Basic Information | |
---|---|
Family ID | F041979 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 159 |
Average Sequence Length | 40 residues |
Representative Sequence | MSQIGSFALLLALGLSAYSFLAGLLALFRRDAASARLGETA |
Number of Associated Samples | 139 |
Number of Associated Scaffolds | 159 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 59.12 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 91.82 % |
Associated GOLD sequencing projects | 136 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (69.811 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.434 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.157 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.428 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.62% β-sheet: 0.00% Coil/Unstructured: 46.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 159 Family Scaffolds |
---|---|---|
PF11154 | DUF2934 | 38.36 |
PF00581 | Rhodanese | 29.56 |
PF00072 | Response_reg | 4.40 |
PF00856 | SET | 3.77 |
PF14579 | HHH_6 | 3.14 |
PF05258 | DciA | 3.14 |
PF01336 | tRNA_anti-codon | 1.89 |
PF07593 | UnbV_ASPIC | 1.26 |
PF01425 | Amidase | 1.26 |
PF07722 | Peptidase_C26 | 0.63 |
PF07494 | Reg_prop | 0.63 |
PF07715 | Plug | 0.63 |
PF14329 | DUF4386 | 0.63 |
PF10282 | Lactonase | 0.63 |
PF01850 | PIN | 0.63 |
PF00342 | PGI | 0.63 |
COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
---|---|---|---|
COG5512 | Predicted nucleic acid-binding protein, contains Zn-ribbon domain (includes truncated derivatives) | General function prediction only [R] | 3.14 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.26 |
COG0166 | Glucose-6-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.63 |
COG3292 | Periplasmic ligand-binding sensor domain | Signal transduction mechanisms [T] | 0.63 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 69.81 % |
Unclassified | root | N/A | 30.19 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001139|JGI10220J13317_10183803 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300001154|JGI12636J13339_1047778 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300001174|JGI12679J13547_1009311 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300001305|C688J14111_10004976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3657 | Open in IMG/M |
3300001471|JGI12712J15308_10132033 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300001546|JGI12659J15293_10032566 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
3300001593|JGI12635J15846_10809634 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100279516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1555 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100427154 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300002561|JGI25384J37096_10020181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2594 | Open in IMG/M |
3300002917|JGI25616J43925_10308171 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300004080|Ga0062385_10351180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 865 | Open in IMG/M |
3300004092|Ga0062389_101908342 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300005332|Ga0066388_102053949 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
3300005406|Ga0070703_10503401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 545 | Open in IMG/M |
3300005458|Ga0070681_11984957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 510 | Open in IMG/M |
3300005541|Ga0070733_10575203 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300005542|Ga0070732_10931382 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300005545|Ga0070695_100190104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1461 | Open in IMG/M |
3300005557|Ga0066704_10259153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1180 | Open in IMG/M |
3300005557|Ga0066704_10933181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 536 | Open in IMG/M |
3300005576|Ga0066708_10515145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 771 | Open in IMG/M |
3300005712|Ga0070764_10162052 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
3300005719|Ga0068861_100909613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 834 | Open in IMG/M |
3300005764|Ga0066903_100917630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1587 | Open in IMG/M |
3300005891|Ga0075283_1101475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 539 | Open in IMG/M |
3300005983|Ga0081540_1251529 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300006028|Ga0070717_11401918 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300006041|Ga0075023_100548731 | Not Available | 529 | Open in IMG/M |
3300006050|Ga0075028_100746735 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300006052|Ga0075029_100092553 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
3300006055|Ga0097691_1039506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1745 | Open in IMG/M |
3300006102|Ga0075015_100987377 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300006162|Ga0075030_100981138 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300006173|Ga0070716_100020093 | All Organisms → cellular organisms → Bacteria | 3502 | Open in IMG/M |
3300006173|Ga0070716_100741411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 755 | Open in IMG/M |
3300006755|Ga0079222_10828193 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300006797|Ga0066659_11350131 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300009088|Ga0099830_11532384 | Not Available | 555 | Open in IMG/M |
3300009521|Ga0116222_1391237 | Not Available | 604 | Open in IMG/M |
3300009523|Ga0116221_1102013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1268 | Open in IMG/M |
3300009623|Ga0116133_1104403 | Not Available | 722 | Open in IMG/M |
3300009624|Ga0116105_1066593 | Not Available | 853 | Open in IMG/M |
3300009683|Ga0116224_10225297 | Not Available | 896 | Open in IMG/M |
3300009700|Ga0116217_10639386 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300010360|Ga0126372_12066754 | Not Available | 617 | Open in IMG/M |
3300010371|Ga0134125_10512250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1329 | Open in IMG/M |
3300010371|Ga0134125_10691387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1125 | Open in IMG/M |
3300010373|Ga0134128_10961681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 944 | Open in IMG/M |
3300010398|Ga0126383_13597749 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300011269|Ga0137392_10385318 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
3300012096|Ga0137389_11780209 | Not Available | 512 | Open in IMG/M |
3300012096|Ga0137389_11796710 | Not Available | 509 | Open in IMG/M |
3300012189|Ga0137388_10334951 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
3300012201|Ga0137365_10106701 | All Organisms → cellular organisms → Bacteria | 2107 | Open in IMG/M |
3300012210|Ga0137378_10350078 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
3300012211|Ga0137377_10919899 | Not Available | 806 | Open in IMG/M |
3300012683|Ga0137398_10142632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1548 | Open in IMG/M |
3300012685|Ga0137397_11362226 | Not Available | 501 | Open in IMG/M |
3300012882|Ga0157304_1095079 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300012917|Ga0137395_11137549 | Not Available | 551 | Open in IMG/M |
3300012918|Ga0137396_10265356 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300012961|Ga0164302_11338831 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300012988|Ga0164306_10992579 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300014498|Ga0182019_10542781 | Not Available | 810 | Open in IMG/M |
3300014654|Ga0181525_10253469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 960 | Open in IMG/M |
3300014658|Ga0181519_10582179 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300014968|Ga0157379_10618892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1012 | Open in IMG/M |
3300014968|Ga0157379_11447585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
3300017822|Ga0187802_10355909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
3300017823|Ga0187818_10570445 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300017932|Ga0187814_10089052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1136 | Open in IMG/M |
3300017946|Ga0187879_10286692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
3300017955|Ga0187817_10723314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
3300017966|Ga0187776_10536973 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300017972|Ga0187781_10006445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8642 | Open in IMG/M |
3300017972|Ga0187781_10933592 | Not Available | 633 | Open in IMG/M |
3300017975|Ga0187782_10476119 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300017975|Ga0187782_10858063 | Not Available | 703 | Open in IMG/M |
3300017995|Ga0187816_10050262 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
3300017995|Ga0187816_10309851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 694 | Open in IMG/M |
3300018007|Ga0187805_10076196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1511 | Open in IMG/M |
3300018007|Ga0187805_10151195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1056 | Open in IMG/M |
3300018024|Ga0187881_10152581 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300018026|Ga0187857_10115451 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
3300018030|Ga0187869_10118157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1330 | Open in IMG/M |
3300018030|Ga0187869_10601491 | Not Available | 520 | Open in IMG/M |
3300018037|Ga0187883_10766205 | Not Available | 504 | Open in IMG/M |
3300018040|Ga0187862_10657860 | Not Available | 616 | Open in IMG/M |
3300018046|Ga0187851_10048115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2800 | Open in IMG/M |
3300018046|Ga0187851_10075906 | Not Available | 2127 | Open in IMG/M |
3300018047|Ga0187859_10390402 | Not Available | 763 | Open in IMG/M |
3300018047|Ga0187859_10502929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 675 | Open in IMG/M |
3300018057|Ga0187858_10265325 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300018057|Ga0187858_10819268 | Not Available | 550 | Open in IMG/M |
3300018085|Ga0187772_10480046 | Not Available | 874 | Open in IMG/M |
3300018085|Ga0187772_10824394 | Not Available | 671 | Open in IMG/M |
3300018086|Ga0187769_10142917 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
3300018086|Ga0187769_10218749 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
3300018090|Ga0187770_10908046 | Not Available | 707 | Open in IMG/M |
3300020004|Ga0193755_1161813 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300020579|Ga0210407_10000806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 32520 | Open in IMG/M |
3300020582|Ga0210395_10528457 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300021171|Ga0210405_11268881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
3300021178|Ga0210408_10696625 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300021178|Ga0210408_11505544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300021181|Ga0210388_10762437 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300021420|Ga0210394_10693844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 892 | Open in IMG/M |
3300021432|Ga0210384_10606081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 983 | Open in IMG/M |
3300021445|Ga0182009_10402240 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300021478|Ga0210402_10990610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
3300022714|Ga0242671_1070527 | Not Available | 617 | Open in IMG/M |
3300024271|Ga0224564_1134446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300025477|Ga0208192_1041360 | Not Available | 952 | Open in IMG/M |
3300025910|Ga0207684_10103393 | All Organisms → cellular organisms → Bacteria | 2436 | Open in IMG/M |
3300025922|Ga0207646_10624651 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300025972|Ga0207668_12032440 | Not Available | 518 | Open in IMG/M |
3300026271|Ga0209880_1030891 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
3300026499|Ga0257181_1071756 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300026557|Ga0179587_10199607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1267 | Open in IMG/M |
3300027070|Ga0208365_1032611 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300027565|Ga0209219_1014071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1897 | Open in IMG/M |
3300027645|Ga0209117_1121479 | Not Available | 699 | Open in IMG/M |
3300027678|Ga0209011_1192768 | Not Available | 558 | Open in IMG/M |
3300027696|Ga0208696_1127352 | Not Available | 834 | Open in IMG/M |
3300027698|Ga0209446_1091931 | Not Available | 777 | Open in IMG/M |
3300027737|Ga0209038_10262563 | Not Available | 517 | Open in IMG/M |
3300027854|Ga0209517_10413881 | Not Available | 754 | Open in IMG/M |
3300027903|Ga0209488_10069959 | All Organisms → cellular organisms → Bacteria | 2601 | Open in IMG/M |
3300027903|Ga0209488_10644381 | Not Available | 764 | Open in IMG/M |
3300027905|Ga0209415_10087248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3532 | Open in IMG/M |
3300027911|Ga0209698_11020226 | Not Available | 616 | Open in IMG/M |
3300028574|Ga0302153_10196469 | Not Available | 691 | Open in IMG/M |
3300028776|Ga0302303_10214119 | Not Available | 664 | Open in IMG/M |
3300028866|Ga0302278_10429614 | Not Available | 578 | Open in IMG/M |
3300029636|Ga0222749_10469739 | Not Available | 676 | Open in IMG/M |
3300029911|Ga0311361_10193521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2526 | Open in IMG/M |
3300029919|Ga0302141_1067078 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300030014|Ga0302175_10074829 | Not Available | 753 | Open in IMG/M |
3300030294|Ga0311349_11162626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
3300030294|Ga0311349_12028754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300030399|Ga0311353_10816940 | Not Available | 794 | Open in IMG/M |
3300030659|Ga0316363_10227577 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300030991|Ga0073994_11826869 | Not Available | 521 | Open in IMG/M |
3300031247|Ga0265340_10561112 | Not Available | 503 | Open in IMG/M |
3300031250|Ga0265331_10196574 | Not Available | 909 | Open in IMG/M |
3300031521|Ga0311364_10487096 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
3300031525|Ga0302326_10566002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1701 | Open in IMG/M |
3300031740|Ga0307468_100167422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1438 | Open in IMG/M |
3300031823|Ga0307478_10102124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2223 | Open in IMG/M |
3300031902|Ga0302322_102726392 | Not Available | 609 | Open in IMG/M |
3300032174|Ga0307470_11903108 | Not Available | 506 | Open in IMG/M |
3300032205|Ga0307472_101521472 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300032783|Ga0335079_10260749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1903 | Open in IMG/M |
3300032783|Ga0335079_12000109 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300032828|Ga0335080_12411208 | Not Available | 501 | Open in IMG/M |
3300032893|Ga0335069_11044719 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300033004|Ga0335084_11907376 | Not Available | 580 | Open in IMG/M |
3300033402|Ga0326728_10325414 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.43% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.18% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.92% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.29% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.03% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.03% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.40% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.14% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.14% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.14% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.52% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.52% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.52% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.89% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.89% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.89% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.26% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.26% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.26% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.26% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.26% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.26% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.63% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.63% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.63% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.63% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.63% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.63% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.63% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.63% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.63% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.63% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.63% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028574 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2 | Environmental | Open in IMG/M |
3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300029919 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2 | Environmental | Open in IMG/M |
3300030014 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3 | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10220J13317_101838031 | 3300001139 | Soil | MSQIGSFALLLALALSTYSFLAGVLALTRPGPASERL |
JGI12636J13339_10477783 | 3300001154 | Forest Soil | MAQIGSYVLLLALALSAYSFLAGTIALVRRDHGSER |
JGI12679J13547_10093112 | 3300001174 | Forest Soil | MSQIGSFALLLALGLSVYCFSAGFLSLFGKDAASARLGETARRAGIATF |
C688J14111_100049761 | 3300001305 | Soil | MAHIGSFALLLALALSMYSFGGGVLALLFQNDPRSARLGETAR |
JGI12712J15308_101320333 | 3300001471 | Forest Soil | MAQIGSFALLLALALSIYSFAAGLFALFFPGPGSERVG |
JGI12659J15293_100325661 | 3300001546 | Forest Soil | MSQIGSFALMLALGLSAYCFVAGFLALFSRSAASARLGETARRAGIA |
JGI12635J15846_108096342 | 3300001593 | Forest Soil | MSQIGSFALLLALGLSAYSFLAGLLALFNRNAASAR |
JGIcombinedJ26739_1002795164 | 3300002245 | Forest Soil | MSQIGSFALLLALALCAYSFLAGILALVNKASGSER |
JGIcombinedJ26739_1004271541 | 3300002245 | Forest Soil | MSQIGSFALMLALGLSAYSFLAGFLALFGRDAASARLG |
JGI25384J37096_100201811 | 3300002561 | Grasslands Soil | MAQIGSFALLLALALSAYSFLAGLLALLRPGAGSERLGETARRA |
JGI25616J43925_103081711 | 3300002917 | Grasslands Soil | MSQIGSFALLLALGLSAYSFLAGLLALFRRDAASARLGETA |
Ga0062385_103511802 | 3300004080 | Bog Forest Soil | MAEIGSFALLLALALSVYCFVAGLIALVRPGGFERLGETA |
Ga0062389_1019083423 | 3300004092 | Bog Forest Soil | MSQIGSFALLFALTLSAYSFLAGLWALTETGPASERVGETARRAGIATFALV |
Ga0066388_1020539491 | 3300005332 | Tropical Forest Soil | MSQIGSFALLLALCFSLYSCFAGILSLFNRDARSARLGETARR |
Ga0070703_105034011 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQIGSFALLLALALSTYSCLAGVLALTRPGPASERLGETA |
Ga0070681_119849571 | 3300005458 | Corn Rhizosphere | MSQIGSFALLLALALSTYSFLAGILALARPGPASERLGETARRAG |
Ga0070733_105752033 | 3300005541 | Surface Soil | MATIGSYALLLALALSAYSFVAGFFALADPGPGSE |
Ga0070732_109313822 | 3300005542 | Surface Soil | MATIGSWSLILALALSAYSFLAGLLSLIEGEGSEYLG |
Ga0070695_1001901043 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQIGSFALLLALALSTYSFLAGVLALARPGPASERLGETARRAG |
Ga0066704_102591531 | 3300005557 | Soil | MSQIGSFSLLLALALSVYSVVAGLIALLRRGPGSERL |
Ga0066704_109331811 | 3300005557 | Soil | MSQIGSFALLLALALSAYSFLAGALALAQPGPGSERLGET |
Ga0066708_105151451 | 3300005576 | Soil | MPQIGSFALLLALCLSAYSFVAGILALAFPGRGSERLG |
Ga0070764_101620524 | 3300005712 | Soil | MPVIGSFALQLALALTAYSFLAGILALAREGPGSARLSETARRA |
Ga0068861_1009096131 | 3300005719 | Switchgrass Rhizosphere | MSQVGSFALLIALALSVYSFLAGIFALIRQGPQSERLGETA |
Ga0066903_1009176303 | 3300005764 | Tropical Forest Soil | MSQIGSFALLLALALAAYSFVAGALALGRPGAGSE |
Ga0075283_11014751 | 3300005891 | Rice Paddy Soil | MAQIGSFSLILALALSIYCFLAGFLALARPGAGSERLNETA |
Ga0081540_12515292 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MSQLGSYALLLALALSAYSFLGGLAALVSPGPQSERLGETA |
Ga0070717_114019183 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQIGSYVLLLALALSAYSFLAGTVALVRRDHGSER |
Ga0075023_1005487311 | 3300006041 | Watersheds | MAQIGSFALILALALSGYSFLFGLLALFLPGAVSARLGETAR |
Ga0075028_1007467351 | 3300006050 | Watersheds | MSQIGSFALLLALCLSAYSFLAGLLALFSKNAASARLG |
Ga0075029_1000925534 | 3300006052 | Watersheds | MSLIGSFALLLALALAAYSFLAGLFGLFRRDAMGAR |
Ga0097691_10395061 | 3300006055 | Arctic Peat Soil | MSQIGSFALLLALGLSAYSFLAGLLALFGKDAVSARV |
Ga0075015_1009873772 | 3300006102 | Watersheds | MAQIGSFALLLALGLSAYSFGAGLLALFGRDAVSARLGE |
Ga0075030_1009811382 | 3300006162 | Watersheds | MAQIGSFALLLALGLSAYSFGAGLLALFGRDAVSAR |
Ga0070716_1000200933 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQIGSFALLLALALSAYSFLAGALALAKPGPVSERLGET |
Ga0070716_1007414111 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQVGSFALLIALALSVYSFLAGIFALIRQGPQSERL |
Ga0079222_108281931 | 3300006755 | Agricultural Soil | MSQIGSFALLLALALSAYSFLGGLMALVVKGPGSER |
Ga0066659_113501312 | 3300006797 | Soil | MSQVGSFALLLALALSAYSFLAGTLALLRPGASSDRLGETA |
Ga0099830_115323841 | 3300009088 | Vadose Zone Soil | MSQIGSFALLLALGLSAYSFLAGLLALFSKDAASARLGETARRA |
Ga0116222_13912371 | 3300009521 | Peatlands Soil | MSQIGSFALLLALGLSAYCFLAGFVALFRRDAASA |
Ga0116221_11020133 | 3300009523 | Peatlands Soil | MSQIGSFALLLALGLSAYSFLAGFIALFGKDAASARLG |
Ga0116133_11044032 | 3300009623 | Peatland | MSQIGSFALLLALGLSAYSFLAGFLALFRRDAVSARLGETARRAG |
Ga0116105_10665931 | 3300009624 | Peatland | MSQIGSFALMLALGLSAYSFLAGFVALFGKDAASAR |
Ga0116224_102252971 | 3300009683 | Peatlands Soil | MSQIGSFALLLALGLSAYSFLAGFLALFGKDAASARLGETAR |
Ga0116217_106393861 | 3300009700 | Peatlands Soil | MSQLGSFALLLALALSAYSFLAGILALVREGPSSARLSETAR |
Ga0126372_120667541 | 3300010360 | Tropical Forest Soil | MSQIGSFALLLALCFSLYSCFAGILSLLKRDARSARLGETAR |
Ga0134125_105122503 | 3300010371 | Terrestrial Soil | MSQIGSFALLLALALSTYSFLAGILALARPGPASERLGETA |
Ga0134125_106913873 | 3300010371 | Terrestrial Soil | MSQIGSFALLLALALSTYSFLAGVLALARPGPASERLGETAR |
Ga0134128_109616811 | 3300010373 | Terrestrial Soil | MSQLGSYALLLALALSAYSFIGGLAALVWPGAQSERLGETA |
Ga0126383_135977492 | 3300010398 | Tropical Forest Soil | MAQIGSFALLLALALSAYSFLVGLLALLRRGPGSERLGE |
Ga0137392_103853183 | 3300011269 | Vadose Zone Soil | MSQIGSFALLLALGLSAYSFLAGLLALLNRDAASARLGETARRAGIA |
Ga0137389_117802091 | 3300012096 | Vadose Zone Soil | MYQIGSFALLLALCLSAYSFLAGLLALFNRDAASARLGETAR |
Ga0137389_117967101 | 3300012096 | Vadose Zone Soil | MSQIGSFALLLALCLSAYSFLAGLLALFNRDAASARLGETAR |
Ga0137388_103349513 | 3300012189 | Vadose Zone Soil | MNGTVGPPAMSQIGSFALLLALCLSAYSFLAGLLALFNRDAASARLG |
Ga0137365_101067011 | 3300012201 | Vadose Zone Soil | MSQIGSFALLLALVLSAYSFLAGLVALSRKGTGAER |
Ga0137378_103500783 | 3300012210 | Vadose Zone Soil | MSLIGSYALLFALALSAYSFLGGFAALAFPGVGSERLGETSRRAG |
Ga0137377_109198991 | 3300012211 | Vadose Zone Soil | MPSIGTFALLLALSLSSYSFLAGLVALFGRDAGSMRLGETARRA |
Ga0137398_101426324 | 3300012683 | Vadose Zone Soil | MSSIGAFALLLALGLSSYSFLAGLLELFGRDAGSMRLGETAPRAGIAT |
Ga0137397_113622261 | 3300012685 | Vadose Zone Soil | MSYIGAFALLLALGLSSYSFLAGLLALFGRDAGSMR |
Ga0157304_10950792 | 3300012882 | Soil | MSQIGSFALLLALALSTYSFLAGVLALTRPGPASERLGET |
Ga0137395_111375491 | 3300012917 | Vadose Zone Soil | MAQIGSYALLLALALSAYSFLAGTIALVRRDPGSERM |
Ga0137396_102653564 | 3300012918 | Vadose Zone Soil | MAQIGSFALLLALALSVYSFLAGMIALFRQDQSSER |
Ga0164302_113388312 | 3300012961 | Soil | MSQIGSFALLLALALSTYSFLAGVLALTRPGPASDRLGET |
Ga0164306_109925791 | 3300012988 | Soil | MSQIGSFALLLALALSTYSFLAGVLALTRPGPASERLG |
Ga0182019_105427811 | 3300014498 | Fen | MSQIGSFALLLALGLSAYSFLAGFLSLFRRDAASARLGETARRAG |
Ga0181525_102534691 | 3300014654 | Bog | MPQIGSFALLLALALTVYSFLAGLFALLLNSQQSGRLGETARR |
Ga0181519_105821791 | 3300014658 | Bog | MSQIGSFALLLALALTAYSFLAGLFALLMNSQQSGRLGETARRA |
Ga0157379_106188921 | 3300014968 | Switchgrass Rhizosphere | MAQIGSFALLLALALSVYSFLAGVISLLRQDQGSE |
Ga0157379_114475853 | 3300014968 | Switchgrass Rhizosphere | MSQLGSYALLLALALSAYSFIGGLAALVWPGAQSERLGE |
Ga0187802_103559092 | 3300017822 | Freshwater Sediment | MAAIGDFVLLLALALSAYSFLFGLLALILPGPGWQRVGETAR |
Ga0187818_105704451 | 3300017823 | Freshwater Sediment | MAQIGSFALLFALALSGYSFLAGIVALVRRDEGAERLGETARR |
Ga0187814_100890523 | 3300017932 | Freshwater Sediment | MSQIGSFALLLALALCAYSFLAGILALVSKAPSSERLGETA |
Ga0187879_102866923 | 3300017946 | Peatland | MSQIGSFALLLALALCTYSFLAGLLALVIKGSGSERLGETA |
Ga0187817_107233141 | 3300017955 | Freshwater Sediment | MAAIGDFVLLLALALSAYSFLFGLLALILPGPGWQRVGETARRAG |
Ga0187776_105369732 | 3300017966 | Tropical Peatland | MSQIGSFALLLALGLSAYSFLAGLLALLGRDAGSLRLGE |
Ga0187781_100064451 | 3300017972 | Tropical Peatland | MATIGSYALLLALALSAYSFLFGLLALVSPGEGSERVGETARRAGV |
Ga0187781_109335922 | 3300017972 | Tropical Peatland | MSQIGSFALLLALGLSVYCFLAGFVALFRRDAASARLGETA |
Ga0187782_104761193 | 3300017975 | Tropical Peatland | MAQIGSFALLLALVLSAYSFGAGLLSLFSRDAASARLGETARRAGIA |
Ga0187782_108580632 | 3300017975 | Tropical Peatland | MAQIGSYALLLALGLSVYSFGAGLLALFGRDAASAR |
Ga0187816_100502624 | 3300017995 | Freshwater Sediment | MSQIGSFALLLALGLSAYCFLAGFVALFRRDAASARLGETAR |
Ga0187816_103098511 | 3300017995 | Freshwater Sediment | MSTIGSFALLLPLGLSAYSFLAGLIALLGRDAAPARLGETARRAGIAT |
Ga0187805_100761964 | 3300018007 | Freshwater Sediment | MSQIGSFALLLALALSAYSFLAGLLALSGKNPGAERLGETARR |
Ga0187805_101511953 | 3300018007 | Freshwater Sediment | MSQIGSFALLLALALCAYSFLAGILALVGKGPSSERLGE |
Ga0187881_101525813 | 3300018024 | Peatland | MSQIGSFALMLALGLSAYCFLAGFVALFRRDAASA |
Ga0187857_101154513 | 3300018026 | Peatland | MSQIGSFALLLALGLSAYSFLAGFLALFRKDAASA |
Ga0187869_101181571 | 3300018030 | Peatland | MSQIGSFALLLALALCTYSFLAGLLALIIKGPGAGRLGETARRAG |
Ga0187869_106014912 | 3300018030 | Peatland | MSEIGSFALMAALGLSAYSFLAGLLSLFNKDAASARLGET |
Ga0187883_107662051 | 3300018037 | Peatland | MSQIGSFALLLALGLSAYSFLAGFLALFRRDAVSARLGETAR |
Ga0187862_106578601 | 3300018040 | Peatland | MSQIGSFALLLALGLSAYSFLAGFLALFSRDAASARLGET |
Ga0187851_100481151 | 3300018046 | Peatland | MSQIGSFALMLALGLSAYSFLAGFVALFGKDAASARLGETARR |
Ga0187851_100759061 | 3300018046 | Peatland | MSQIGSFALLLALALCTYSFLAGLLALIIKGPGAGR |
Ga0187859_103904023 | 3300018047 | Peatland | MSQLGSFALLLALALSAYSFLAGILALVREGPSSARLSET |
Ga0187859_105029292 | 3300018047 | Peatland | MSQIGSFALLLALALCTYSFLAGLLALVIKGSGSERLGET |
Ga0187858_102653253 | 3300018057 | Peatland | MLALGLSAYSFLAGFLALFGKDAASARLGETARRAGIATFAAVLLAGI |
Ga0187858_108192681 | 3300018057 | Peatland | MSQIGSFALMLALGLSAYCFLAGFVALFRRDAASARLGET |
Ga0187772_104800461 | 3300018085 | Tropical Peatland | MATIGSFALLLALALSVYSFLAGLLSLFGRDAASAR |
Ga0187772_108243943 | 3300018085 | Tropical Peatland | MAQIGSFALLLAFVLSAYSFGAGLLSLFRRDAASARLGETARRAGIA |
Ga0187769_101429173 | 3300018086 | Tropical Peatland | MSQIGSFTLLLALALSGYCFLAGLLALIREGPGSARL |
Ga0187769_102187493 | 3300018086 | Tropical Peatland | MSQIGSFALLLALALCAYSFLAGLVALAREQNTSSARLSE |
Ga0187770_109080463 | 3300018090 | Tropical Peatland | MAQIGSFALLLALGLAAYSFGAGLLSLFNRDAASAR |
Ga0193755_11618132 | 3300020004 | Soil | MSQIGSFALLLALVLSAYSFLAGLVALVRKGPAAERLGE |
Ga0210407_100008061 | 3300020579 | Soil | MSQIGSFALLLALGLSAYSFLAGLLALFNKDAASARL |
Ga0210395_105284573 | 3300020582 | Soil | MSQIGSFALLLALALCTYSFLAGLLALIIKGVGSERL |
Ga0210405_112688812 | 3300021171 | Soil | MSQIGSFALLLALALCAYSFLAGILALINKGPGSE |
Ga0210408_106966252 | 3300021178 | Soil | MSQIGSFALLLALALCAYSFLAGLLALVIKGPGAGRLGETARR |
Ga0210408_115055442 | 3300021178 | Soil | MSQIGSFALLLGLALCAYSFLAGLLALVINGPGSGRLGET |
Ga0210388_107624372 | 3300021181 | Soil | MAEIGSFALLLALGLSVYSFLAGIIALIKGDGSERLGETAPAPA |
Ga0210394_106938443 | 3300021420 | Soil | MSQIGSFALLLGLALCAYSFLAGLLALVINGPGSGRQTCEE |
Ga0210384_106060811 | 3300021432 | Soil | MSQIGSFALLLALALSAYSFLAGALALARPGPGSERLGET |
Ga0182009_104022403 | 3300021445 | Soil | MSQLGSYALLLALALSAYSFIGGLAALVWPGAQSERLGETARRAGIAVF |
Ga0210402_109906102 | 3300021478 | Soil | MAAIGDFALLLALALSIYSFLFGLLALILPGPGWQRVGET |
Ga0242671_10705271 | 3300022714 | Soil | MPIIGSFALQLALALTAYSFLAGILALAWEGPFWTRLGETARRAGIASFAIV |
Ga0224564_11344462 | 3300024271 | Soil | MSQIGSFALLLALALCAYSFLAGILGLVIKSPGAGRLGETAR |
Ga0208192_10413602 | 3300025477 | Peatland | MSQIGSFALLIALDLSAYSFLAGFLALRDKGAAWARLGETARRA |
Ga0207684_101033934 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQIGSFALLLALALSAYSFLAGLLALVRPGAGSERLGETAR |
Ga0207646_106246513 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQIGSFALLLALALSAYSFLAGLLALVRPGAGSERLGE |
Ga0207668_120324401 | 3300025972 | Switchgrass Rhizosphere | MSQVGSFALLIALALSVYSFLAGIFALIRRGPQSER |
Ga0209880_10308911 | 3300026271 | Soil | MSQIGSFALLLALGLSAYSFLAGFLALFSRDAASARLGETA |
Ga0257181_10717561 | 3300026499 | Soil | MSQIGSFALLLGLALSAYSFLAGALALARPGPGSE |
Ga0179587_101996074 | 3300026557 | Vadose Zone Soil | MAQIGSYVLLLALALSAYSFLAGTIALVRRDHNSERMGETARRA |
Ga0208365_10326113 | 3300027070 | Forest Soil | MSQIGSFALLLALALSAYSFLAGLFALARPGAGSDRL |
Ga0209219_10140711 | 3300027565 | Forest Soil | MSQIGSFALLLALGLSAYSFLAGLLALFSKDAASARL |
Ga0209117_11214791 | 3300027645 | Forest Soil | MSQIGSFALLLALGLSAYSFLAGFLSLFGKDAASARLGETARRA |
Ga0209011_11927682 | 3300027678 | Forest Soil | MSQIGSFALLLALALSAYSFLAGVLALARPGPGSERL |
Ga0208696_11273521 | 3300027696 | Peatlands Soil | MSQIGSFALLLALGLSAYSFLAGFLALFGKDAASARLGETARR |
Ga0209446_10919312 | 3300027698 | Bog Forest Soil | MSTIGAWALMLALGLSAYSFLAGLVALFGKGAASARLGETARRAGIA |
Ga0209038_102625631 | 3300027737 | Bog Forest Soil | MSQIGSFALLLALGLSSYSFLAGFLALFGKSAASARLG |
Ga0209517_104138812 | 3300027854 | Peatlands Soil | MSQIGSFALLLALGLSAYCFLAGFVALFRRDAASARLGETA |
Ga0209488_100699591 | 3300027903 | Vadose Zone Soil | MSQIGSFALLLGLALSAYSFLAGALALARPGPGSERLG |
Ga0209488_106443811 | 3300027903 | Vadose Zone Soil | MSQIGSFALLLALGLSAYSFLAGLLALFRKDAASARLG |
Ga0209415_100872481 | 3300027905 | Peatlands Soil | MSQIGSFALMLALGLSAYSFLAGLVALFGKDAASARL |
Ga0209698_110202261 | 3300027911 | Watersheds | MSQIGSFALLLALGLSAYSFLAGLLSLFGKDASSARLGETARRA |
Ga0302153_101964691 | 3300028574 | Bog | MSQIGSFALMAALVLSAYSFLAGLLSLFKKDASSARLGETA |
Ga0302303_102141191 | 3300028776 | Palsa | MLALGLSAYSFLAGLVALFGKDAASARLGETARRAGIAT |
Ga0302278_104296141 | 3300028866 | Bog | MSEIGSFALMAALGLSAYSFLAGLLSLFNKDAASAR |
Ga0222749_104697392 | 3300029636 | Soil | MSQIGSFALLLALGLSAYSFLAGLLALFHKDAASARLGETAR |
Ga0311361_101935211 | 3300029911 | Bog | MAALGLSAYSFLAGLLSLFNKDAASARLGETARRAGIATFAAVLL |
Ga0302141_10670781 | 3300029919 | Bog | MSQIGSFALMAALVLSAYSFLAGLLSLFKKDASSARLGETARRAGIATF |
Ga0302175_100748292 | 3300030014 | Fen | MSLIGSYALLFALALSAYSFLGGFAALAFPGAGSERLGETARRAGIAIFAV |
Ga0311349_111626262 | 3300030294 | Fen | MSQLGSFSLLLALGLSVYSFLAGAAALFLKGPASARLAETARRA |
Ga0311349_120287542 | 3300030294 | Fen | MAQIGSFALLLALALSIYSFGAGILALIYQDQGSERL |
Ga0311353_108169402 | 3300030399 | Palsa | MSQIGSFALLLALGLSSYSFLAGFLALFGNDAAAARLGE |
Ga0316363_102275772 | 3300030659 | Peatlands Soil | MSQIGSFALLLALALCAYSFLAGLLALVIKGPGSGRLGETARR |
Ga0073994_118268691 | 3300030991 | Soil | MSLIGSFALLLALALSAYSFLAGILALSRNGVGSE |
Ga0265340_105611121 | 3300031247 | Rhizosphere | MAQIGSFALLLALVLSAYSFGAGLLALFGRDAVSA |
Ga0265331_101965741 | 3300031250 | Rhizosphere | MSQIGSFALLLALGLSSYSFLAGLFALFGKDAASARL |
Ga0311364_104870963 | 3300031521 | Fen | MSLIGSYALLFALALSAYSFLGGFAALAFPGAGSERLGETA |
Ga0302326_105660023 | 3300031525 | Palsa | MSQIGSFALLLALALSSYSFLAGIVSLTGKGSGRARLGETAR |
Ga0307468_1001674221 | 3300031740 | Hardwood Forest Soil | MSPIGSFALLLALALSAYSFLAGALALARPGPGSERLGE |
Ga0307478_101021244 | 3300031823 | Hardwood Forest Soil | MAAIGDFALLLALALSVYSFLFGLLALVLPGPGWE |
Ga0302322_1027263921 | 3300031902 | Fen | MSQIGSFALLLALGLSSYSFLAGLLALFGRDAGSMRL |
Ga0307470_119031081 | 3300032174 | Hardwood Forest Soil | MSQIGSFALLLALALSGYSFLAGALALAQPGPGSER |
Ga0307472_1015214721 | 3300032205 | Hardwood Forest Soil | MPLIGSFALLFALALSAYSFLGGLAALVLPGASSARLGETARRAGI |
Ga0335079_102607491 | 3300032783 | Soil | MSQIGSFALLLALALSVYAFLAGIVSLAGLFGSDSDRLG |
Ga0335079_120001092 | 3300032783 | Soil | MSEIGSFALLLALALCVYSFLAGLLALVRESNDASARLSE |
Ga0335080_124112081 | 3300032828 | Soil | MAQIGSFALLLALGLAVYSFGAGLLSLFGRDAASARLGETARRAGI |
Ga0335069_110447193 | 3300032893 | Soil | MSQIGSFALLLALGLSSYSFAAGLLALFGRDAGSLRLGETARRAGIA |
Ga0335084_119073762 | 3300033004 | Soil | MSQIGSFALLLALCLAGYSFLAGVLALFQRDAGSLRLGET |
Ga0326728_103254141 | 3300033402 | Peat Soil | MSLIGSFALLLALGLSAYSFLAGFLALFGKDAASARL |
⦗Top⦘ |