLESQIKLDEAEIIKKLSLAAA
Ga0184626_1002288223300018053Groundwater SedimentMKIFFFDIETVPTDKSLQENGLLEEQIKLDEPELIKKLSLSAATAKIICLCYAID
Ga0184624_1036329013300018073Groundwater SedimentMKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYALEPPFDSPF
Ga0184609_1031846523300018076Groundwater SedimentMKIFFFDIETVPTDKSLQENGLLEEQIKLDEPELIKKLSLS
Ga0184633_1051364423300018077Groundwater SedimentMKIFFLDIETVPTDHALKENGLLEAQIKLDEPELIKKLSLSAATAKIICLCYAVEPSLTNSIEV
Ga0184612_1016247423300018078Groundwater SedimentMKIFFFDIETVPTNKSLQENGLLDAQIKLDEAELIKKLSLSAATAKIICLCYAIDPPGD
Ga0184627_1017179523300018079Groundwater SedimentMKTIFLDIETVPTDQSLKENGLLESQIQLDEAELIKKLSLSAATAKILCLCYAFDPPADS
Ga0190265_1048544413300018422SoilMKIFFFDIETIPTDQSVLDNNLLAAQIRLDEPEIIKKLSLSAATARI
Ga0190264_1035452613300019377SoilMKIFFFDIETVPTEQSLQENGLLDAQIQLNEEEIIKKLSLSAMTAKIICLCYAIEPSVSGTVE
Ga0193715_102477823300019878SoilMKTIFLDIETVPTDPSLQENGLLEAQIQLNEAELLKKLSLSAVTA
Ga0193747_106794513300019885SoilMKTIFLDIETVPTDPSLQENGLLEAQIQLNEAELLKKLSLSAVTAKIICIG
Ga0193731_116355923300020001SoilMKTIFLDIETVPTDPSLQENGLLEAQIQLNEAELLKKLSLSAVTAKIICIGYAVEPPVGCEVQAL
Ga0206227_111759823300021063Deep Subsurface SedimentMKIFFFDIETVPTDQSLQDNGLLDSQIKLDEAELLKKL
Ga0247745_106102013300022898SoilMKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKKLSLS
Ga0247794_1021919313300024055SoilMKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIK
Ga0209108_1018082913300025165SoilMKIFFFDIETVPTDQSLQDNGLLGSQIKLDEAELLKKLSLSAATARILCLGYAI
Ga0209431_1122084513300025313SoilMKIFFFDIETVPTDRSLQDNGLLESQIKLDEAELI
Ga0209641_1040651313300025322SoilVKIFFFDIETVPTEQSLQDNGLLDSQIKLDEAELLKKLSLSAATAKILCLGYAIDPPADSPV
Ga0209342_1073674613300025326SoilMKIFFFDIETAPTDQSLQDNGLLESQIKLDEAELLKKLSLSAATAKILCLGY
Ga0210138_105188213300025580Natural And Restored WetlandsMKILFFDIETVPTDQSLQDNGLLEAQMQLDEADIIKKLSLAAA
Ga0207680_1007853923300025903Switchgrass RhizosphereMKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAMEPAVHT
Ga0207693_1009594523300025915Corn, Switchgrass And Miscanthus RhizosphereMKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLI
Ga0207660_1018162623300025917Corn RhizosphereMKICFLDIETVPTDRSLEENGLLEPQIHLDEAELIKKLSLSAATAKILCICYAIEP
Ga0207662_1107448723300025918Switchgrass RhizosphereMKILFFDIETVPTEPSLQENGLLEEQIRLDEAEVRVD
Ga0207709_1040113013300025935Miscanthus RhizosphereMAMKIIFLDIETVPTDLSLQENGLLEPQIQLNETELIKKLSLSAAT
Ga0207704_1021764023300025938Miscanthus RhizosphereMKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAMEPAVHT
Ga0208778_100585623300026025Rice Paddy SoilMDIETVPTDRSLEENGLLEAQLQLDEGDLIKKLSLSAA
Ga0207675_10025650533300026118Switchgrass RhizosphereMAMKIIFLDIETVPTDLSLQENGLLEPQIQLNETELIK
Ga0209967_103193613300027364Arabidopsis Thaliana RhizosphereMKICFMDIETVPTDRSLEENGLFEAQLQLDEADVIKKLSLSAATAKILCLCYAIEPPV
Ga0209819_1000060913300027722Freshwater SedimentMKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAY
Ga0209819_1006370213300027722Freshwater SedimentMKILFFDIETVPTEQSLQDNGLLESQIKLDEAEIIKKLSLA
Ga0209689_125921913300027748SoilMKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAAA
Ga0209814_1011861923300027873Populus RhizosphereMKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYALEP
Ga0207428_1019512613300027907Populus RhizosphereMKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAMEPAVHTAIEVLDGDER
Ga0209382_1067992923300027909Populus RhizosphereMKIFFFDIETVPTEKSLQENGLLEEQIKLDEPELIKKLSL
Ga0268265_1221740423300028380Switchgrass RhizosphereMKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTAKIL
Ga0299906_1009588623300030606SoilMKILFFDIETIPTEDSLEHSGLLEAQLQLDEADIIKRLSLSAATARILCLAYALEPP
Ga0299906_1076135813300030606SoilMKICFLDIETVPTDRSLEENGLLESQIQLDEAELIKKLSLSAATAKILCLCYA
(restricted) Ga0255310_1007439923300031197Sandy SoilMKICFLDIETVPTDQSLQENGLLESQIKIDEAELI
Ga0307410_1010023713300031852RhizosphereMKIFYFDIETVPTDKSLQDNGLLEPQIKLDEAEIIKKLSLSAITAKI
Ga0310910_1057224923300031946SoilMKVIFLDIETVPTDQALLEHGLLEPQLQFNEGELIKKLSLSATTAKIVCLCYAIEPATQT
Ga0306926_1127080813300031954SoilMKILFLDIETVPTDQSLQDNGLLESQIRLDEAEIIKKLSLAAATSKILCL
Ga0307416_10294318623300032002RhizosphereMSSMKIFFFDIETIPTDQSVLDHNLLAAQMRLDEPEIIKKLSLSAATARILCLA
Ga0310906_1053083613300032013SoilMKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAMEPAVHTAI
Ga0315912_1082733223300032157SoilMKTCFMDIETVPTDRSLEENGLLESQIKLDEADLIKKLSLSAATAKILCLCYAIEPPMGS
Ga0307470_1013859213300032174Hardwood Forest SoilMAMKIIFLDIETVPTDLSLQENGLLEPQIQLNETELIKKLSLSAATAKILCLCYAIEPST
Ga0335070_1019359213300032829SoilMKIMFFDIETVPTEAALQEYGLLEAQIQLNEAEIIKKLSLSAATAKI
Ga0335084_1069699123300033004SoilMKILFLDIETVPTQQSLQENNLLEAQMQLDEAEIIKKLSLAAITSRIICLAYALEPPTDS
Ga0364924_170379_407_5173300033811SedimentMKILFFDIETVPTEQSLKDNGLLESQIKLDEADIIKK
Ga0364925_0333844_396_5693300034147SedimentMKILFFDIETVPTQQSLHDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYALEPPL
Ga0373958_0200079_2_1753300034819Rhizosphere SoilMKILFFDIETVPTDQSLQDNGLLESQIRLDQAEIIKKLSLAAATSRILCLAYALEPPL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.