NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F043025

Metagenome / Metatranscriptome Family F043025

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F043025
Family Type Metagenome / Metatranscriptome
Number of Sequences 157
Average Sequence Length 41 residues
Representative Sequence GDAATRKKIMARLNELLNRRSYIRNLVTNVQKELL
Number of Associated Samples 123
Number of Associated Scaffolds 157

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.29 %
% of genes near scaffold ends (potentially truncated) 97.45 %
% of genes from short scaffolds (< 2000 bps) 94.90 %
Associated GOLD sequencing projects 118
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.994 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(27.389 % of family members)
Environment Ontology (ENVO) Unclassified
(26.115 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.949 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.79%    β-sheet: 0.00%    Coil/Unstructured: 49.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 157 Family Scaffolds
PF00012HSP70 91.72
PF0563523S_rRNA_IVP 3.18
PF04384Fe-S_assembly 1.27
PF02885Glycos_trans_3N 0.64
PF07743HSCB_C 0.64
PF03703bPH_2 0.64
PF00111Fer2 0.64
PF08545ACP_syn_III 0.64

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 157 Family Scaffolds
COG0443Molecular chaperone DnaK (HSP70)Posttranslational modification, protein turnover, chaperones [O] 91.72
COG2975Fe-S-cluster formation regulator IscX/YfhJPosttranslational modification, protein turnover, chaperones [O] 1.27
COG1076DnaJ domain-containing proteinPosttranslational modification, protein turnover, chaperones [O] 0.64
COG3402Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domainFunction unknown [S] 0.64
COG3428Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domainFunction unknown [S] 0.64

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.99 %
UnclassifiedrootN/A7.01 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001082|JGI12664J13189_1006712All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis767Open in IMG/M
3300002917|JGI25616J43925_10253218All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis661Open in IMG/M
3300005175|Ga0066673_10119882All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1434Open in IMG/M
3300005179|Ga0066684_10076991All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1989Open in IMG/M
3300005332|Ga0066388_106426223All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300005440|Ga0070705_100817398All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae743Open in IMG/M
3300005454|Ga0066687_10681198All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae611Open in IMG/M
3300005552|Ga0066701_10977662All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter500Open in IMG/M
3300005561|Ga0066699_10150300All Organisms → cellular organisms → Bacteria → Acidobacteria1588Open in IMG/M
3300005568|Ga0066703_10821479All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300005591|Ga0070761_10914093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae555Open in IMG/M
3300005993|Ga0080027_10067449All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1312Open in IMG/M
3300006059|Ga0075017_101530277All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300006174|Ga0075014_100009886All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3293Open in IMG/M
3300006174|Ga0075014_100712197All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300006354|Ga0075021_10889681All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae578Open in IMG/M
3300006755|Ga0079222_11264496All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300006871|Ga0075434_102288780All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300006893|Ga0073928_10852476All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae627Open in IMG/M
3300007255|Ga0099791_10683842All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300009012|Ga0066710_104751429All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300009038|Ga0099829_10002280All Organisms → cellular organisms → Bacteria → Acidobacteria10983Open in IMG/M
3300009038|Ga0099829_10439294All Organisms → cellular organisms → Bacteria → Acidobacteria1081Open in IMG/M
3300009038|Ga0099829_11082585All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300009089|Ga0099828_10741745All Organisms → cellular organisms → Bacteria → Acidobacteria881Open in IMG/M
3300009089|Ga0099828_11759213All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300009090|Ga0099827_11162204All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300009162|Ga0075423_10911820Not Available932Open in IMG/M
3300009522|Ga0116218_1102485All Organisms → cellular organisms → Bacteria → Proteobacteria1303Open in IMG/M
3300009624|Ga0116105_1046057All Organisms → cellular organisms → Bacteria → Acidobacteria990Open in IMG/M
3300009764|Ga0116134_1257182All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300010159|Ga0099796_10203338All Organisms → cellular organisms → Bacteria → Acidobacteria804Open in IMG/M
3300010337|Ga0134062_10462119All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300010359|Ga0126376_11753061All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300010376|Ga0126381_100870589All Organisms → cellular organisms → Bacteria → Acidobacteria1296Open in IMG/M
3300011120|Ga0150983_16674682All Organisms → cellular organisms → Bacteria → Acidobacteria706Open in IMG/M
3300011271|Ga0137393_10327813All Organisms → cellular organisms → Bacteria → Acidobacteria1306Open in IMG/M
3300012169|Ga0153990_1097955All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300012200|Ga0137382_10177530All Organisms → cellular organisms → Bacteria → Acidobacteria1456Open in IMG/M
3300012200|Ga0137382_11059757All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300012201|Ga0137365_10469891All Organisms → cellular organisms → Bacteria → Acidobacteria925Open in IMG/M
3300012201|Ga0137365_10838285All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300012205|Ga0137362_10458300All Organisms → cellular organisms → Bacteria → Acidobacteria1104Open in IMG/M
3300012209|Ga0137379_11032903All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300012359|Ga0137385_11241505All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300012362|Ga0137361_10907257All Organisms → cellular organisms → Bacteria → Acidobacteria799Open in IMG/M
3300012362|Ga0137361_11024353All Organisms → cellular organisms → Bacteria → Acidobacteria745Open in IMG/M
3300012362|Ga0137361_11591189All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300012363|Ga0137390_10650610All Organisms → cellular organisms → Bacteria → Acidobacteria1019Open in IMG/M
3300012582|Ga0137358_10210414All Organisms → cellular organisms → Bacteria → Acidobacteria1327Open in IMG/M
3300012582|Ga0137358_10938048All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300012685|Ga0137397_10248758All Organisms → cellular organisms → Bacteria1325Open in IMG/M
3300012685|Ga0137397_10498004All Organisms → cellular organisms → Bacteria → Acidobacteria908Open in IMG/M
3300012917|Ga0137395_11186708All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300012918|Ga0137396_10209407All Organisms → cellular organisms → Bacteria → Acidobacteria1434Open in IMG/M
3300012918|Ga0137396_10242713All Organisms → cellular organisms → Bacteria → Acidobacteria1328Open in IMG/M
3300012918|Ga0137396_10538431All Organisms → cellular organisms → Bacteria → Acidobacteria865Open in IMG/M
3300012927|Ga0137416_11171113All Organisms → cellular organisms → Bacteria → Acidobacteria691Open in IMG/M
3300012927|Ga0137416_11751394All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300012929|Ga0137404_10691795All Organisms → cellular organisms → Bacteria → Acidobacteria922Open in IMG/M
3300012944|Ga0137410_10272808All Organisms → cellular organisms → Bacteria → Acidobacteria1332Open in IMG/M
3300012944|Ga0137410_11944321All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis522Open in IMG/M
3300012960|Ga0164301_11003255All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300012977|Ga0134087_10570958All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300012984|Ga0164309_10547462All Organisms → cellular organisms → Bacteria → Acidobacteria895Open in IMG/M
3300012988|Ga0164306_11479246All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300013832|Ga0120132_1093061All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300014152|Ga0181533_1180525All Organisms → cellular organisms → Bacteria → Acidobacteria832Open in IMG/M
3300014157|Ga0134078_10270323All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300014165|Ga0181523_10357562All Organisms → cellular organisms → Bacteria → Acidobacteria818Open in IMG/M
3300015052|Ga0137411_1179286All Organisms → cellular organisms → Bacteria → Acidobacteria891Open in IMG/M
3300016422|Ga0182039_11899040All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300018030|Ga0187869_10020824All Organisms → cellular organisms → Bacteria3747Open in IMG/M
3300018088|Ga0187771_10929844Not Available738Open in IMG/M
3300020170|Ga0179594_10376724All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300020579|Ga0210407_10023389All Organisms → cellular organisms → Bacteria4593Open in IMG/M
3300020579|Ga0210407_10756190Not Available751Open in IMG/M
3300020583|Ga0210401_10523772All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300020583|Ga0210401_10573708All Organisms → cellular organisms → Bacteria → Acidobacteria990Open in IMG/M
3300020583|Ga0210401_11185396All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300021086|Ga0179596_10455862All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300021086|Ga0179596_10643339All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300021088|Ga0210404_10131992All Organisms → cellular organisms → Bacteria → Acidobacteria1293Open in IMG/M
3300021170|Ga0210400_10656968All Organisms → cellular organisms → Bacteria → Acidobacteria863Open in IMG/M
3300021170|Ga0210400_11158743All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300021178|Ga0210408_10817124All Organisms → cellular organisms → Bacteria → Acidobacteria729Open in IMG/M
3300021178|Ga0210408_11165668All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300021180|Ga0210396_11141326All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300021401|Ga0210393_10605444Not Available895Open in IMG/M
3300021405|Ga0210387_10912505All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300021406|Ga0210386_10324055All Organisms → cellular organisms → Bacteria → Acidobacteria1323Open in IMG/M
3300021420|Ga0210394_11243514All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300021420|Ga0210394_11374125All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300021478|Ga0210402_10361303All Organisms → cellular organisms → Bacteria → Acidobacteria1348Open in IMG/M
3300021478|Ga0210402_10728239All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300022724|Ga0242665_10192782All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300022726|Ga0242654_10129373All Organisms → cellular organisms → Bacteria → Acidobacteria824Open in IMG/M
3300024288|Ga0179589_10013501All Organisms → cellular organisms → Bacteria2516Open in IMG/M
3300024288|Ga0179589_10383082All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300025325|Ga0209341_10359345All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter insuavis → Achromobacter insuavis AXX-A1188Open in IMG/M
3300025612|Ga0208691_1158247All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300026294|Ga0209839_10247320All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300026296|Ga0209235_1063568All Organisms → cellular organisms → Bacteria → Acidobacteria1713Open in IMG/M
3300026310|Ga0209239_1157923All Organisms → cellular organisms → Bacteria → Acidobacteria889Open in IMG/M
3300026317|Ga0209154_1104464All Organisms → cellular organisms → Bacteria → Acidobacteria1206Open in IMG/M
3300026330|Ga0209473_1046300All Organisms → cellular organisms → Bacteria → Acidobacteria1912Open in IMG/M
3300026334|Ga0209377_1130104All Organisms → cellular organisms → Bacteria → Acidobacteria994Open in IMG/M
3300026356|Ga0257150_1023919All Organisms → cellular organisms → Bacteria → Acidobacteria864Open in IMG/M
3300026542|Ga0209805_1199305All Organisms → cellular organisms → Bacteria → Acidobacteria863Open in IMG/M
3300026548|Ga0209161_10427690All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300026555|Ga0179593_1085257All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1744Open in IMG/M
3300026990|Ga0207824_1028965All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300027000|Ga0207803_1023852All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300027565|Ga0209219_1080640All Organisms → cellular organisms → Bacteria → Acidobacteria807Open in IMG/M
3300027591|Ga0209733_1077231All Organisms → cellular organisms → Bacteria → Acidobacteria858Open in IMG/M
3300027671|Ga0209588_1087790All Organisms → cellular organisms → Bacteria → Acidobacteria1003Open in IMG/M
3300027671|Ga0209588_1121217All Organisms → cellular organisms → Bacteria → Acidobacteria837Open in IMG/M
3300027671|Ga0209588_1184299All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300027768|Ga0209772_10149146All Organisms → cellular organisms → Bacteria → Acidobacteria733Open in IMG/M
3300027842|Ga0209580_10563159All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300027884|Ga0209275_10117388All Organisms → cellular organisms → Bacteria → Acidobacteria1380Open in IMG/M
3300028759|Ga0302224_10166324All Organisms → cellular organisms → Bacteria → Acidobacteria867Open in IMG/M
3300029636|Ga0222749_10712980All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300029910|Ga0311369_11401253All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300030707|Ga0310038_10266180All Organisms → cellular organisms → Bacteria → Acidobacteria786Open in IMG/M
3300031057|Ga0170834_109046604All Organisms → cellular organisms → Bacteria → Acidobacteria718Open in IMG/M
3300031057|Ga0170834_113767648All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300031128|Ga0170823_13288342All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300031231|Ga0170824_105548710All Organisms → cellular organisms → Bacteria → Acidobacteria1289Open in IMG/M
3300031240|Ga0265320_10184951Not Available933Open in IMG/M
3300031474|Ga0170818_115096637All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300031682|Ga0318560_10736395All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300031718|Ga0307474_11134398All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300031718|Ga0307474_11605033All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis511Open in IMG/M
3300031720|Ga0307469_11927853All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300031753|Ga0307477_11074311All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300031754|Ga0307475_10001623All Organisms → cellular organisms → Bacteria → Acidobacteria13398Open in IMG/M
3300031823|Ga0307478_10341409All Organisms → cellular organisms → Bacteria → Acidobacteria1233Open in IMG/M
3300031890|Ga0306925_10709148All Organisms → cellular organisms → Bacteria → Acidobacteria1052Open in IMG/M
3300031941|Ga0310912_10704069Not Available783Open in IMG/M
3300031941|Ga0310912_11275966All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300031962|Ga0307479_10818942All Organisms → cellular organisms → Bacteria → Acidobacteria906Open in IMG/M
3300031962|Ga0307479_10966540All Organisms → cellular organisms → Bacteria → Acidobacteria822Open in IMG/M
3300031962|Ga0307479_11003328All Organisms → cellular organisms → Bacteria → Acidobacteria804Open in IMG/M
3300031962|Ga0307479_11054308All Organisms → cellular organisms → Bacteria → Acidobacteria780Open in IMG/M
3300031962|Ga0307479_11204075All Organisms → cellular organisms → Bacteria → Acidobacteria721Open in IMG/M
3300032089|Ga0318525_10357043Not Available750Open in IMG/M
3300032180|Ga0307471_100513136All Organisms → cellular organisms → Bacteria → Acidobacteria1348Open in IMG/M
3300032180|Ga0307471_102022290All Organisms → cellular organisms → Bacteria → Acidobacteria723Open in IMG/M
3300032261|Ga0306920_102510607Not Available709Open in IMG/M
3300032893|Ga0335069_11799940All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300032954|Ga0335083_10834228Not Available737Open in IMG/M
3300033289|Ga0310914_10461123All Organisms → cellular organisms → Bacteria → Acidobacteria1150Open in IMG/M
3300034091|Ga0326724_0647450All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300034125|Ga0370484_0106933All Organisms → cellular organisms → Bacteria → Acidobacteria732Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil27.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.83%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil8.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.37%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.18%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.55%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.55%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.91%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.27%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.27%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.27%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.27%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.27%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.27%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.27%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.64%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.64%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.64%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.64%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.64%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.64%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.64%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.64%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.64%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.64%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.64%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.64%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.64%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.64%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.64%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001082Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3EnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012169Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaGHost-AssociatedOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013832Permafrost microbial communities from Nunavut, Canada - A3_5cm_0MEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026356Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-AEnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300026990Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 73 (SPAdes)EnvironmentalOpen in IMG/M
3300027000Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031240Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaGHost-AssociatedOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12664J13189_100671213300001082Forest SoilDAAIDADAADSDRDAIKVRLNELLNRRSYIRNLVNGVAKELA*
JGI25616J43925_1025321813300002917Grasslands SoilWDAALQGEAATRKQVMAKLNDLLNRRSYIRNLVVNVQKELL*
Ga0066673_1011988213300005175SoilAARKWDTALQGNAAMRKKIMAKLNDLLNRRSYIRNLVTNVQKELV*
Ga0066684_1007699113300005179SoilQLQAASREWDAALEADSITRKKVMAKLNDLLNRRSYIRNLLASVQKELV*
Ga0066388_10642622313300005332Tropical Forest SoilSGGDDATRKKIMARLNEHLNRRSYVRNLVMNVARELEEA*
Ga0070705_10081739823300005440Corn, Switchgrass And Miscanthus RhizosphereSAAHDWDAALTGDSATRKKIMARLNELLNRRNYIRNLVTNVQKELSVTSL*
Ga0066687_1068119813300005454SoilVTAREWDATLQGDPATRKKIMAQLNELLNRRSYIRNLVTNVQKELL*
Ga0066701_1097766223300005552SoilGADDAARKKLMTRMNELLNRRSYIRNLAANVQKELAEA*
Ga0066699_1015030013300005561SoilDAALSGDAATRKKIMAQLNGLLNRRSYIRNLVTNVQKELL*
Ga0066703_1082147913300005568SoilEADSITRKKVMAKLNDLLNRRSYIRNLLASVQKELV*
Ga0070761_1091409323300005591SoilDAAVDANGDEAARKKIMARLNERLNRRSYIRNLVMSVAKELGEA*
Ga0080027_1006744913300005993Prmafrost SoilAALDADASDPDREAILQRLNELLNRRSYIRNLVAGVENELTGAAS*
Ga0075017_10153027713300006059WatershedsADSATRKIVMAKLNELLNRRSYIRNLVINVQKELL*
Ga0075014_10000988613300006174WatershedsALRADAATRKVIMAKLNELLNRRSYIRNLVTNVQKELL*
Ga0075014_10071219713300006174WatershedsLQADSATRKIVMAKLNELLNRRSYIRNLVINVQKELL*
Ga0075021_1088968113300006354WatershedsLQAAAREWDAALQGDGATRKPIKERLNELLNRRSYIRNLVTNVQKELS*
Ga0079222_1126449613300006755Agricultural SoilWDAALEADSATRKKVMAKLNDLLNRRSYIRNLLASVQKELV*
Ga0075434_10228878023300006871Populus RhizosphereAAVDATADTAVRKGIFARMNELLNRRSYIRNLVTGVEKELAA*
Ga0073928_1085247613300006893Iron-Sulfur Acid SpringQTAQAWDVASESDTAKRKEVMTRLNELLNRRSYIRNLVTNVQKELQ*
Ga0099791_1068384223300007255Vadose Zone SoilDAASRKESMAQLNELLNRRSYIRNLVTNVQKELL*
Ga0066710_10475142923300009012Grasslands SoilQSDAATRKKIMTRLNELLNRRSYIRNLVTNVQKELL
Ga0099829_10002280123300009038Vadose Zone SoilETGRKQIFARMNELLNRRSYIRNLVANVAKELEA*
Ga0099829_1043929413300009038Vadose Zone SoilLQADAATRKKIMAQLNELLNRRSYIRNLVTNVQKELL*
Ga0099829_1108258523300009038Vadose Zone SoilEWDAAPDGDAAARKQIMGRLNDLLNRRSYIRNLVTNVQKELATA*
Ga0099828_1074174513300009089Vadose Zone SoilWDAALQGEAATRKQIMAKLNDLLNRRSYIRNLVTNVQKELL*
Ga0099828_1175921313300009089Vadose Zone SoilSSSDTDRKAIMVRLNELLNRRSYIRNLVTNVQKELL*
Ga0099827_1116220423300009090Vadose Zone SoilAAREWDAALQGDAATRKKIMARLNDLLNRRSYIRNLVTNVQKELV*
Ga0075423_1091182023300009162Populus RhizosphereFEANGTSEARKMLMARMNELLNRRSYIRNLVANVAKELAEA*
Ga0116218_110248513300009522Peatlands SoilAGVPDRGKLMAQLNELLNRRSYIRNLVVNVQKELL*
Ga0116105_104605713300009624PeatlandAIEANAGDSDRAAIKVRLNELLNRRSYIRNLVNNVAKELTES*
Ga0116134_125718213300009764PeatlandQVIDSAADETARRKAMSKLNELLNRRSYIRNLVVNVQKELL*
Ga0099796_1020333813300010159Vadose Zone SoilDANASDTDRKGIMVRLNELLNRRSYIRNLVTNVQKELQ*
Ga0134062_1046211923300010337Grasslands SoilLQGNAAMRKKIMAKLNDLLNRRSYIRNLVTNVQKELV*
Ga0126376_1175306113300010359Tropical Forest SoilNGDAASRKALMARMNDLLNRRSYIRNLVNGVAKELGEI*
Ga0126381_10087058923300010376Tropical Forest SoilAALEGDRATRKKIMGRLNELLNRRSYIRNLVTNVAKELAEV*
Ga0150983_1667468213300011120Forest SoilQRIAQEWDAAIDANAAAPARKTLMAQMNECLNRRSYIRNLVAGVAKELGEI*
Ga0137393_1032781313300011271Vadose Zone SoilAHEWDAALTGDSATRNKIMARLNELLNRRSYIRNLVTNVQKELL*
Ga0153990_109795513300012169Attine Ant Fungus GardensIDANVGDNDRKAIMVRLNELLNRRSYIRNLVTNVQKELV*
Ga0137382_1017753013300012200Vadose Zone SoilNAAMRKKIIAKLNDLLNRRSYIRNLVTNVQKELV*
Ga0137382_1105975723300012200Vadose Zone SoilDSAVDANAGVAARKKLFAGMNELLNRRSYIRNLVTNVAKELAEV*
Ga0137365_1046989113300012201Vadose Zone SoilALQGEATKRKKIMTQLNDLLNRRSYIRNLVTNVQKELL*
Ga0137365_1083828513300012201Vadose Zone SoilALQGEATKRKKIMTQLNDLLNRRSYIRNLVTSVQKELL*
Ga0137362_1045830023300012205Vadose Zone SoilVDTSADDSTRKKIMARLNEHLNRRSYIRNLVVSVAKELAEA*
Ga0137379_1103290313300012209Vadose Zone SoilTARKRIMSRMNELLNRRSYIRNLVANVQKELTAP*
Ga0137385_1124150513300012359Vadose Zone SoilQAAAREWDTALQGNAAMRKKIIAKLNDLLNRRSYIRNLVTNVQKELV*
Ga0137361_1090725713300012362Vadose Zone SoilDAALAGDSATRKKIMARLNELLNRRSYVRNLVTNVKKELV*
Ga0137361_1102435323300012362Vadose Zone SoilEWDAALQGEAATRKKVMAKLNDLLNRRSYIRNLVTNVQKELL*
Ga0137361_1159118923300012362Vadose Zone SoilTADSAARKKIMARLNELLNRRSYIRNLVTNVQKELL*
Ga0137390_1065061013300012363Vadose Zone SoilDAALQADAATRKKVMAKLNDLLNRRSYIRNLVTNVQKELL*
Ga0137358_1021041423300012582Vadose Zone SoilAAREWDAALQADTATRKKIMARLNELLNRRSYIRNLVTTVQKELL*
Ga0137358_1093804813300012582Vadose Zone SoilANKAGRKSVMAKLNELLNRRSYIRNLVVNVQKELL*
Ga0137397_1024875823300012685Vadose Zone SoilDAATRKKIMARLNELLNRRSYIRNLVTNVQKELL*
Ga0137397_1049800423300012685Vadose Zone SoilLQTAAREWDAALQGEAATRKQVMAKLNDLLNRRSYIRNLVVNVQKELL*
Ga0137395_1118670813300012917Vadose Zone SoilDSAARKKLFARMNELLNRRSYIRNLVANVQKELQE*
Ga0137396_1020940713300012918Vadose Zone SoilLQTAAREWDASLQSDAATRRKIIVRLNDLLNRRSYIRNLVINVQKELL*
Ga0137396_1024271323300012918Vadose Zone SoilDAATRKKIMARLNELLNRRSYIRNLVTSVQKELL*
Ga0137396_1053843123300012918Vadose Zone SoilDAALQGEAATRKQVMAKLNDLLNRRSYIRNLVVNVQKELL*
Ga0137416_1117111313300012927Vadose Zone SoilLQGEAATRKQVMAKLNDLLNRRSYIRNLVVNVQKELL*
Ga0137416_1175139413300012927Vadose Zone SoilDAVDANADETARKQIFARMNELLNRRSYIRNLVANVRKELEA*
Ga0137404_1069179523300012929Vadose Zone SoilVDANADEAKRKSVMTKLNELLNRRSYIRNLVVNVQKELT*
Ga0137410_1027280813300012944Vadose Zone SoilGDAATRKKIMARLNELLNRRSYIRNLVTNVQKELL*
Ga0137410_1194432113300012944Vadose Zone SoilQQWDAAIDANASDTDRKGILVGLNELLNRRSYIRNLVTNVEKELQ*
Ga0164301_1100325523300012960SoilTADDAARKKIMARLNELLNRRNYIRNLVTNVQKELSVTSL*
Ga0134087_1057095813300012977Grasslands SoilREWDAALSGDAATRKKIMAQLNGLLNRRSYIRNLVTNVQKELL*
Ga0164309_1054746223300012984SoilDTAVDSNAGAEARMEIFARINELLNRRSYIRNLVANVAKELEA*
Ga0164306_1147924613300012988SoilDDAARKKIMARLNELLNRRSYIRNLVVNVAKELGEA*
Ga0120132_109306123300013832PermafrostLDANASDSDREAVLQRLNELLNRRSYIRNLVAGVEKELAGAAS*
Ga0181533_118052523300014152BogDSAADDAARRQAMSKLNELLNRRSYIKNLVVNVQKELL*
Ga0134078_1027032313300014157Grasslands SoilGDAATRKKIMTQLNGLLNRRSYIRNLVTNVQKELL*
Ga0181523_1035756223300014165BogIDESADPTRRKALMSKLNELLNRRSYIRNLVVNVQKELL*
Ga0137411_117928613300015052Vadose Zone SoilSALTADSAARKKIMARLNELLNRRSYIRNLVTNVQKELL*
Ga0182039_1189904023300016422SoilIQDNAGKTQRDAVKSKLNDLLNRRSYIRNLVVNVQKELV
Ga0187869_1002082463300018030PeatlandGAIDAGAGEPDRGKIMAQLNELLNRRSYIRNLVVNVQKELL
Ga0187771_1092984413300018088Tropical PeatlandEWDKLIDEKADESQRNAAKVKLNELLNRRSYIRNLVVNVQKELL
Ga0179594_1037672423300020170Vadose Zone SoilAVEANADAAARKKLFARMNDLLNRRSYIRNLVASVEKELAA
Ga0210407_1002338973300020579SoilAMDANAGDADRKGIMARLNELLNRRSYIRNLVTNVQKELL
Ga0210407_1075619023300020579SoilTARQWDAAIDADASDTDRKGIMARLNELLNRRSYIRNLVTDVQKEVL
Ga0210401_1052377213300020583SoilESADPSQREAAKGKLNELLNRRSYIRNLVINVQKELAGT
Ga0210401_1057370823300020583SoilDATSDQAAHKRIMGRLNELLNRRSYIRNLVVNVAKELGEA
Ga0210401_1118539613300020583SoilARADEATRKGVMAKLNELLNRRSYIRNLVVNVQKELL
Ga0179596_1045586223300021086Vadose Zone SoilAAVSGDAATRKKIMAQLNGLLNRRSYIRNLVTNVQKELL
Ga0179596_1064333913300021086Vadose Zone SoilAALEANAGDNDRAAIKVRLNELLNRRSYIRNLVNNVQKELE
Ga0210404_1013199223300021088SoilAARQWDAALDGDAATRTKIMAQLNELLNRRSYIRNLVTNVQKELL
Ga0210400_1065696823300021170SoilAAVDANADDSARKKIMAHLNELLNRRSYIRNLVVNVAKELGEV
Ga0210400_1115874323300021170SoilNADEAARKKIMTRLNELLNRRSYIRNLVVNVQKELTT
Ga0210408_1081712413300021178SoilNADDAARKKIMARLNELLNRRSYIRNLVVNVAKELGEV
Ga0210408_1116566823300021178SoilAREWDNALDGGAVTLGEIMAKLNELLNRRSYIRNLVTNVQKELL
Ga0210396_1114132613300021180SoilAQMKTAAQQWDADLDANASESDREAILQRLNELLNRRSYIRNLVAGVEKELQGAAC
Ga0210393_1060544423300021401SoilQTDEASRNTAMGKLNELLNRRSYVRNLVVNVQKELL
Ga0210387_1091250513300021405SoilDAGVDASADEAARKKIMTRLNELLNRRSYIRNLVVNVQKELTT
Ga0210386_1032405513300021406SoilGADDAVRKKIMARLNELLNRRSYIRNLVVNVAKELGEA
Ga0210394_1124351413300021420SoilALEAEAGDNDRRAIMVRLNELLNRRSYIRNLVKNVQMELQ
Ga0210394_1137412523300021420SoilDKTVDGNADGTARKSTMAKLNELLNRRSYIRNLVANVQKELV
Ga0210402_1036130313300021478SoilEWDVVLDGDVGARKKIMARLNELLNRRSYIRNLVTNVQKELL
Ga0210402_1072823923300021478SoilADANADEAARKKIMTRLNELLNRRSYIRNLVVNVQKELTT
Ga0210402_1181812313300021478SoilTARDWDAGVDANADDPARKKLMTRMNELLNRRSYIRNLVVNVQKELS
Ga0242665_1019278213300022724SoilELQSAAREWDAALDGDTAMRNTIKARLNEMLNRRSYVRNLVTNVQKELL
Ga0242654_1012937313300022726SoilAIDANAAAPARKTLMAQMNECLNRRSYIRNLVAGVAKELGEI
Ga0179589_1001350113300024288Vadose Zone SoilDETGRKQIFVRMNELLNRRSYIRNLVANVAKELEA
Ga0179589_1038308223300024288Vadose Zone SoilQETPQQWDAAIDANASDTDRKGILVRLNELLNRRSYIRNLVTNVQKELQ
Ga0209341_1035934523300025325SoilKLFAEWDRAVEAGASGPAQQQLMERMNEALNRRSYIRNLVESVEKELAED
Ga0208691_115824713300025612PeatlandNAGDSDRAAIKVRLNELLNRRSYIRNLVNNVAKELTES
Ga0209839_1024732023300026294SoilEMKIAAQQWDAALDANAGDADREAILQRLNELLNRRSYIRNLVAGVEKELTGAAG
Ga0209235_106356823300026296Grasslands SoilLDSGGDDTARKRIMARMNELLNRRSYIRNLVANVQKEL
Ga0209239_115792323300026310Grasslands SoilARKWDTALQGNAAMRKKIMAKLNDLLNRRSYIRNLVTNVQKELV
Ga0209154_110446423300026317SoilTALQGNAAMRKKIIAKLNDLLNRRSYIRNLVTNVQKELV
Ga0209473_104630013300026330SoilQLQAASREWDAALEADSITRKKVMAKLNDLLNRRSYIRNLLASVQKELV
Ga0209377_113010423300026334SoilAALEGDAATRKKIMARLNDLLNRRSYIRNLVTNVQKELL
Ga0257150_102391923300026356SoilQGEAATRKQVMAKLNDLLNRRSYIRNLVVNVQKELL
Ga0209805_119930513300026542SoilDAALSGDAATRKKIMAQLNGLLNRRSYIRNLVTNVQKELL
Ga0209161_1042769013300026548SoilAREWDGALSADAATRTKIMAQLNGLLNRRSYIRNLVTNVQKELL
Ga0179593_108525763300026555Vadose Zone SoilLQGEAATRKKIMAKLNDLLNRRSYIRNLVTNVQKELL
Ga0207824_102896523300026990Tropical Forest SoilLDAKTDPSVRQQVMNQLNDLLNRRSYIRNLVVNVQKELS
Ga0207803_102385223300027000Tropical Forest SoilAIDGNADESARKQVMTKLNELLNRRSYVRNLVVNVQKELL
Ga0209219_108064023300027565Forest SoilWDAALDANASESDREAILQRLNELLNRRSYIRNLVLGVEKELQGASC
Ga0209733_107723113300027591Forest SoilQQWDAALDANASESDREAILQRLNELLNRRSYIRNLVAGVEKELQGAAC
Ga0209588_108779013300027671Vadose Zone SoilDANASDSDRKAIMVRLNELLNRRSYIRNLVNNVQKELM
Ga0209588_112121723300027671Vadose Zone SoilALTADSAARKKIMARLNELLNRRSYIRNLVTNVQKELL
Ga0209588_118429913300027671Vadose Zone SoilLDGDAVTRKKIMAKLNDLLNRRSYIRNLVTNVQKELL
Ga0209772_1014914623300027768Bog Forest SoilNADERVRKKLMARMNELLNRRSYIRNLVVNVQKELS
Ga0209580_1056315913300027842Surface SoilDAAIDAKSGDDLKAILVRLNELLNRRSYIRNLVTNVEKELV
Ga0209275_1011738823300027884SoilAALEAEAGDNDRRAIMVRLNELLNRRSYIRNLVKNVQMELQ
Ga0302224_1016632423300028759PalsaLQIAAEQWDAAVDADASVSDRDAIMIRLNELLNRRSYIRNLVNSVRQELL
Ga0222749_1071298023300029636SoilAGDNDRRAIMVRLNELLNRRSYIRNLVKNVQMELQ
Ga0311369_1140125323300029910PalsaASKDARAALMAQMNEILNRRSYIRNLVANVEQELAKTS
Ga0310038_1026618013300030707Peatlands SoilDSATDDAARRRAMSKLNELLNRRSYIRNLVVNVQKELL
Ga0170834_10904660413300031057Forest SoilNSDDAARKKIFARMNELLNRRSYIRNLVANVAKELEA
Ga0170834_11376764823300031057Forest SoilADAAARKALMARMNECLNRRSYIRNLVTGVAKELGEI
Ga0170823_1328834213300031128Forest SoilAVDANADEAKRKIVMAKLNELLNRRSYIRNLVVNVQKELL
Ga0170824_10554871023300031231Forest SoilVDANAESGGRKELFARMNELLNRRSYIRNLVTNVAKELAEV
Ga0265320_1018495113300031240RhizosphereTVDANADDAARKKIMSRMNELLNRRAYVRNLVVNVQKELS
Ga0170818_11509663723300031474Forest SoilAVDANADETGRKPIFARMNELLNRRSYIRNLVANVAKELEA
Ga0318560_1073639513300031682SoilIDGNADESARKQVMTRLNELLNRRSYVRNLVVNVQKELL
Ga0307476_1003136563300031715Hardwood Forest SoilLAEVDAQLQTTAREWDAAVDANADDAARKKLMSRMNDLLNRRAYVRNLVVNVQKELS
Ga0307474_1113439823300031718Hardwood Forest SoilDANADDAARKKLMSRMNDLLNRRAYVRNLVVNVQKELS
Ga0307474_1160503313300031718Hardwood Forest SoilTAREWDAALDGDAVTRNKIKARLNELLNRRSYIRNLVTNVQKELL
Ga0307469_1192785323300031720Hardwood Forest SoilWDTAIDANASANDRKGIMVRLNELLNRRSYIRNLVTNVAKELL
Ga0307477_1107431113300031753Hardwood Forest SoilVALEADAATQKKIMAKLNDLLNRRSYVRNLVANVQKELL
Ga0307475_1000162313300031754Hardwood Forest SoilDADAGDANRKAIMVRLNELLNRRSYIRNLVTNVQKELL
Ga0307478_1034140913300031823Hardwood Forest SoilAALQADSATRKKIMAKLNDLLNRRSYIRNLVTNVQKELS
Ga0306925_1070914823300031890SoilIDANGAGEARKKLMARMNELLNRRSYLRNLVANVQKELAVS
Ga0310912_1070406913300031941SoilNGTGEARKKLMARMNELLNRRSYIRNLVTNVQKELAAS
Ga0310912_1127596613300031941SoilADESARKQVMNRLNELLNRRSYVRNLVVSVQKELL
Ga0307479_1081894223300031962Hardwood Forest SoilNAAGEAHKKLMARMNELLNRRSYIRNLVANVAKELAEV
Ga0307479_1096654023300031962Hardwood Forest SoilQLQAAAREWDNALDGDAVKREKIMAKLNELLNRRSYIRNLVTNVQKELL
Ga0307479_1100332813300031962Hardwood Forest SoilADSATRKKIMAKLNDLLNRRSYIRNLVTNVEKELL
Ga0307479_1105430813300031962Hardwood Forest SoilLQAAAREWDVALEADAATQKKIMAKLNDLLNRRSYVRNLVANVQKELL
Ga0307479_1120407513300031962Hardwood Forest SoilALAGDAATRKKIMAQLNELLNRRSYIRNLVTNVQKELL
Ga0318525_1035704313300032089SoilGEARKKLMARMNQLLNRRSYIRNLVTNVQKELAAS
Ga0307471_10051313623300032180Hardwood Forest SoilNAGDVDRKAIMVRLNELLNRRSYIRNLVTNVQKELQ
Ga0307471_10202229023300032180Hardwood Forest SoilALIGDAATRKKIMARLNELLNRRSYIRNLVTNVQKELV
Ga0306920_10251060713300032261SoilAIDVHADDAGKKGVMARLNELLNRRSYIRNLVVNVQKELA
Ga0335069_1179994023300032893SoilQAAARDWDQAIDQNSDKVRRDAIKTRLNDLLNRRSYIRNLVVNVQKELL
Ga0335083_1083422813300032954SoilDSGAESADAERKKLMGRMNEALNRRSYVRNLVDSVERELAEV
Ga0310914_1046112313300033289SoilAKADAAARKGVMARLNELLNRRSYIRNLVVNVQKELA
Ga0326724_0647450_388_5193300034091Peat SoilEAIDAGADMPDRGKIMAQLNELLNRRSYIRNLVVNVQKELLGS
Ga0370484_0106933_592_7323300034125Untreated Peat SoilDAARDANASESDREAILQRLNELLNRRSYIRNLVAGVEKELEGASS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.