Metagenome / Metatranscriptome Family F042870

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F042870
Family Type	Metagenome / Metatranscriptome
Number of Sequences	157
Average Sequence Length	41 residues
Representative Sequence	MSENLPDSKIPWWDNEYEGVYSDDPEDGYPYDMGTKVQE
Number of Associated Samples	107
Number of Associated Scaffolds	157

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	68.79 %
% of genes near scaffold ends (potentially truncated)	7.64 %
% of genes from short scaffolds (< 2000 bps)	52.87 %
Associated GOLD sequencing projects	98
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (50.955 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (26.752 % of family members)
Environment Ontology (ENVO)	Unclassified (76.433 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (71.338 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 4.48% β-sheet: 0.00% Coil/Unstructured: 95.52%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.15
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.15
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 157 Family Scaffolds
PF00149	Metallophos	8.92
PF14213	DUF4325	7.64
PF05866	RusA	4.46
PF04448	DUF551	1.91
PF00085	Thioredoxin	1.91
PF05136	Phage_portal_2	1.27
PF02945	Endonuclease_7	1.27
PF12850	Metallophos_2	1.27
PF01391	Collagen	1.27
PF01370	Epimerase	1.27
PF07596	SBP_bac_10	1.27
PF01844	HNH	1.27
PF04862	DUF642	0.64
PF00478	IMPDH	0.64
PF13392	HNH_3	0.64
PF13489	Methyltransf_23	0.64
PF04055	Radical_SAM	0.64
PF13912	zf-C2H2_6	0.64
PF12705	PDDEXK_1	0.64
PF04024	PspC	0.64
PF00156	Pribosyltran	0.64
PF07733	DNA_pol3_alpha	0.64
PF16363	GDP_Man_Dehyd	0.64
PF00588	SpoU_methylase	0.64
PF09722	Xre_MbcA_ParS_C	0.64
PF03567	Sulfotransfer_2	0.64
PF06067	DUF932	0.64
PF13692	Glyco_trans_1_4	0.64
PF01755	Glyco_transf_25	0.64
PF08279	HTH_11	0.64
PF00268	Ribonuc_red_sm	0.64
PF13899	Thioredoxin_7	0.64
PF00692	dUTPase	0.64
PF10124	Mu-like_gpT	0.64
PF13098	Thioredoxin_2	0.64
PF03851	UvdE	0.64
PF13479	AAA_24	0.64
PF07963	N_methyl	0.64
PF00089	Trypsin	0.64

COG ID	Name	Functional Category	% Frequency in 157 Family Scaffolds
COG4570	Holliday junction resolvase RusA (prophage-encoded endonuclease)	Replication, recombination and repair [L]	4.46
COG2165	Type II secretory pathway, pseudopilin PulG	Cell motility [N]	2.55
COG5511	Phage capsid protein	Mobilome: prophages, transposons [X]	1.27
COG0208	Ribonucleotide reductase beta subunit, ferritin-like domain	Nucleotide transport and metabolism [F]	0.64
COG0219	tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain	Translation, ribosomal structure and biogenesis [J]	0.64
COG0565	tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase	Translation, ribosomal structure and biogenesis [J]	0.64
COG0566	tRNA G18 (ribose-2'-O)-methylase SpoU	Translation, ribosomal structure and biogenesis [J]	0.64
COG0587	DNA polymerase III, alpha subunit	Replication, recombination and repair [L]	0.64
COG0717	dCTP deaminase	Nucleotide transport and metabolism [F]	0.64
COG0756	dUTP pyrophosphatase (dUTPase)	Defense mechanisms [V]	0.64
COG2176	DNA polymerase III, alpha subunit (gram-positive type)	Replication, recombination and repair [L]	0.64
COG3306	Glycosyltransferase involved in LPS biosynthesis, GR25 family	Cell wall/membrane/envelope biogenesis [M]	0.64
COG4294	UV DNA damage repair endonuclease	Replication, recombination and repair [L]	0.64

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.96 %
All Organisms	root	All Organisms	49.04 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.96 %
cellular organisms	root	All Organisms → cellular organisms	28.03 %
Viruses	superkingdom	All Organisms → Viruses	21.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.96 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	22.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	11.46 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	9.55 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	5.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	11.46 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	9.55 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	3.18 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.55 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.91 %
unclassified Archaea	no rank	All Organisms → cellular organisms → Archaea → unclassified Archaea	0.64 %
environmental samples	no rank	All Organisms → cellular organisms → Archaea → environmental samples	0.64 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	11.46 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	9.55 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	3.18 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.27 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.91 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	0.64 %
uncultured archaeon	species	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon	0.64 %
unclassified Proteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria	0.64 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.64 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	11.46 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	9.55 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	2.55 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.91 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.64 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.64 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.64 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.64 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	0.64 %
uncultured archaeon	species	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	11.46 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	7.01 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	2.55 %
unclassified Bacteroidetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes	1.27 %
unclassified Planctomycetia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia	1.91 %
Streptomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales	0.64 %
Saprospiria	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria	0.64 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.64 %
Gemmatales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales	0.64 %
Chromatiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	0.64 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.64 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	0.64 %
uncultured archaeon	species	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	11.46 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7.01 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	2.55 %
Planctomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium	1.91 %
Gemmataceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae	0.64 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.64 %
Bacteroidetes bacterium 37-13	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 37-13	0.64 %
Bacteroidetes bacterium ADurb.BinA104	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104	0.64 %
Thiohalocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiohalocapsa	0.64 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	0.64 %
Saprospirales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales	0.64 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.64 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	0.64 %
uncultured archaeon	species	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	11.46 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7.01 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	2.55 %
Planctomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium	1.91 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.64 %
unclassified Saprospirales	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales	0.64 %
Methylobacterium nodulans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans	0.64 %
Thiohalocapsa halophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiohalocapsa → Thiohalocapsa halophila	0.64 %
Gemmataceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae	0.64 %
Bacteroidetes bacterium 37-13	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 37-13	0.64 %
Bacteroidetes bacterium ADurb.BinA104	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104	0.64 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.64 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	0.64 %
uncultured archaeon	species	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	11.46 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7.01 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	2.55 %
Planctomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium	1.91 %
Saprospirales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium	0.64 %
Methylobacterium nodulans ORS 2060	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans → Methylobacterium nodulans ORS 2060	0.64 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.64 %
Thiohalocapsa halophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiohalocapsa → Thiohalocapsa halophila	0.64 %
Gemmataceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae	0.64 %
Bacteroidetes bacterium 37-13	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 37-13	0.64 %
Bacteroidetes bacterium ADurb.BinA104	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104	0.64 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.64 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	0.64 %
uncultured archaeon	species	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon	0.64 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001848\|RCM47_1081525	Not Available	824	Open in IMG/M
3300002200\|metazooDRAFT_1279622	Not Available	1008	Open in IMG/M
3300002356\|B570J29598_103450	Not Available	717	Open in IMG/M
3300002357\|B570J29597_100587	Not Available	1024	Open in IMG/M
3300002403\|B570J29609_1001657	All Organisms → Viruses → Predicted Viral	2822	Open in IMG/M
3300002408\|B570J29032_109891594	Not Available	2063	Open in IMG/M
3300002476\|metazooDRAFT_10907440	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1589	Open in IMG/M
3300002835\|B570J40625_100003072	Not Available	31276	Open in IMG/M
3300002835\|B570J40625_100006581	All Organisms → cellular organisms → Bacteria	21513	Open in IMG/M
3300002835\|B570J40625_100202632	Not Available	2147	Open in IMG/M
3300002835\|B570J40625_100219167	All Organisms → Viruses → Predicted Viral	2031	Open in IMG/M
3300002835\|B570J40625_100286159	Not Available	1684	Open in IMG/M
3300002835\|B570J40625_100341698	Not Available	1489	Open in IMG/M
3300003986\|Ga0063233_10134539	Not Available	744	Open in IMG/M
3300004772\|Ga0007791_10055518	Not Available	1272	Open in IMG/M
3300005527\|Ga0068876_10000265	All Organisms → cellular organisms → Bacteria	41906	Open in IMG/M
3300005527\|Ga0068876_10095116	All Organisms → cellular organisms → Bacteria	1780	Open in IMG/M
3300005581\|Ga0049081_10001622	Not Available	8485	Open in IMG/M
3300005805\|Ga0079957_1000008	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	153585	Open in IMG/M
3300005805\|Ga0079957_1000150	Not Available	57103	Open in IMG/M
3300005805\|Ga0079957_1092342	All Organisms → Viruses → Predicted Viral	1674	Open in IMG/M
3300005805\|Ga0079957_1335957	Not Available	667	Open in IMG/M
3300006639\|Ga0079301_1008214	Not Available	4010	Open in IMG/M
3300007216\|Ga0103961_1440987	All Organisms → cellular organisms → Bacteria	1378	Open in IMG/M
3300007541\|Ga0099848_1195449	All Organisms → cellular organisms → Bacteria	728	Open in IMG/M
3300007541\|Ga0099848_1325602	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae	523	Open in IMG/M
3300008110\|Ga0114343_1034977	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium	2061	Open in IMG/M
3300008114\|Ga0114347_1013499	Not Available	4026	Open in IMG/M
3300008953\|Ga0104241_1000118	All Organisms → cellular organisms → Bacteria	6108	Open in IMG/M
3300008962\|Ga0104242_1026721	Not Available	990	Open in IMG/M
3300009081\|Ga0105098_10245490	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	843	Open in IMG/M
3300009151\|Ga0114962_10079177	All Organisms → cellular organisms → Archaea	2086	Open in IMG/M
3300009152\|Ga0114980_10074070	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium	2048	Open in IMG/M
3300009152\|Ga0114980_10097685	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1757	Open in IMG/M
3300009152\|Ga0114980_10144980	All Organisms → Viruses → Predicted Viral	1409	Open in IMG/M
3300009154\|Ga0114963_10114841	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1631	Open in IMG/M
3300009154\|Ga0114963_10129905	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1513	Open in IMG/M
3300009155\|Ga0114968_10043202	All Organisms → Viruses → Predicted Viral	2940	Open in IMG/M
3300009158\|Ga0114977_10185092	Not Available	1227	Open in IMG/M
3300009159\|Ga0114978_10046731	All Organisms → Viruses → Predicted Viral	3009	Open in IMG/M
3300009159\|Ga0114978_10571161	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon	656	Open in IMG/M
3300009161\|Ga0114966_10468605	Not Available	724	Open in IMG/M
3300009164\|Ga0114975_10012568	Not Available	5246	Open in IMG/M
3300009180\|Ga0114979_10184632	All Organisms → Viruses → Predicted Viral	1268	Open in IMG/M
3300009180\|Ga0114979_10361088	Not Available	855	Open in IMG/M
3300009180\|Ga0114979_10741136	Not Available	554	Open in IMG/M
3300009185\|Ga0114971_10038833	Not Available	3024	Open in IMG/M
3300010160\|Ga0114967_10000004	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	199884	Open in IMG/M
3300010334\|Ga0136644_10000783	All Organisms → cellular organisms → Bacteria	25434	Open in IMG/M
3300010334\|Ga0136644_10014734	Not Available	5369	Open in IMG/M
3300010334\|Ga0136644_10085250	All Organisms → Viruses → Predicted Viral	1981	Open in IMG/M
3300010334\|Ga0136644_10247189	Not Available	1048	Open in IMG/M
3300010354\|Ga0129333_10450990	Not Available	1133	Open in IMG/M
3300010885\|Ga0133913_10009549	All Organisms → cellular organisms → Bacteria	25434	Open in IMG/M
3300010885\|Ga0133913_11289747	Not Available	1866	Open in IMG/M
3300010885\|Ga0133913_12605351	All Organisms → cellular organisms → Archaea	1227	Open in IMG/M
3300012012\|Ga0153799_1009700	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2163	Open in IMG/M
3300013004\|Ga0164293_10004555	Not Available	11864	Open in IMG/M
3300013004\|Ga0164293_10026873	Not Available	4789	Open in IMG/M
3300013004\|Ga0164293_10027216	All Organisms → Viruses → Predicted Viral	4753	Open in IMG/M
3300013004\|Ga0164293_10120711	Not Available	1985	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10251497	All Organisms → Viruses → Predicted Viral	1073	Open in IMG/M
(restricted) 3300013133\|Ga0172362_10692167	Not Available	685	Open in IMG/M
3300013372\|Ga0177922_10475815	Not Available	10054	Open in IMG/M
3300014962\|Ga0134315_1002849	Not Available	3110	Open in IMG/M
3300017707\|Ga0181363_1047608	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	774	Open in IMG/M
3300017761\|Ga0181356_1154280	Not Available	709	Open in IMG/M
3300019784\|Ga0181359_1000486	Not Available	8924	Open in IMG/M
3300019784\|Ga0181359_1002534	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	5334	Open in IMG/M
3300020048\|Ga0207193_1021821	Not Available	7942	Open in IMG/M
3300020172\|Ga0211729_10522346	All Organisms → Viruses → Predicted Viral	1998	Open in IMG/M
3300020172\|Ga0211729_10879580	All Organisms → Viruses → Predicted Viral	1337	Open in IMG/M
3300020504\|Ga0208484_1008212	All Organisms → Viruses → Predicted Viral	1301	Open in IMG/M
3300020506\|Ga0208091_1001638	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium	3466	Open in IMG/M
3300020506\|Ga0208091_1008381	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 37-13	1323	Open in IMG/M
3300020515\|Ga0208234_1000887	All Organisms → cellular organisms → Archaea	4970	Open in IMG/M
3300020515\|Ga0208234_1016470	Not Available	880	Open in IMG/M
3300020516\|Ga0207935_1000599	Not Available	8550	Open in IMG/M
3300020530\|Ga0208235_1000232	All Organisms → cellular organisms → Bacteria	14489	Open in IMG/M
3300020531\|Ga0208487_1022461	Not Available	759	Open in IMG/M
3300020535\|Ga0208228_1017649	All Organisms → cellular organisms → Archaea	1228	Open in IMG/M
3300020541\|Ga0208359_1047665	Not Available	635	Open in IMG/M
3300020544\|Ga0207937_1013992	Not Available	1485	Open in IMG/M
3300020547\|Ga0208361_1000704	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiohalocapsa → Thiohalocapsa halophila	8002	Open in IMG/M
3300020555\|Ga0208358_1003307	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3863	Open in IMG/M
3300022747\|Ga0228703_1011761	All Organisms → cellular organisms → Bacteria	3194	Open in IMG/M
3300022752\|Ga0214917_10174838	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1096	Open in IMG/M
3300022752\|Ga0214917_10211537	Not Available	944	Open in IMG/M
3300023179\|Ga0214923_10000104	Not Available	122466	Open in IMG/M
3300023179\|Ga0214923_10000258	All Organisms → cellular organisms → Bacteria	81337	Open in IMG/M
3300023179\|Ga0214923_10000487	All Organisms → cellular organisms → Bacteria	60358	Open in IMG/M
3300023179\|Ga0214923_10004934	All Organisms → cellular organisms → Bacteria	15766	Open in IMG/M
3300023179\|Ga0214923_10050445	All Organisms → cellular organisms → Bacteria	3180	Open in IMG/M
3300023179\|Ga0214923_10266002	Not Available	955	Open in IMG/M
3300023179\|Ga0214923_10348859	Not Available	781	Open in IMG/M
3300023184\|Ga0214919_10722135	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	560	Open in IMG/M
3300025532\|Ga0208249_1124490	Not Available	564	Open in IMG/M
3300025578\|Ga0208864_1037095	Not Available	1341	Open in IMG/M
3300025687\|Ga0208019_1047339	All Organisms → cellular organisms → Bacteria	1504	Open in IMG/M
3300027114\|Ga0208009_1012653	Not Available	2033	Open in IMG/M
3300027581\|Ga0209651_1015671	All Organisms → cellular organisms → Archaea	2416	Open in IMG/M
3300027608\|Ga0208974_1009860	Not Available	3129	Open in IMG/M
3300027656\|Ga0209357_1202020	Not Available	505	Open in IMG/M
3300027708\|Ga0209188_1000055	All Organisms → cellular organisms → Bacteria	131248	Open in IMG/M
(restricted) 3300027730\|Ga0247833_1021751	Not Available	4657	Open in IMG/M
3300027733\|Ga0209297_1319884	Not Available	572	Open in IMG/M
3300027734\|Ga0209087_1002877	Not Available	9570	Open in IMG/M
3300027746\|Ga0209597_1168407	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	922	Open in IMG/M
3300027747\|Ga0209189_1001478	All Organisms → cellular organisms → Bacteria	17509	Open in IMG/M
3300027747\|Ga0209189_1017078	Not Available	3983	Open in IMG/M
3300027747\|Ga0209189_1031868	All Organisms → Viruses → Predicted Viral	2697	Open in IMG/M
3300027763\|Ga0209088_10004303	All Organisms → cellular organisms → Archaea	8319	Open in IMG/M
3300027777\|Ga0209829_10149539	Not Available	1069	Open in IMG/M
3300027782\|Ga0209500_10455610	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	502	Open in IMG/M
3300027793\|Ga0209972_10000233	All Organisms → cellular organisms → Bacteria	55622	Open in IMG/M
3300027963\|Ga0209400_1000687	All Organisms → cellular organisms → Bacteria	29205	Open in IMG/M
3300027974\|Ga0209299_1195825	Not Available	741	Open in IMG/M
3300028025\|Ga0247723_1065831	Not Available	989	Open in IMG/M
3300028394\|Ga0304730_1000024	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	199903	Open in IMG/M
(restricted) 3300028569\|Ga0247843_1000222	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	135304	Open in IMG/M
(restricted) 3300028581\|Ga0247840_10090060	Not Available	2074	Open in IMG/M
3300029349\|Ga0238435_102647	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2528	Open in IMG/M
3300031758\|Ga0315907_10171139	All Organisms → Viruses → Predicted Viral	1832	Open in IMG/M
3300031787\|Ga0315900_10048266	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104	4517	Open in IMG/M
3300031857\|Ga0315909_10031307	All Organisms → cellular organisms → Bacteria	5159	Open in IMG/M
3300031857\|Ga0315909_10092235	Not Available	2638	Open in IMG/M
3300031857\|Ga0315909_10114782	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium	2290	Open in IMG/M
3300031951\|Ga0315904_10000070	Not Available	157712	Open in IMG/M
3300031951\|Ga0315904_10299056	All Organisms → Viruses → Predicted Viral	1509	Open in IMG/M
3300033816\|Ga0334980_0008210	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	4594	Open in IMG/M
3300033980\|Ga0334981_0034204	Not Available	2721	Open in IMG/M
3300033981\|Ga0334982_0227387	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	908	Open in IMG/M
3300033981\|Ga0334982_0530268	Not Available	517	Open in IMG/M
3300033993\|Ga0334994_0036047	All Organisms → Viruses → Predicted Viral	3173	Open in IMG/M
3300033993\|Ga0334994_0143912	Not Available	1348	Open in IMG/M
3300033994\|Ga0334996_0091680	Not Available	1786	Open in IMG/M
3300034061\|Ga0334987_0000567	Not Available	34415	Open in IMG/M
3300034061\|Ga0334987_0524881	Not Available	716	Open in IMG/M
3300034062\|Ga0334995_0130430	Not Available	1846	Open in IMG/M
3300034062\|Ga0334995_0321048	All Organisms → cellular organisms → Bacteria	1005	Open in IMG/M
3300034062\|Ga0334995_0417057	Not Available	835	Open in IMG/M
3300034063\|Ga0335000_0215697	Not Available	1227	Open in IMG/M
3300034066\|Ga0335019_0038692	Not Available	3287	Open in IMG/M
3300034072\|Ga0310127_007401	All Organisms → cellular organisms → Bacteria	8749	Open in IMG/M
3300034072\|Ga0310127_052624	All Organisms → Viruses → Predicted Viral	2023	Open in IMG/M
3300034073\|Ga0310130_0007048	Not Available	4206	Open in IMG/M
3300034073\|Ga0310130_0075699	Not Available	1002	Open in IMG/M
3300034092\|Ga0335010_0118180	Not Available	1733	Open in IMG/M
3300034092\|Ga0335010_0150645	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans → Methylobacterium nodulans ORS 2060	1475	Open in IMG/M
3300034101\|Ga0335027_0179151	All Organisms → cellular organisms → Bacteria	1526	Open in IMG/M
3300034106\|Ga0335036_0667279	Not Available	621	Open in IMG/M
3300034120\|Ga0335056_0136787	Not Available	1469	Open in IMG/M
3300034120\|Ga0335056_0479002	Not Available	658	Open in IMG/M
3300034167\|Ga0335017_0486877	Not Available	655	Open in IMG/M
3300034200\|Ga0335065_0594340	Not Available	647	Open in IMG/M
3300034284\|Ga0335013_0187437	Not Available	1381	Open in IMG/M
3300034284\|Ga0335013_0283452	Not Available	1061	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	95.54%
Terrestrial	Environmental → Terrestrial	4.46%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	92.99%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	4.46%
Marine	Environmental → Aquatic → Marine	2.55%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	60.51%
Lentic	Environmental → Aquatic → Freshwater → Lentic	25.48%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	4.46%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	4.46%
Coastal	Environmental → Aquatic → Marine → Coastal	2.55%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.64%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.64%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.64%
Creek	Environmental → Aquatic → Freshwater → Creek	0.64%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	59.24%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	13.38%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	12.10%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	4.46%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	4.46%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	2.55%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	1.27%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.64%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.64%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.64%
Unclassified	Environmental → Aquatic → Freshwater → Creek → Unclassified	0.64%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	26.75%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	23.57%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	12.10%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	6.37%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	4.46%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	4.46%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	4.46%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	2.55%
Fracking Water	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water	2.55%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	1.91%
Lake	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake	1.27%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	1.27%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	1.27%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	1.27%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.64%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.64%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.64%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	0.64%
Marine Plankton	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton	0.64%
Surface Water	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water	0.64%
Freshwater	Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater	0.64%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	0.64%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.64%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001848	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a	Environmental	Open in IMG/M
3300002200	Freshwater microbial communities from San Paulo Zoo lake, Brazil - APR 2013	Environmental	Open in IMG/M
3300002356	Freshwater microbial communities from Lake Mendota, WI - 30AUG2010 deep hole epilimnion	Environmental	Open in IMG/M
3300002357	Freshwater microbial communities from Lake Mendota, WI - 17AUG2010 deep hole epilimnion	Environmental	Open in IMG/M
3300002403	Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnion	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300002476	Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300003986	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2)	Environmental	Open in IMG/M
3300004772	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300006639	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11	Environmental	Open in IMG/M
3300007216	Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects	Environmental	Open in IMG/M
3300007541	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG	Environmental	Open in IMG/M
3300008110	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA	Environmental	Open in IMG/M
3300008114	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA	Environmental	Open in IMG/M
3300008953	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4	Environmental	Open in IMG/M
3300008962	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5	Environmental	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental	Open in IMG/M
3300009152	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG	Environmental	Open in IMG/M
3300009154	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009185	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG	Environmental	Open in IMG/M
3300010160	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG	Environmental	Open in IMG/M
3300010334	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300012012	Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013126 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m	Environmental	Open in IMG/M
3300013133 (restricted)	Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300014962	Surface water microbial communities from Bangladesh - BaraHaldiaSW0309	Environmental	Open in IMG/M
3300017707	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental	Open in IMG/M
3300020504	Freshwater microbial communities from Lake Mendota, WI - 09AUG2011 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020506	Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020515	Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020516	Freshwater microbial communities from Lake Mendota, WI - 30AUG2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020530	Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020531	Freshwater microbial communities from Lake Mendota, WI - 21SEP2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020535	Freshwater microbial communities from Lake Mendota, WI - 25JUL2011 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020541	Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020544	Freshwater microbial communities from Lake Mendota, WI - 04SEP2011 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020547	Freshwater microbial communities from Lake Mendota, WI - 05AUG2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020555	Freshwater microbial communities from Lake Mendota, WI - 10AUG2009 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300022747	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG	Environmental	Open in IMG/M
3300022752	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB	Environmental	Open in IMG/M
3300023179	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510	Environmental	Open in IMG/M
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental	Open in IMG/M
3300025532	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1M (SPAdes)	Environmental	Open in IMG/M
3300025578	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M (SPAdes)	Environmental	Open in IMG/M
3300025687	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)	Environmental	Open in IMG/M
3300027114	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes)	Environmental	Open in IMG/M
3300027581	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes)	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027656	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes)	Environmental	Open in IMG/M
3300027708	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027730 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m	Environmental	Open in IMG/M
3300027733	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027734	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027746	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027747	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027763	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027777	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027793	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300027963	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027974	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300028394	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)	Environmental	Open in IMG/M
3300028569 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m	Environmental	Open in IMG/M
3300028581 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m	Environmental	Open in IMG/M
3300029349	Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300033816	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005	Environmental	Open in IMG/M
3300033980	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007	Environmental	Open in IMG/M
3300033981	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011	Environmental	Open in IMG/M
3300033993	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037	Environmental	Open in IMG/M
3300033994	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046	Environmental	Open in IMG/M
3300034061	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028	Environmental	Open in IMG/M
3300034062	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045	Environmental	Open in IMG/M
3300034063	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053	Environmental	Open in IMG/M
3300034066	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087	Environmental	Open in IMG/M
3300034072	Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A	Environmental	Open in IMG/M
3300034073	Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL	Environmental	Open in IMG/M
3300034092	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069	Environmental	Open in IMG/M
3300034101	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034120	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172	Environmental	Open in IMG/M
3300034167	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082	Environmental	Open in IMG/M
3300034200	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190	Environmental	Open in IMG/M
3300034284	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
RCM47_10815253	3300001848	Marine Plankton	MTADADDKNLPDSKIPWWDNHYEDVYSEEWEDAYPYDTGTKVQE*
metazooDRAFT_12796221	3300002200	Lake	MSDELPDSKIPWWDNHSEGTYSDDPEHGYPYDVGTKVQE*
B570J29598_1034502	3300002356	Freshwater	MNTTNEDTEYSLPDSKPFWDNHYEGVYSDDPENGYPYDVGTKVQE*
B570J29597_1005872	3300002357	Freshwater	MTDAADDSLPDSKIPWWDNDYEGTYSDDPENGYPYDVGTKVQE*
B570J29609_10016577	3300002403	Freshwater	MSEELPDSKIPWWDNEYEGIYSEDPDNGYPYDVGTKVQE*
B570J29032_1098915942	3300002408	Freshwater	MTNEDLPDVGPAWWDNESEGTYSEDHEDGYPYDE*
metazooDRAFT_109074404	3300002476	Lake	MSEDNEELPDVKPWFDNESEGVYSDDPENGFPYDNGSKVQE*
B570J40625_10000307250	3300002835	Freshwater	MLNEEHDEINDNLPDSKIPWFDNEYEGVYSEDPEDGYPYDVGSKVQE*
B570J40625_10000658128	3300002835	Freshwater	MSEELPDVPPCWWDNEYEGIYSDDPEDGYPYDMGTKVQE*
B570J40625_1002026323	3300002835	Freshwater	MSNTENNLPDSKIPWWDNHYEDIYSDDPEDGYPYDMGTKIQE*
B570J40625_1002191672	3300002835	Freshwater	MSEQLPDSKIPWWDNEYEGVYSDDPKDGYPYDMGTKVQE*
B570J40625_1002861594	3300002835	Freshwater	MTADVDSELPDSKIPWWDNEYEGVYSNDPENGYPYDMGTKVQE*
B570J40625_1003416983	3300002835	Freshwater	MQAEENNDDLPDSKIPWWDNHYEGVYSDDPEHGYPYDIGTKVQE*
Ga0063233_101345393	3300003986	Freshwater Lake	MSEELPDSKIPWFDNEYEGVYSDDQEHGYPYDMGTKVQE*
Ga0007791_100555184	3300004772	Freshwater	MTNTNSEHQENLPDSKIPWWDNHYEDVYSEEAEDGYPYDMGSKVQE*
Ga0068876_1000026521	3300005527	Freshwater Lake	MISDNTDGESLPDSKIPWYDNEYEGVYSDDPENGYPYDMGTKVQE*
Ga0068876_100951161	3300005527	Freshwater Lake	ATAGADQMTDAADDSLPDSKIPWWDNDYEGTYSDDPENGYPYDVGTKVQE*
Ga0049081_1000162213	3300005581	Freshwater Lentic	MTNTNSEHQENLPDSKIPWWDNHYEDVYSEDPEDGYPYDMGSKVQE*
Ga0079957_1000008127	3300005805	Lake	MSEILPDSKIPWWDNEYEGVYSDDPEDGYAYDMGTKIQE*
Ga0079957_100015076	3300005805	Lake	MTDELPDSKIPWWDNEYEGVYSDDPEDGYPYDVGTKVQE*
Ga0079957_10923424	3300005805	Lake	MSSNETNELPDSKIPWWDNHYEDVYSEEWDDGYPYDTGTKVQE*
Ga0079957_13359573	3300005805	Lake	MSSELPDSKIPWWDNHYEDTYSEEREDGYPYDMGTKIQE*
Ga0079301_10082143	3300006639	Deep Subsurface	MSTLPDSKIPWWDNHYEDTYSEEVEDGYPYDLGTKVQE*
Ga0103961_14409873	3300007216	Freshwater Lake	LDNEEELPDIDPYWENDYEGVYSDDPEDGYPYDTGTKVQE*
Ga0099848_11954492	3300007541	Aqueous	VNETLPDNDIPWWDNHYEGTYSEDPEDGYPYDTGTKVQE*
Ga0099848_13256022	3300007541	Aqueous	LSKELPDSKIPWWDNHYEGTYSDDYEDGYPYDNGTKVQE*
Ga0114343_10349773	3300008110	Freshwater, Plankton	MTDAADESLPDAKIPWWDNHSEGTYSDDPENGYPYDVGTKVQE*
Ga0114347_101349910	3300008114	Freshwater, Plankton	MSEEINDELPDSKIPWWDNHYEDTYSEEWENGYPYDTGTKVQE*
Ga0104241_10001183	3300008953	Freshwater	LDKELPDVSPSWWDNEYEGTYSDDPENGYAYDIGNKIQE*
Ga0104242_10267212	3300008962	Freshwater	MSNEENLPDSKIPWFDNEYEGVYSDDPEHGYPYDMGTKVQE*
Ga0105098_102454903	3300009081	Freshwater Sediment	MSSENENLPDSKIPWLDNEYEGVYSYDPEDGYPYDMGTKVQE*
Ga0114962_100791776	3300009151	Freshwater Lake	MTELPDSKIPWWDNHYEDIYSEEIEDGYPYDMGTKVQE*
Ga0114980_100740703	3300009152	Freshwater Lake	MSEVLPDSKIPWFDNEYEGVYSDDPENGYPYDMGTKVQE*
Ga0114980_100976853	3300009152	Freshwater Lake	MSILPDSKIPWWDNHYEDTYSEEVEDGYPYDMGTKIQE*
Ga0114980_101449802	3300009152	Freshwater Lake	MSDENLPDNKIPWWDNEYEGVYSDDPEDGYPYDMGSKVQE*
Ga0114963_101148411	3300009154	Freshwater Lake	LPDSKIPWWDNHYEDVYSEEVEDGYPYDVGTKVQE*
Ga0114963_101299053	3300009154	Freshwater Lake	MSELPDSKIPWWDNHYEDFYSEEVEDGYPYDLGTKIQE*
Ga0114968_1004320211	3300009155	Freshwater Lake	MHEELPDSKIPWFDNEYEGVYSDDPEHGYPYDVGTKVQE*
Ga0114977_101850921	3300009158	Freshwater Lake	IMGELPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKVQE*
Ga0114978_100467314	3300009159	Freshwater Lake	MGELPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKVQE*
Ga0114978_105711612	3300009159	Freshwater Lake	MSETLPDSKIPWFDNEYEGVYSDDPENGYPYDMGTKVQE*
Ga0114966_104686052	3300009161	Freshwater Lake	MSQILPDSKIPWWDNHYEDTYSEEVEDGYPYDVGTKVQE*
Ga0114975_100125689	3300009164	Freshwater Lake	MNNELPDSKIPWWDNHYEDVYSEEVEDGYPYDLGTKVQE*
Ga0114979_101846324	3300009180	Freshwater Lake	MNNQLPDSKIPWWDNHYEDIYSEEIEDGYPYDMGTKIQE*
Ga0114979_103610882	3300009180	Freshwater Lake	MGEVLPDSKIPWWDNHYEDIYSEEVEDGYPYDMGTKVQE*
Ga0114979_107411362	3300009180	Freshwater Lake	MTELPDSKIPWCDNHYEDIYSEEIEDGYPYDMGTKVQE*
Ga0114971_100388332	3300009185	Freshwater Lake	MINELPDSKIPWWDNHYEDTYTEEVEDGYPYDIGTKVQE*
Ga0114967_10000004130	3300010160	Freshwater Lake	MFNFNELPDTKIPWWDNHYEDTYSEEIEDGYPYDMGTKVQE*
Ga0136644_1000078343	3300010334	Freshwater Lake	MSENLPDSKIPWWDNEYEGVYSDDPEDGYPYDMETKVQE*
Ga0136644_100147348	3300010334	Freshwater Lake	MSTLPDSKIPWWDNHYEDVYSEEVEDGYPYDVGSKVQE*
Ga0136644_100852502	3300010334	Freshwater Lake	MSTLPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKVQE*
Ga0136644_102471895	3300010334	Freshwater Lake	MSENLPDSKIPWLDNEYEGVYSDDPEDGYPYDMGTKVQE*
Ga0129333_104509903	3300010354	Freshwater To Marine Saline Gradient	MSDELPDSKIPWWDNEYEGTYSDDHEDGYPYDMGTKVQE*
Ga0133913_1000954943	3300010885	Freshwater Lake	MSENLPDSKIPWWDNEYEGVYSDDPEDGYPYDMGTKVQE*
Ga0133913_112897475	3300010885	Freshwater Lake	MSEELPDSKIPWFDNEYEGVYSDDPEHGYPYDIGTKIQE*
Ga0133913_126053514	3300010885	Freshwater Lake	MNNQLPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKVQE*
Ga0153799_10097002	3300012012	Freshwater	MSEENLRDSKIPWWDNHYEYVYSEDPEDGYPYDMGTKVQE*
Ga0164293_1000455523	3300013004	Freshwater	MCNEEENNDYLPDSKIPWWDNHYEGVYSDDTENGYPYDIGTKVQE*
Ga0164293_1002687314	3300013004	Freshwater	MSELPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKIQE*
Ga0164293_100272164	3300013004	Freshwater	MSTLPDSKIPWWDNHYEDTYSEEVEDGYPYDIGTKVQE*
Ga0164293_101207116	3300013004	Freshwater	MSTLPDSKIPWWDNHYEDVYSEEVEDGYPYDVGTKVQE*
(restricted) Ga0172367_102514973	3300013126	Freshwater	LSEDKIETNQSLPDSKIPWWDNEYEDVYSEEWDDGYPYDVGTKVQE*
(restricted) Ga0172362_106921672	3300013133	Sediment	MEDILPDDDIPWFDNEYEGVYSDDPEDGYPYDMGTKVQE*
Ga0177922_1047581526	3300013372	Freshwater	MENNEELPDSKIPWWDNHYEDVYSEDPEDGYPYDMGTKVQE*
Ga0134315_10028495	3300014962	Surface Water	VSGEALPDSKLPWWDNHYEGTYSDDPENGYPYDVGTKVQE*
Ga0181363_10476083	3300017707	Freshwater Lake	MTADEDSGLPDSKIPWWDNDYEGVYSDDPANGYPYDIGTKVQE
Ga0181356_11542804	3300017761	Freshwater Lake	MNNELPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKIQE
Ga0181359_10004865	3300019784	Freshwater Lake	MSTLPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKIQE
Ga0181359_10025343	3300019784	Freshwater Lake	MSEELPDSKIPWFDNEYEGVYSDDQEHGYPYDMGTKVQE
Ga0207193_10218217	3300020048	Freshwater Lake Sediment	MNIEEENNLPDTKIPWFDNEYEGVYSDDPEDGYPYDMGTKVQE
Ga0211729_105223463	3300020172	Freshwater	MSEENLPDSKIPWWDNEYERVYSDDPEDGYPYDVGTKVQE
Ga0211729_108795802	3300020172	Freshwater	MSEENLPDSKIPWLDNEYEGVYSDDPEDGYPYDVGTKVQE
Ga0208484_10082122	3300020504	Freshwater	MSEQLPDSKIPWWDNEYEGVYSDDPKDGYPYDMGTKVQE
Ga0208091_10016387	3300020506	Freshwater	MTDAADDSLPDSKIPWWDNDYEGTYSDDPENGYPYDVGTKVQE
Ga0208091_10083816	3300020506	Freshwater	MSEELPDVPPCWWDNEYEGIYSDDPEDGYPYDMGTKVQE
Ga0208234_100088718	3300020515	Freshwater	MSTLPDSKIPWWDNHYEDTYSEEVEDGYPYDIGTKVQE
Ga0208234_10164701	3300020515	Freshwater	MSEELPDSKIPWWDNEYEGIYSEDPDNGYPYDVGTKVQE
Ga0207935_100059926	3300020516	Freshwater	MNTTNEDTEYSLPDSKPFWDNHYEGVYSDDPENGYPYDVGTKVQE
Ga0208235_100023210	3300020530	Freshwater	MLNEEHDEINDNLPDSKIPWFDNEYEGVYSEDPEDGYPYDVGSKVQE
Ga0208487_10224614	3300020531	Freshwater	MCNEEENNDYLPDSKIPWWDNHYEGVYSDDTENGYPYDIGTKVQE
Ga0208228_10176494	3300020535	Freshwater	MSTLPDSKIPWWDNHYEDVYSEEVEDGYPYDVGTKVQE
Ga0208359_10476652	3300020541	Freshwater	MSEVLPDSKIPWFDNEYEGVYSDDPENGYPYDMGTKVQE
Ga0207937_10139923	3300020544	Freshwater	MNELPDSKIPWWDNHYEDTYSEEVEDGYPYDMGTKIQE
Ga0208361_100070417	3300020547	Freshwater	MTDAADESLPDSKIPWWDNAYEGTYSDDPENGYPYDVGTKVQE
Ga0208358_10033072	3300020555	Freshwater	MTADEDSGLPDSKIPWWDNHYEDTYSEEVEDGYPYDMGTKVQE
Ga0228703_10117615	3300022747	Freshwater	MSKQLPDSKIPWWDNESEGVYSDDPDDGYPYDIGTKVQE
Ga0214917_101748384	3300022752	Freshwater	MIGAAMTQENEEDILPDSKSPWWDNEYEGVYSDDPEDGYPYDMGTKVQE
Ga0214917_102115373	3300022752	Freshwater	MSNEENLPDSKIPWFDNEYEGVYSDDPEHGYPYDMGTKVQE
Ga0214923_1000010427	3300023179	Freshwater	MTKQQINGHIEELPDSKIPWFDNEYEGVYSDDPEHGYPYDMGTKVQE
Ga0214923_1000025835	3300023179	Freshwater	MTTDSDSVLPDSKIPWWDNDYEGVYSDDPENGYPYDMGTKVQE
Ga0214923_10000487117	3300023179	Freshwater	MTNQESESDNLPDSKIPWWDNHYEDTYSEEVEDGYPYDMGTKVQE
Ga0214923_1000493453	3300023179	Freshwater	MIDQSQSDDLPDSKIPWWDNHYEDTYSEEVEDGYPYDMGTKVQE
Ga0214923_1005044511	3300023179	Freshwater	MIGVVMLEKNSEEDILPDSKIPWWDNEYERVYSDDPEDGYPYDIGTKVQE
Ga0214923_102660024	3300023179	Freshwater	MAEENLPDSKIPWFDNEYEGVYSDDPEHGYPYDMGTKVQE
Ga0214923_103488592	3300023179	Freshwater	MSSNEQNELPDSKIPWWDNHYEDVYSEEWEDGYPYDTGTKAQE
Ga0214919_107221352	3300023184	Freshwater	MTNTNSEHQENLPDTKIPWWDNHYEDVYSEEVEDGYPYDMGSKVQE
Ga0208249_11244901	3300025532	Freshwater	TNSEHQENLPDSKIPWWDNHYEDVYSEEAEDGYPYDMGSKVQE
Ga0208864_10370954	3300025578	Freshwater	MTNTNSEHQENLPDSKIPWWDNHYEDVYSEEAEDGYPYDMGSKVQE
Ga0208019_10473394	3300025687	Aqueous	VNETLPDNDIPWWDNHYEGTYSEDPEDGYPYDTGTKVQE
Ga0208009_10126534	3300027114	Deep Subsurface	MSTLPDSKIPWWDNHYEDTYSEEVEDGYPYDLGTKVQE
Ga0209651_10156719	3300027581	Freshwater Lake	MSTLPDSKIPWWDNHYEDVYSEEVEDGYPYDLGTKVQE
Ga0208974_10098602	3300027608	Freshwater Lentic	MTNTNSEHQENLPDSKIPWWDNHYEDVYSEDPEDGYPYDMGSKVQE
Ga0209357_12020201	3300027656	Freshwater Lake	MSEELPDSKIPWFDNEYEGVYSDDPEHGYPYDMGTKVQE
Ga0209188_1000055144	3300027708	Freshwater Lake	MTELPDSKIPWWDNHYEDIYSEEIEDGYPYDMGTKVQE
(restricted) Ga0247833_10217517	3300027730	Freshwater	MNNENTEENLPDSKIPWWDNHYEDVYSEEVEDGYSYDMGTKVQE
Ga0209297_13198843	3300027733	Freshwater Lake	IMGELPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKVQE
Ga0209087_10028778	3300027734	Freshwater Lake	MGELPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKVQE
Ga0209597_11684072	3300027746	Freshwater Lake	MINELPDSKIPWWDNHYEDTYTEEVEDGYPYDIGTKVQE
Ga0209189_100147839	3300027747	Freshwater Lake	MSTLPDSKIPWWDNHYEDVYSEEVEDGYPYDVGSKVQE
Ga0209189_101707812	3300027747	Freshwater Lake	MSENLPDSKIPWWDNEYEGVYSDDPEDGYPYDMGTKVQE
Ga0209189_10318688	3300027747	Freshwater Lake	MSTLPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKVQE
Ga0209088_1000430330	3300027763	Freshwater Lake	MNNQLPDSKIPWWDNHYEDIYSEEIEDGYPYDMGTKIQE
Ga0209829_101495392	3300027777	Freshwater Lake	MNELPDSKIPWWDNHYEDVYSEEVEDGYPYDVGTKVQE
Ga0209500_104556101	3300027782	Freshwater Lake	MSDENLPDNKIPWWDNEYEGVYSDDPEDGYPYDMGSKVQE
Ga0209972_1000023368	3300027793	Freshwater Lake	MISDNTDGESLPDSKIPWYDNEYEGVYSDDPENGYPYDMGTKVQE
Ga0209400_100068754	3300027963	Freshwater Lake	MHEELPDSKIPWFDNEYEGVYSDDPEHGYPYDVGTKVQE
Ga0209299_11958252	3300027974	Freshwater Lake	KMSEVLPDSKIPWFDNEYEGVYSDDPENGYPYDMGTKVQE
Ga0247723_10658311	3300028025	Deep Subsurface Sediment	MNEELPDSKIPWFDNEYEGVYSDDPEHGYPYDMGTKVQE
Ga0304730_1000024102	3300028394	Freshwater Lake	MFNFNELPDTKIPWWDNHYEDTYSEEIEDGYPYDMGTKVQE
(restricted) Ga0247843_1000222156	3300028569	Freshwater	MNQDWSLGYIEMSGENLPDSKIPWWDNEYEGVYSEDDEDGYPYDVGTKVQE
(restricted) Ga0247840_100900601	3300028581	Freshwater	LPDSKIPWWDNHYEDVYSEEVEDGYSYDMGTKVQE
Ga0238435_1026478	3300029349	Freshwater	MSEEINDELPDSKIPWWDNHYEDTYSEEWENGYPYDTGTKVQE
Ga0315907_101711394	3300031758	Freshwater	MSDELPDSKIPWWDNEYEGVYSDDPEDGYPYDMGAKVQE
Ga0315900_1004826611	3300031787	Freshwater	MSDELPDSKIPWWDNEYEGTYSDDPEDGCPYDMGTKVQE
Ga0315909_100313071	3300031857	Freshwater	MIENGEENSLPDSKIPWWDNEYEGVYSDDPEDGYPYDMGTKVQE
Ga0315909_100922353	3300031857	Freshwater	MSDELPDSKSPWWDNEYEGTYSDDPEDGYPYDMGTKVQE
Ga0315909_101147822	3300031857	Freshwater	MTDAADESLPDAKIPWWDNHSEGTYSDDPENGYPYDVGTKVQE
Ga0315904_1000007097	3300031951	Freshwater	MIENEADNSLPDSKIPWWDNEYEGVYSDDPEDGYPYDMGTKVQE
Ga0315904_102990564	3300031951	Freshwater	MSEEINDELPDSKIPWWDNHYEDTYSEEWDNGYPYDTGTKVQE
Ga0334980_0008210_668_826	3300033816	Freshwater	MSCSSRKNDMTTDTDNELPDSKIPWWDNDYEGVYSNDPENGYPYDMGTKVQE
Ga0334981_0034204_353_484	3300033980	Freshwater	MTDAADDSLPDSKIPWWDNAYEGTYSDDPENGYPYDVGTKVQE
Ga0334982_0227387_657_776	3300033981	Freshwater	MSKELPDVPPSWWDNEYEGTYSDDPENGYPYDVGSKIQE
Ga0334982_0530268_21_176	3300033981	Freshwater	MKKTKIMTKLTDEDSELPDSKIPWWDNEYEGVYSNDPENGYPYDIGTKVQE
Ga0334994_0036047_1273_1389	3300033993	Freshwater	MNELPDSKIPWWDNHYEDTYSEELEDGYPYDIGTKVQE
Ga0334994_0143912_1223_1348	3300033993	Freshwater	MTDAADDSLPDSKIPWWDNDYEGTYSDDPENGYPYDVGTKVQ
Ga0334996_0091680_1607_1726	3300033994	Freshwater	MSDALPDSKIPWLDNEYEGVYSDDPEDGYPYDMGSKVQE
Ga0334987_0000567_11283_11399	3300034061	Freshwater	MNELPDSKIPWWDNHYEDVYSEELEDGYPYDMGTKIQE
Ga0334987_0524881_215_331	3300034061	Freshwater	MSGLPDSKIPWWDNESEGVYSDDPEDGYPYDMGTKVQE
Ga0334995_0130430_575_706	3300034062	Freshwater	MTDAADDSLPDSKIPWWENDYEGTYSDDPENGYPYDVGTKVQE
Ga0334995_0321048_785_898	3300034062	Freshwater	MFNMTNEDLPDVGPAWWDNESEGTYSEDHEDGYPYDE
Ga0334995_0417057_46_174	3300034062	Freshwater	MSNTENNLPDSKIPWWDNHYEDIYSDDPEDGYPYDMGTKIQE
Ga0335000_0215697_642_761	3300034063	Freshwater	MSEVLPDSKIPWLDNEYEGVYSDDPENGYPYDMGTKVQE
Ga0335019_0038692_647_763	3300034066	Freshwater	MSELPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKIQE
Ga0310127_007401_1962_2081	3300034072	Fracking Water	MSDQLPDSKLPWWDNHYEGTYSDDPEDGYPYDVGTKVQE
Ga0310127_052624_612_731	3300034072	Fracking Water	LDKELPDVPPSWWDNEYEGTYSDDPENGYAYDIGNKIQE
Ga0310130_0007048_3210_3329	3300034073	Fracking Water	LDKELPDVPPSWWDNEYEGTYSDDPENGYPYDLGTKVQE
Ga0310130_0075699_438_557	3300034073	Fracking Water	LDKELPDVSPSWWDNGYEGTYSDDPENGYAYDIGNKIQE
Ga0335010_0118180_1468_1599	3300034092	Freshwater	MTADVDSELPDSKIPWWDNEYEGVYSNDPENGYPYDMGTKVQE
Ga0335010_0150645_690_821	3300034092	Freshwater	MTADEDSGLPDSKIPWWDNDYEGVYSDDPENGYPYDMGTKVQE
Ga0335027_0179151_746_865	3300034101	Freshwater	MSEELPDVPPSWWDNEYEGTYSDDPENGYPYDVGSKIQE
Ga0335036_0667279_321_446	3300034106	Freshwater	MENNEELPDSKIPWWDNHHEDVYSEDPEDGYPYDMGSKVQE
Ga0335056_0136787_521_652	3300034120	Freshwater	MTDAADGSLPDSKIPWWDNHSEGTYSDDPENGYPYDVGTKVQE
Ga0335056_0479002_124_255	3300034120	Freshwater	MTADVDSELPDSKIPWWDNDYEGVYSNDPENGYPYDMGTKVQE
Ga0335017_0486877_457_603	3300034167	Freshwater	MSLNWRIKMSEENLPDTKIPWWDNHYEDVYSEDPEDGYPYDMGSKVQE
Ga0335065_0594340_217_348	3300034200	Freshwater	MTDAADDSLPDSKIPWWDNDYEGTNSDDPENGYPYDVGTKVQE
Ga0335013_0187437_894_1028	3300034284	Freshwater	MQAEENNDDLPDSKIPWWDNHYEGVYSDDPEHGYPYDIGTKVQE
Ga0335013_0283452_755_871	3300034284	Freshwater	MSTLPDSKTPWWDNHYEDTYSEEVEDGYPYDIGTKVQE

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters