NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F041970

Metagenome / Metatranscriptome Family F041970

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F041970
Family Type Metagenome / Metatranscriptome
Number of Sequences 159
Average Sequence Length 49 residues
Representative Sequence MFDNLVESSSHKDDITRKGSFIGITALIYGVLLVTFFVAGIYWYDARLGD
Number of Associated Samples 136
Number of Associated Scaffolds 159

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.37 %
% of genes near scaffold ends (potentially truncated) 97.48 %
% of genes from short scaffolds (< 2000 bps) 94.97 %
Associated GOLD sequencing projects 129
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.226 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.836 % of family members)
Environment Ontology (ENVO) Unclassified
(41.509 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(61.006 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 60.26%    β-sheet: 0.00%    Coil/Unstructured: 39.74%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 159 Family Scaffolds
PF02355SecD_SecF 36.48
PF07549Sec_GG 3.77
PF03401TctC 0.63
PF14714KH_dom-like 0.63
PF03544TonB_C 0.63
PF02699YajC 0.63

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 159 Family Scaffolds
COG0341Preprotein translocase subunit SecFIntracellular trafficking, secretion, and vesicular transport [U] 40.25
COG0342Preprotein translocase subunit SecDIntracellular trafficking, secretion, and vesicular transport [U] 40.25
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.63
COG1862Protein translocase subunit YajCIntracellular trafficking, secretion, and vesicular transport [U] 0.63
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.63


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.23 %
UnclassifiedrootN/A3.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2209111006|2214880213All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes579Open in IMG/M
2228664021|ICCgaii200_c0918399All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium721Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104937939All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1022304All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium689Open in IMG/M
3300000891|JGI10214J12806_12634782All Organisms → cellular organisms → Bacteria → Acidobacteria843Open in IMG/M
3300000955|JGI1027J12803_109637772Not Available939Open in IMG/M
3300000956|JGI10216J12902_109665736Not Available563Open in IMG/M
3300001139|JGI10220J13317_10411388All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium668Open in IMG/M
3300004156|Ga0062589_100694934All Organisms → cellular organisms → Bacteria → Acidobacteria902Open in IMG/M
3300004157|Ga0062590_102108027All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300004463|Ga0063356_103123594All Organisms → cellular organisms → Bacteria → Acidobacteria713Open in IMG/M
3300004798|Ga0058859_11729974All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300005293|Ga0065715_11060011All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum513Open in IMG/M
3300005328|Ga0070676_10462888All Organisms → cellular organisms → Bacteria → Acidobacteria894Open in IMG/M
3300005330|Ga0070690_100862970All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium706Open in IMG/M
3300005333|Ga0070677_10355813All Organisms → cellular organisms → Bacteria → Acidobacteria760Open in IMG/M
3300005334|Ga0068869_101291354All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium644Open in IMG/M
3300005335|Ga0070666_10647315All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium773Open in IMG/M
3300005335|Ga0070666_11398736All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300005339|Ga0070660_101071733All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium682Open in IMG/M
3300005340|Ga0070689_101049996All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium727Open in IMG/M
3300005340|Ga0070689_101445577All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300005341|Ga0070691_10523851All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium689Open in IMG/M
3300005345|Ga0070692_10179701All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum1226Open in IMG/M
3300005345|Ga0070692_10352765All Organisms → cellular organisms → Bacteria → Acidobacteria914Open in IMG/M
3300005345|Ga0070692_10604336All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium726Open in IMG/M
3300005353|Ga0070669_101461819All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300005438|Ga0070701_10676067All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300005440|Ga0070705_100235661All Organisms → cellular organisms → Bacteria → Acidobacteria1276Open in IMG/M
3300005440|Ga0070705_100820387Not Available742Open in IMG/M
3300005441|Ga0070700_100377101All Organisms → cellular organisms → Bacteria → Acidobacteria1060Open in IMG/M
3300005444|Ga0070694_101773159All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300005535|Ga0070684_101284104All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium689Open in IMG/M
3300005536|Ga0070697_101373045All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300005546|Ga0070696_100238818All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1370Open in IMG/M
3300005547|Ga0070693_100389378All Organisms → cellular organisms → Bacteria → Acidobacteria963Open in IMG/M
3300005547|Ga0070693_100756038All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium717Open in IMG/M
3300005564|Ga0070664_100348395All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1347Open in IMG/M
3300005564|Ga0070664_101919434All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300005577|Ga0068857_100006124All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum10278Open in IMG/M
3300005577|Ga0068857_102494968All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300005616|Ga0068852_101108240All Organisms → cellular organisms → Bacteria → Acidobacteria812Open in IMG/M
3300005719|Ga0068861_102085183All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300005842|Ga0068858_100071099All Organisms → cellular organisms → Bacteria → Acidobacteria3226Open in IMG/M
3300005842|Ga0068858_100088733All Organisms → cellular organisms → Bacteria → Acidobacteria2877Open in IMG/M
3300005844|Ga0068862_101904949All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300005844|Ga0068862_102563593All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300005844|Ga0068862_102793818All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300006173|Ga0070716_100285624All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum1141Open in IMG/M
3300006791|Ga0066653_10606372All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300006804|Ga0079221_11224528All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300006806|Ga0079220_10457245All Organisms → cellular organisms → Bacteria → Acidobacteria856Open in IMG/M
3300006844|Ga0075428_100516285All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1278Open in IMG/M
3300006854|Ga0075425_101912289All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium665Open in IMG/M
3300006954|Ga0079219_11014193All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium690Open in IMG/M
3300006969|Ga0075419_10672053All Organisms → cellular organisms → Bacteria → Acidobacteria732Open in IMG/M
3300006969|Ga0075419_10753739All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium694Open in IMG/M
3300009100|Ga0075418_11913474All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes646Open in IMG/M
3300009148|Ga0105243_12742578Not Available533Open in IMG/M
3300009176|Ga0105242_12843832All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes534Open in IMG/M
3300009551|Ga0105238_12144759All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes593Open in IMG/M
3300009840|Ga0126313_11067257All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium663Open in IMG/M
3300010038|Ga0126315_10981275All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes565Open in IMG/M
3300010038|Ga0126315_11159953All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes524Open in IMG/M
3300010041|Ga0126312_10425177All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes946Open in IMG/M
3300010044|Ga0126310_10649502All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes793Open in IMG/M
3300010046|Ga0126384_12414524All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes509Open in IMG/M
3300010047|Ga0126382_10626243All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes890Open in IMG/M
3300010159|Ga0099796_10214786All Organisms → cellular organisms → Bacteria → Acidobacteria786Open in IMG/M
3300010373|Ga0134128_11183116All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes844Open in IMG/M
3300010373|Ga0134128_12995352All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes520Open in IMG/M
3300010399|Ga0134127_12574504All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes589Open in IMG/M
3300010400|Ga0134122_10823700All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes889Open in IMG/M
3300010400|Ga0134122_12163492All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300010401|Ga0134121_10892749All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes863Open in IMG/M
3300011119|Ga0105246_10468723All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1063Open in IMG/M
3300011119|Ga0105246_10503032All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1029Open in IMG/M
3300011436|Ga0137458_1209641All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes592Open in IMG/M
3300012022|Ga0120191_10101965All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300012045|Ga0136623_10001495All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes8047Open in IMG/M
3300012210|Ga0137378_10725088All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes905Open in IMG/M
3300012212|Ga0150985_100603430All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1371Open in IMG/M
3300012684|Ga0136614_10024489All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes4459Open in IMG/M
3300012899|Ga0157299_10225934All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes579Open in IMG/M
3300012899|Ga0157299_10267797All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes550Open in IMG/M
3300012907|Ga0157283_10069602All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes864Open in IMG/M
3300012910|Ga0157308_10322864All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes573Open in IMG/M
3300012917|Ga0137395_10603456All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes793Open in IMG/M
3300012930|Ga0137407_10135368All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2159Open in IMG/M
3300012951|Ga0164300_10362649All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes782Open in IMG/M
3300012955|Ga0164298_11642853All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes508Open in IMG/M
3300012958|Ga0164299_10684143All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes715Open in IMG/M
3300012961|Ga0164302_10212388All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1200Open in IMG/M
3300012987|Ga0164307_11403722All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes588Open in IMG/M
3300013102|Ga0157371_11103729All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes608Open in IMG/M
3300013306|Ga0163162_12184713All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300013754|Ga0120183_1012841All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300014325|Ga0163163_10776523All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1021Open in IMG/M
3300014326|Ga0157380_12507493All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes581Open in IMG/M
3300014487|Ga0182000_10255622All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium705Open in IMG/M
3300014969|Ga0157376_10171069All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1978Open in IMG/M
3300015261|Ga0182006_1278117All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes549Open in IMG/M
3300015262|Ga0182007_10278428All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes608Open in IMG/M
3300015372|Ga0132256_102072190All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium675Open in IMG/M
3300015373|Ga0132257_101857301All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes775Open in IMG/M
3300015374|Ga0132255_103949041All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium630Open in IMG/M
3300018051|Ga0184620_10333271All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes514Open in IMG/M
3300018067|Ga0184611_1205323All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium701Open in IMG/M
3300018422|Ga0190265_11685886All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes744Open in IMG/M
3300018422|Ga0190265_13769244All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes505Open in IMG/M
3300018466|Ga0190268_10903085All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium687Open in IMG/M
3300018469|Ga0190270_11089759All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes831Open in IMG/M
3300018476|Ga0190274_12758133All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300018476|Ga0190274_13143300All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes555Open in IMG/M
3300018920|Ga0190273_10534109All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes867Open in IMG/M
3300019362|Ga0173479_10036990All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1522Open in IMG/M
3300019377|Ga0190264_10605183All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes783Open in IMG/M
3300020002|Ga0193730_1180082All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300020004|Ga0193755_1216436All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes536Open in IMG/M
3300021445|Ga0182009_10474573All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes656Open in IMG/M
3300025321|Ga0207656_10279544All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes823Open in IMG/M
3300025325|Ga0209341_10075408All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2852Open in IMG/M
3300025893|Ga0207682_10293495All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes761Open in IMG/M
3300025893|Ga0207682_10330303All Organisms → cellular organisms → Bacteria → Acidobacteria717Open in IMG/M
3300025903|Ga0207680_10772848All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300025903|Ga0207680_11362778All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes504Open in IMG/M
3300025907|Ga0207645_10090410All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1968Open in IMG/M
3300025907|Ga0207645_10606910All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes743Open in IMG/M
3300025917|Ga0207660_10502422All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes984Open in IMG/M
3300025919|Ga0207657_10609685All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes851Open in IMG/M
3300025920|Ga0207649_10546849All Organisms → cellular organisms → Bacteria → Acidobacteria885Open in IMG/M
3300025921|Ga0207652_11301557All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes629Open in IMG/M
3300025925|Ga0207650_11659459All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300025931|Ga0207644_10926205All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes731Open in IMG/M
3300025940|Ga0207691_11287005All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes604Open in IMG/M
3300025961|Ga0207712_11274597All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300025972|Ga0207668_10920678All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes779Open in IMG/M
3300025981|Ga0207640_10517812All Organisms → cellular organisms → Bacteria → Acidobacteria996Open in IMG/M
3300026023|Ga0207677_11884741All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes555Open in IMG/M
3300026095|Ga0207676_12137057All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes558Open in IMG/M
3300026118|Ga0207675_100636454All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1072Open in IMG/M
3300027462|Ga0210000_1075248All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300027761|Ga0209462_10069950All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium739Open in IMG/M
3300027846|Ga0209180_10324561All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes880Open in IMG/M
3300028381|Ga0268264_11532719All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes677Open in IMG/M
3300031456|Ga0307513_10634194All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes776Open in IMG/M
3300031740|Ga0307468_102393875Not Available515Open in IMG/M
3300031847|Ga0310907_10283921All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes827Open in IMG/M
3300031858|Ga0310892_11011467All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes586Open in IMG/M
3300031901|Ga0307406_10207220All Organisms → cellular organisms → Bacteria → Acidobacteria1448Open in IMG/M
3300031908|Ga0310900_10418604All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1022Open in IMG/M
3300031908|Ga0310900_11458746All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300031943|Ga0310885_10868309All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300033412|Ga0310810_10754357All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes891Open in IMG/M
3300033475|Ga0310811_10970700All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes750Open in IMG/M
3300034672|Ga0314797_120730All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300034817|Ga0373948_0018547All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1308Open in IMG/M
3300034965|Ga0370497_0196671All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes522Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere4.40%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.77%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.14%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.14%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.14%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.14%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.14%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.52%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.89%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.26%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.26%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.26%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial1.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.26%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.26%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.26%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.26%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.63%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.63%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.63%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.63%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.63%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.63%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.63%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.63%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.63%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.63%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2209111006Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0Host-AssociatedOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000596Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TCEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001139Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soilEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013754Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep2EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015261Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027462Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027761Agave microbial communities from Guanajuato, Mexico - As.Sf.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034672Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M
3300034965Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
22139321782209111006Arabidopsis RhizosphereMFDNLVESSSHKDDISRKGSFVVATALIYGVLLLAFFVAGIYWYDNHLGEMELELTTL
ICCgaii200_091839922228664021SoilMFDNLVESSSHKDDISRKGSFVAATALIYAVLMVAFFVAGIYWYDNHLGQMELE
INPhiseqgaiiFebDRAFT_10493793923300000364SoilMFENLVESTTHKDDLARKGSFILATLVVYGVLGLAFFIAGIFWYDAHLENQNLEL
KanNP_Total_noBrdU_T14TCDRAFT_102230413300000596SoilMFDNLVESSSHKADIERKGSFILGTAVIYGVLLVGFFVAGIYWYDNKL
JGI10214J12806_1263478213300000891SoilMFDNLVESNSHKDDISRKGSFIIVTTIVYAVLGLAFFVAGIYWYDAHLENQNLDLI
JGI1027J12803_10963777213300000955SoilMFDNLVESSSHKDDITRKGSFIGVTALIYGVLLVG
JGI10216J12902_10966573613300000956SoilMFDNLVESSSHKEDITRKGSFIGITLLIYAVLLPG
JGI10220J13317_1041138823300001139SoilMFDNLVESNSHKDDISRKGSFIIVTTIVYAVLGLAFFVAGIYWYDAHLENQNLDLITLVAPV
Ga0062589_10069493413300004156SoilMFDNLVESNSHKGDISRKGSFILVTSVVYAVLGLAFFVAGIYWYDAHLENQSLDLITLVAPV
Ga0062590_10210802713300004157SoilMFDNLVESNSHKDDISRKGSFIIVTTIVYAVLGLAFFVAGIYWYDAHLENQNLDLITLVA
Ga0063356_10312359413300004463Arabidopsis Thaliana RhizosphereMFDNLVESSSHKDDISRKGSFVAATALIYAVLMVAFFVAGIY
Ga0058859_1172997413300004798Host-AssociatedMFDNLVESSSHKDDITRKGSFIGITFLIYGVLILTFFIAGIYWYDARLGDMELELTTLVAPV
Ga0065715_1106001113300005293Miscanthus RhizosphereMFDNLVESSSHKDDLTRKGSFIGITLAVYVVLIVVFVVAGILMYDAHLTAQDLELTTL
Ga0070676_1046288813300005328Miscanthus RhizosphereMFDNLVESSSHKDDISRKGSFVAATALIYGVLMLAFFVAGIY
Ga0070690_10086297013300005330Switchgrass RhizosphereMFDNLVESSSHKDDITRKSSFIGITALIYGVLLVTFFVAGIYW
Ga0070677_1035581323300005333Miscanthus RhizosphereMFDNLVESSSHKKDIERKGSFIIVTAVIYLVLLVAFFVAG
Ga0068869_10129135413300005334Miscanthus RhizosphereMFDNLVESSSHKDDITRKGSFVGITALIYAVLLVTFFVAGIYWYDARLGDMELEL
Ga0070666_1064731523300005335Switchgrass RhizosphereMFDNLVESSSHKDDISRKGSFVAATALIYAVLMVAFFVAGIYWYDNHL
Ga0070666_1139873613300005335Switchgrass RhizosphereMFDNLVESSSHKDDITRKGSFVGITALIYTVLLVTFFVAGIYWYDARLGDMELEL
Ga0070660_10107173313300005339Corn RhizosphereMFDNLVESSSHKDDLTRKGSFIGITFLIYGVLILTFFIAGIYWYDARL
Ga0070689_10104999623300005340Switchgrass RhizosphereMFDNLVESSSHKDDITRKGSFVGITALIYAVLLVTFFVAGIYWYDARLGDMELELT
Ga0070689_10144557723300005340Switchgrass RhizosphereMFDNLVESSSHKDDLTRKGSFIGITLVVYAVLISAFVIAGIFLYDAHLSEMELELTTLVA
Ga0070691_1052385113300005341Corn, Switchgrass And Miscanthus RhizosphereMFDNLVESSSHKDDITRKGSFIGITALIYGVLLVTFFIAGIYW
Ga0070692_1017970123300005345Corn, Switchgrass And Miscanthus RhizosphereMFDNLVESSSHKDDIARKGSFIGVTLAIYAVLIAVFFVAGIYLYDAHLSTLDLELTTLV
Ga0070692_1035276523300005345Corn, Switchgrass And Miscanthus RhizosphereMFDNLVESSSHKSDLTRKGSFIGITALIYGVLLVVFFVAGIYLYDAHLADME
Ga0070692_1060433623300005345Corn, Switchgrass And Miscanthus RhizosphereMFDNLVESSSHKDDITRKGSFIGVTALIYGVLLVTFFVAGIYWYDAKLGEMELELT
Ga0070669_10146181913300005353Switchgrass RhizosphereMFDNLVESSSHKDDITRKGSFIGITAVIYGVLILAFFVVGIFWYDAK
Ga0070701_1067606713300005438Corn, Switchgrass And Miscanthus RhizosphereMFDNLVESSSHKDDITRKGSFIGITALIYGVLLVTFFVAGIYWYDARLGDM
Ga0070705_10023566123300005440Corn, Switchgrass And Miscanthus RhizosphereMFDNLVESSSHKDDLTRKGSFIGITALIYGVLLLAFFVAG
Ga0070705_10082038713300005440Corn, Switchgrass And Miscanthus RhizosphereMFDNLVESSSHKNDLTRKGSFIGVTLAIYFVGILTFFVVGIF
Ga0070700_10037710133300005441Corn, Switchgrass And Miscanthus RhizosphereMFDNLVESSSHKSDLTRKGSFIGITALIYGVLLVVFFVAGIYLYDAHLADMELE
Ga0070694_10177315913300005444Corn, Switchgrass And Miscanthus RhizosphereMFDNLVESSSHKDDITRKGSFIGITFAVYAVLIATFFIAGIYLYDAHLATLDL
Ga0070684_10128410413300005535Corn RhizosphereMFENLVESNSHKDDIARKGSFIGVTLLIYGVLLLTFFVAGIYWYDNHLD
Ga0070697_10137304513300005536Corn, Switchgrass And Miscanthus RhizosphereMFDNLVESSSHKDDITRKGSFIGITMAIYVVLIGVFFVAGIYLYDAH
Ga0070696_10023881823300005546Corn, Switchgrass And Miscanthus RhizosphereMFENLVESTSHKDDISRKGSFILVTTLVYLVLGVAFFVAGVYWYDNHLGELELE
Ga0070693_10038937813300005547Corn, Switchgrass And Miscanthus RhizosphereMFDNLVESSSHKDDITRKGSFIGVTLAIYAVLIGVFFVAGIYLYDAHLSTLDLE
Ga0070693_10075603813300005547Corn, Switchgrass And Miscanthus RhizosphereMFDNLVESSSHKDDLTRKGSFIGITLAIYVVLIAVFVVAGILMYDAHLTAQDLELTTLVA
Ga0070664_10034839523300005564Corn RhizosphereMFDNLVESSSHKDDITRKGSFIGITALIYGVLLVTFFIAGIYWYDARLGDMEL
Ga0070664_10191943423300005564Corn RhizosphereMFDNLVESSSHKDDLTRKGSFIGITLVVYAVLISAFVIAGIFLYDAHLS
Ga0068857_10000612413300005577Corn RhizosphereMFDNLVESSSHKDDISRKGSFVAATALIYAVLMVAFFVAGIYWYD
Ga0068857_10249496813300005577Corn RhizosphereMFENLVESSSHKDDIARKGSFIGITALIYGLLLVGFFVAGIYWYDARLGDMELELTTL
Ga0068852_10110824013300005616Corn RhizosphereMFDNLVESSSHKQDLSRKGSFIVGTTIIYAVLLLTFFVAGIYWYDAKLGEM
Ga0068861_10208518323300005719Switchgrass RhizosphereMFDNLVESSSHKQDLSRKGSFIVGTTIIYAVLLLTFFVAGIYWYDAKLGEMELELTTL
Ga0068858_10007109913300005842Switchgrass RhizosphereMFDNLVESSSHKDDITRKSSFIGITALIYGVLLVTFFVAGIYWYD
Ga0068858_10008873313300005842Switchgrass RhizosphereMFDNLVESSSHKKDIERKGSFIVGTAVIYGVLLLTFFVAGIYWYDNKLGEMELELTTL
Ga0068862_10190494913300005844Switchgrass RhizosphereMFDNLVESSSHKQDLSRKGSFIVGTTIIYAVLLLTF
Ga0068862_10256359313300005844Switchgrass RhizosphereMFDNLVESSSHKDDITRKGSFVGITALIYAVLLVTFFVAGIYWYDARLGDMELELTTL
Ga0068862_10279381813300005844Switchgrass RhizosphereMFDNLVESSSHKDDITRKSSFIGITALIYGVLLVTFFVAGIYWYDARLGDMELELTTLVA
Ga0070716_10028562413300006173Corn, Switchgrass And Miscanthus RhizosphereMFDNLVESSSHKDDLTRKGSFIGITLLIYGVLLVGFFVAGILWYDNHLSEQEYELTTLVA
Ga0066653_1060637223300006791SoilMFDNLVESSSHKDDITRKGSFIGITLLVYGVLFLAFFVAGSYWYDAHLEAQGLELTTLVA
Ga0079221_1122452823300006804Agricultural SoilMFDNLVESSSHRDDIARKGSFIGITALVYGVLLLAFFVAGIYWYDAHLEAQDLELTTLV
Ga0079220_1045724513300006806Agricultural SoilMFDNLVESSSHKDDIARKGSFIGVTLLVYAVLLLAFFVAGIYWYDNHLDQMELE
Ga0075428_10051628513300006844Populus RhizosphereMFDNLVESSSHKKDIERKGSFIIVTAVIYVVLLVAFFVAGIYWYDNHLGEMELEL
Ga0075425_10191228913300006854Populus RhizosphereMFENLVESNSHKDDIARKGSFIGVTLLIYGVLLLTFFVAGIYWYDNHLDQMELELTT
Ga0079217_1017096913300006876Agricultural SoilMFDNLVESSSHKQDISRKGSFVLVTALIYGVLLGGFFVAGILWYDAHLAEQELELTTLVAPVRVPQQQKEPEQKQ
Ga0079219_1101419313300006954Agricultural SoilMFDNLVESNSHKDDIARKGSFIGVTLLVYAVLLLAFFVAGIYWYDNHLDQMELELT
Ga0075419_1067205313300006969Populus RhizosphereMFDNLVESSSHKDDIARKGSFIGVTALIYGVLIVAFFVV
Ga0075419_1075373913300006969Populus RhizosphereMFDNLVESSSHKKDIERKGSFIIVTAFIYLVLVVSVFVARIYW*
Ga0075418_1191347413300009100Populus RhizosphereMFDNLVESSSHKSDISRKGSFVAVTATIYLVLMAAFFIAGIYWYDTHL
Ga0105243_1274257823300009148Miscanthus RhizosphereMFDNLVESSSHKSDISRKGSFVAVTALIYGVLLAGF
Ga0105242_1284383213300009176Miscanthus RhizosphereMFDNLVESSSHKDDISRKGSFVAATALIYVVLLVAFFVAGIYWYDNHL
Ga0105238_1214475913300009551Corn RhizosphereMFDNLVESSSHKDDITRKSSFIGITALIYGVLLVTFFVAGIYWYDARLGDMELEL
Ga0126313_1106725713300009840Serpentine SoilMFDNLVESSSHKDDIARKGSFIGITALIYGVLLVAF
Ga0126315_1098127513300010038Serpentine SoilMFDNLVESSSHKDDITRKSSFIGITALIYGVLLLTFFVAGIYWYDARLGD
Ga0126315_1115995313300010038Serpentine SoilMFDNLVESSSHKDDIARKGSFVGITALIYAVLLVTFFVAGIYWYDARLGDMELE
Ga0126312_1042517713300010041Serpentine SoilMFDNLVESSSHKDDIARKGSFIGITLLVYGVLITAFVIAGILWYDAR
Ga0126310_1064950223300010044Serpentine SoilMFDNLVESSSHKNDISRKGSFILVTALIYGVLIGVFVIAGIVFYDANMTPSDLELTTLIAPVPV
Ga0126384_1241452413300010046Tropical Forest SoilMFDNLVESSSHKDDITRKGSFIGITALIYGVLLVGFFVAGILWYDNHLS
Ga0126382_1062624313300010047Tropical Forest SoilMFENLVESSSHKDDIARKGSFIGVTALIYGVLLVAFFVVGIYLYDNHLDQMEL
Ga0099796_1021478623300010159Vadose Zone SoilMFDNLVESNSHKDDISRKGSFVVITLLVYTVLGVAFFVAG
Ga0134128_1118311613300010373Terrestrial SoilMFDNLVESSSHKDDIARKGSFIGVTALIYGVLMLAFFVAGIYWYDAHLDEQTLELTTLVA
Ga0134128_1299535213300010373Terrestrial SoilMFDNLVESSSHKDDIARKGSFIGITALIYGVLLVTFFV
Ga0134127_1257450413300010399Terrestrial SoilMFDNLVESSSHKQDISRKGSFIVVTALIYGVLLLGFFVAG
Ga0134122_1082370023300010400Terrestrial SoilMFENLVESSPHKDDLTRKGSFIGITMAIYVVLIAVFFVAGIYLYD
Ga0134122_1216349223300010400Terrestrial SoilMFDNLVESSSHKDDITRKGSFIGITMAIYVVLIGVFFVAGIYLYDAHLST
Ga0134121_1089274913300010401Terrestrial SoilMFDNLVESSSHKKDIERKGSFIVGTAVIYGVLLLTIFVAGIYWYDNKLGEMELELTTLVA
Ga0105246_1046872313300011119Miscanthus RhizosphereMFDNLVESSSHKDDLTRKGSFIGITLAIYLVLIAVFFVAGIYLYDAHLAPSDLELTTLVA
Ga0105246_1050303213300011119Miscanthus RhizosphereMFDNLVESSSHKDDLTRKGSFIGITALIYGVLLLAFFVAGIIWYDNHLSEQELELTTLVA
Ga0137458_120964113300011436SoilMFDNLVESNSHKDDISRKGSFILVTIAVYTVLGTIFFVAGIYMYDAHMENQNQDMITLVAPVN
Ga0120191_1010196523300012022TerrestrialMFDNLVESSSHKDDISRKGSFILVTTVVYLVLGVAFFVAGIYWY
Ga0136623_1000149593300012045Polar Desert SandMFENLVESNSHKGDLSRKGSFILVTTAIYFVLGLAFFIVGIYWYDAHLENQNLD
Ga0137378_1072508813300012210Vadose Zone SoilMFDNLVESSSHKNDISRKGSFVAITALIYLVLGVAFFVAGVYWYDNHLGEMELELTTLVA
Ga0150985_10060343033300012212Avena Fatua RhizosphereMFDNLVESSSHKDDLARKGSFIGATVAIYAVVLTALGIGSIFWYDAQLEN*
Ga0136614_1002448913300012684Polar Desert SandMFDNLVESSSHKDDISRKGTFILVTVAVYAVLGIAFFVAG
Ga0157299_1022593413300012899SoilMFDNLVESSSHKDDITRKGSFIGITALIYGVLLVTFFIAGIYWYDARLGDMELE
Ga0157299_1026779713300012899SoilMFDNLVESSSHKDDITRKGSFIGITFLIYGVLILTF
Ga0157283_1006960213300012907SoilMFDNLVESSSHRDDITRKGSFIGITFAIYAVLITTFFVAGIFLYDAHL
Ga0157308_1032286413300012910SoilLAPEVEDKKSMFDNLVESSSHKDDLSRKGSFVVATALIYGVLLLAFFVAGIYWYDNHLG
Ga0137395_1060345613300012917Vadose Zone SoilMFDNLVESSSHKDDISRKGSFVVITALIYAVLGVAFFVAGVYWYDNH
Ga0137407_1013536813300012930Vadose Zone SoilMFENLVESTSHKDDLSRKGSFILVTTLIYLVLGVAFFVAGVYWYENHLGEIE
Ga0164300_1036264923300012951SoilMFDNLVESSSHKDDLTRKGSFIGIPALIYGVLLVAFFVAGIIWYDNHLSVQ
Ga0164298_1164285313300012955SoilMFDNLVESSSHKDDISRKGSFVAATALIYGVLMLAFFVAGIYWYDNHLGEMELELTTLVAPV
Ga0164299_1068414313300012958SoilMFDNLVESSSHKDDLTRKGSFIGITLLIYGVLLVGFFVAGILWYDNHL
Ga0164302_1021238823300012961SoilMFDNLVESSSHKKDIERKGSFIVGTAVIYGVLLLTFFIAGIYWYDN
Ga0164307_1140372213300012987SoilMFDNLVESSSHKDDISRKGSFVAATALIYGVLMLAFFVAGIYW
Ga0157371_1110372913300013102Corn RhizosphereMFDNLVESSSHKDDITRKGSFIGITALTYGVLLVTFFVAGIYWYDARLGDMELEL
Ga0163162_1218471313300013306Switchgrass RhizosphereMFDNLVESSSHKSDLTRKGSFIGITALIYGVLLVVFFVAGIYLYDAHLADMEL
Ga0120183_101284113300013754TerrestrialMFDNLVESSSHKDDITRKGSFVGITALIYLVLMVAFFVAGIYWYDAKLGEMELELT
Ga0163163_1077652323300014325Switchgrass RhizosphereMFDNLVESSSHKDDIARKGSFIGITFLIYGVLIVTFFIAGIYWYDARLGDMELELTTLVA
Ga0157380_1250749313300014326Switchgrass RhizosphereMFDNLVESSSHKDDISRKGSFIIATTVIYAVILVAF
Ga0182000_1025562223300014487SoilMFDNLVESSSHKDDIARKGSFIGVTFVVYLVLIVAFFIAGIYWYDARLGEMELE
Ga0157376_1017106943300014969Miscanthus RhizosphereMFDNLVESSSHKDDIARKGSFIGITALIYGVLMLAFFVAGIYWYDAHLDEQTLELTTLV
Ga0182006_127811713300015261RhizosphereMFDNLVESNSHKDDITRKGSFIGITALIYGVLLLTFFVAG
Ga0182007_1027842813300015262RhizosphereMFDNLVESSSHKDDITRKGSFIGVTLLVYAVLLLAFFVAGIYW
Ga0132256_10207219023300015372Arabidopsis RhizosphereMFDNLVESSSHKDDISRKGSFIGITALVYGVLILTFFVAGIYWYDAKLGE
Ga0132257_10185730123300015373Arabidopsis RhizosphereMFDNLVESSSHKDDLSRKGSFIVGTTVIYGVLLLTFFVAGIYWYDARLGNMELELTT
Ga0132255_10394904113300015374Arabidopsis RhizosphereMFDNLVESSSHKDDITRKGSFIGVTALIYGVLIVAFVVGGILWYDAKLGEMELELTT
Ga0184620_1033327113300018051Groundwater SedimentMFDNLVESSSHKDDLSRKGSFILVTAAIYLVLGLAFVIAGIYWYDNHLG
Ga0184611_120532323300018067Groundwater SedimentMFDNLVESSSHKDDISRKGSFVLVTLTIYVVLAVAFFIGGIYWYD
Ga0190265_1168588613300018422SoilMFDNLVESSSHKDDIARKGSFIGVTALIYGVLMISFFVAGIYWYDAHLGEMELEL
Ga0190265_1376924413300018422SoilMFDHLVESSSHKQDLSRKGSFIAVTAAIYGVLLVVFFVAGIYMYDAHLAPSDLELTTLIAPVPVPQ
Ga0190268_1090308513300018466SoilMFDNLVESSSHKDDITRKGSFIGVTALIYGVLIGAFIIGGILWYDAKLSEMELELTT
Ga0190270_1108975933300018469SoilMFDNLVESSSHKDDISRKGSFVLVTLAIYGVLIVAFAIAGIYWYDNHLGNM
Ga0190274_1275813313300018476SoilMFDNLVESSSHKDDITRKGSFIGVTALIYFVLMAAFF
Ga0190274_1314330013300018476SoilMFDNLVESSSHKQDISRKGSFIVATALIYGVLLVGFFVAGILWYDAH
Ga0190273_1053410913300018920SoilMFDNLVESNSHKGDISRKGSFIFVTSVVYLVLGLAFFVAGIYWYD
Ga0173479_1003699023300019362SoilMFDNLVESSSHKDDISRKGSFVAATALIYGVLMLAFFVAGIYWYDNHLGEMELELTTLVA
Ga0190264_1060518313300019377SoilMFDNLVESSSHKGDISRKGSFILVTSVVYAVLGLAFFVAGIYWYDAHLENQSLD
Ga0193730_118008213300020002SoilMFDNLVESSSHKNDISRKGSFVAITALIYAVLGVAF
Ga0193755_121643613300020004SoilMFDNLVESSSHKDDISRKGSFVIVTLIVYTVLGVAFFVAGIYWYDNHLAEQDLELTTLV
Ga0182009_1047457313300021445SoilMFDNLVESSSHKQDISRKGSFIIVTALVYGVVLVAFFVVGIL
Ga0207656_1027954413300025321Corn RhizosphereMFDNLVESSSHKDDISRKGSFVVATALIYGVLLLAFFV
Ga0209341_1007540813300025325SoilMFENLVESTSHKDDISRKGSFILVTTAVYAILGVAFFVGGIYWYDARLSELELE
Ga0207682_1029349523300025893Miscanthus RhizosphereMFDNLVESSSHKDDISRKGSFVAATALIYAVLMVAFFVAGIYWYDNHLGQM
Ga0207682_1033030323300025893Miscanthus RhizosphereMFDNLVESNSHKDDISRKGSFILATFAIYFVLGLAF
Ga0207680_1077284823300025903Switchgrass RhizosphereMFDNLVESSSHKDDISRKGSFVVATALIYGVLLLAFFVAGIYWYDNHLGEMEL
Ga0207680_1136277813300025903Switchgrass RhizosphereMFDNLVESSSHKDDISRKGSFVAATALIYVVLLVAFFVAGIYWYDNHLGQMELELT
Ga0207645_1009041033300025907Miscanthus RhizosphereMFDNLVESSSHKKDIERKGSFIVGTAVIYGVLLLTFFVAGIYW
Ga0207645_1060691013300025907Miscanthus RhizosphereMFDNLVESSSHKDDISRKGSFVAATALIYGVLMLAFFVAGIYWYDNH
Ga0207660_1050242213300025917Corn RhizosphereMFDNLVESNSHKGDISRKGSFILVTSVVYAVLGLAFFVA
Ga0207657_1060968523300025919Corn RhizosphereMFDNLVESSSHKQDITRKGSFVIGTLIIYGVLIVA
Ga0207649_1054684913300025920Corn RhizosphereMFDNLVESSSHKDDITRKGSFIGITMAIYVVLIGVFF
Ga0207652_1130155713300025921Corn RhizosphereMFDNLVESSSHKDDITRKGSFIGITALIYGVLLVTFFVAGIYWYDARLGDMELELTTLVAGTAPMRAVPAK
Ga0207650_1165945913300025925Switchgrass RhizosphereMFDNLVESSSHKDDLTRKGSFIGITLVVYAVLISTFVIA
Ga0207644_1092620523300025931Switchgrass RhizosphereMFDNLVESSSHKDDITRKGSFVGITALIYAVLLVTFFVAG
Ga0207691_1128700513300025940Miscanthus RhizosphereMFDNLVESSSHKDDITRKGSFIGITMGIYVVLIGVFFVAGIYL
Ga0207712_1127459723300025961Switchgrass RhizosphereMFDNLVESSSHKDDLTRKGSFIGITLVVYAVLISAFVI
Ga0207668_1092067813300025972Switchgrass RhizosphereMFDNLVESSSHKDDISRKGSFVAATALIYGVLMLAFFVAGI
Ga0207640_1051781223300025981Corn RhizosphereMFDNLVESSSHKDDLTRKGSFIGITLVVYAVLISAFVIA
Ga0207677_1188474113300026023Miscanthus RhizosphereMFDNLVESSSHKDDLTRKGSFIGITFLIYGVLILTFFIAGIYWYDARLGDMEL
Ga0207676_1213705713300026095Switchgrass RhizosphereMFDNLVESSSHKDDLTRKGSFIGITALIYGVLLLAFFVAGIIWYDNHLSEQELELTTL
Ga0207675_10063645413300026118Switchgrass RhizosphereMFDNLVESSSHKDDIARKGSFIGITALIYGVLLVTFFVAG
Ga0210000_107524813300027462Arabidopsis Thaliana RhizosphereMFDNLVESNSHKDDISRKGSFIIVTTIVYAVLGLAFFVAGIYWYDAHLENQNLDLITLV
Ga0209462_1006995013300027761AgaveMFDNLVESSSHKDDIARKGSFIGVTALIYGVLMVAFFVAGIYWYDAHLGQMELELTTLVA
Ga0209180_1032456123300027846Vadose Zone SoilMFDNLVESSSHKDDISRKGSFVVITALIYAVLGVAFFVAGVYWYDN
Ga0268264_1153271913300028381Switchgrass RhizosphereMFDNLVESSSHKKDIERKGSFIIVTAVIYLVLLVAFFVAGIYWYDNHLGEMEL
Ga0307513_1063419423300031456EctomycorrhizaMFDNLVESNSHKDDISRKGSFILVTIAVYVVLGTVFFVAGIYLYDAHLENQ
Ga0307468_10239387513300031740Hardwood Forest SoilMFDNLVESSSNMDDIARKGSFIGVTVLVYGVLLIAFVIVSIYAIDAHMENQNLEL
Ga0310907_1028392123300031847SoilMFDNLVESSSHKKDIERKGSFIIVTAVIYLVLLVAF
Ga0310892_1101146713300031858SoilMFDNLVESSSHKDDIARKGSFIGVTALIYGVLLVTFFVAGI
Ga0307406_1020722023300031901RhizosphereMFDNLVESSSHKDDITRKGSFIGITALIYGVLLVT
Ga0310900_1041860413300031908SoilMFDNLVESSSHKSDLTRKGSFIGITLLVYAVLIVTFVIAGIFLYDAHLSEMELE
Ga0310900_1145874613300031908SoilMFDNLVESSSHKDDIARKGSFIGVTALIYGVLMLAFFVA
Ga0310885_1086830913300031943SoilMFDNLVESSSHKDDITRKGSFVGITALIYVVLLVTFFVAG
Ga0310810_1075435723300033412SoilMFDNLVESSSHKDDITRKGSFIGITLLIYAVLIGVFFVVGIYLY
Ga0310811_1097070023300033475SoilMFDNLVESSSHKDDITRKGSFIGITLLIYAVLIGVFFVVGIYL
Ga0314797_120730_2_1093300034672SoilMFDNLVESSSHKDDLTRKGSFIGITALIYGVLLVAF
Ga0373948_0018547_1_1503300034817Rhizosphere SoilMFDNLVESSSHKDDITRKGSFIGITALIYGVLLVTFFVAGIYWYDARLGD
Ga0370497_0196671_1_1323300034965Untreated Peat SoilMFDNLVESSSHKDDISRKGSFVIVTGSIYLVLMAAFFIAGIYWY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.