Metagenome / Metatranscriptome Family F041908

Basic Information
Family ID	F041908
Family Type	Metagenome / Metatranscriptome
Number of Sequences	159
Average Sequence Length	38 residues
Representative Sequence	MKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ
Number of Associated Samples	142
Number of Associated Scaffolds	159

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	2.53 %
% of genes near scaffold ends (potentially truncated)	64.15 %
% of genes from short scaffolds (< 2000 bps)	89.31 %
Associated GOLD sequencing projects	138
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.31

Most Common Taxonomy
Group	Bacteria (76.730 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.321 % of family members)
Environment Ontology (ENVO)	Unclassified (22.013 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (48.428 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 43.75% β-sheet: 0.00% Coil/Unstructured: 56.25%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 159 Family Scaffolds
PF08388	GIIM	5.03
PF00078	RVT_1	3.14
PF03401	TctC	2.52
PF04392	ABC_sub_bind	2.52
PF00589	Phage_integrase	1.26
PF02585	PIG-L	0.63
PF01790	LGT	0.63
PF00106	adh_short	0.63
PF00072	Response_reg	0.63
PF08843	AbiEii	0.63
PF00496	SBP_bac_5	0.63
PF13432	TPR_16	0.63
PF14464	Prok-JAB	0.63
PF13592	HTH_33	0.63
PF05598	DUF772	0.63
PF03480	DctP	0.63
PF02371	Transposase_20	0.63
PF12770	CHAT	0.63
PF05694	SBP56	0.63
PF01272	GreA_GreB	0.63
PF00701	DHDPS	0.63
PF13181	TPR_8	0.63
PF13763	DUF4167	0.63
PF14534	DUF4440	0.63
PF00753	Lactamase_B	0.63
PF00258	Flavodoxin_1	0.63
PF13442	Cytochrome_CBB3	0.63
PF01663	Phosphodiest	0.63
PF01797	Y1_Tnp	0.63
PF01425	Amidase	0.63
PF03466	LysR_substrate	0.63
PF13495	Phage_int_SAM_4	0.63

COG ID	Name	Functional Category	% Frequency in 159 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	2.52
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	2.52
COG0329	4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase	Cell wall/membrane/envelope biogenesis [M]	1.26
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.63
COG0682	Prolipoprotein diacylglyceryltransferase	Cell wall/membrane/envelope biogenesis [M]	0.63
COG0782	Transcription elongation factor, GreA/GreB family	Transcription [K]	0.63
COG1943	REP element-mobilizing transposase RayT	Mobilome: prophages, transposons [X]	0.63
COG2120	N-acetylglucosaminyl deacetylase, LmbE family	Carbohydrate transport and metabolism [G]	0.63
COG2253	Predicted nucleotidyltransferase component of viral defense system	Defense mechanisms [V]	0.63
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.63

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	77.36 %
Unclassified	root	N/A	22.64 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	77.36 %
Unclassified	root	N/A	22.64 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	76.73 %
Unclassified	root	N/A	22.64 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.63 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	69.18 %
Unclassified	root	N/A	22.64 %
TACK group	clade	All Organisms → cellular organisms → Archaea → TACK group	0.63 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.63 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	60.38 %
Unclassified	root	N/A	22.64 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3.14 %
Candidatus Bathyarchaeota	phylum	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota	0.63 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.63 %

Name	Rank	Taxonomy	Distribution
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	28.93 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	27.04 %
Unclassified	root	N/A	22.64 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.89 %
unclassified Candidatus Bathyarchaeota	no rank	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota	0.63 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.63 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	28.93 %
Unclassified	root	N/A	22.64 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	12.58 %
Methylocystaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae	6.92 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1.89 %
Candidatus Bathyarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	0.63 %
Solibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae	0.63 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	28.93 %
Unclassified	root	N/A	22.64 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	12.58 %
Methylosinus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus	6.92 %
Ralstonia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia	1.26 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.63 %
Candidatus Solibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	0.63 %
Candidatus Bathyarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	0.63 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	28.93 %
Unclassified	root	N/A	22.64 %
unclassified Methylosinus	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus	6.92 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	5.03 %
Ralstonia solanacearum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	1.26 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	1.26 %
Bradyrhizobium uaiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	0.63 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	0.63 %
Burkholderia cepacia complex	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex	0.63 %
Candidatus Bathyarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	0.63 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	28.93 %
Unclassified	root	N/A	22.64 %
Methylosinus sp. C49	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49	6.29 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	5.03 %
Ralstonia solanacearum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	1.26 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	1.26 %
Burkholderia lata	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia lata	0.63 %
Candidatus Solibacter usitatus Ellin6076	isolate	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076	0.63 %
Methylosinus sp. PW1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. PW1	0.63 %
Bradyrhizobium uaiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	0.63 %
Candidatus Bathyarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	0.63 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000655\|AF_2010_repII_A100DRAFT_1083199	Not Available	562	Open in IMG/M
3300000886\|AL3A1W_1056918	Not Available	1102	Open in IMG/M
3300001593\|JGI12635J15846_10198666	Not Available	1328	Open in IMG/M
3300001661\|JGI12053J15887_10085062	All Organisms → cellular organisms → Bacteria	1735	Open in IMG/M
3300002074\|JGI24748J21848_1045873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	563	Open in IMG/M
3300004798\|Ga0058859_11713797	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	604	Open in IMG/M
3300005167\|Ga0066672_10022341	All Organisms → cellular organisms → Bacteria → Proteobacteria	3334	Open in IMG/M
3300005168\|Ga0066809_10008128	Not Available	1910	Open in IMG/M
3300005440\|Ga0070705_100990702	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	682	Open in IMG/M
3300005552\|Ga0066701_10741976	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	588	Open in IMG/M
3300005552\|Ga0066701_10814900	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	556	Open in IMG/M
3300005555\|Ga0066692_10491506	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	782	Open in IMG/M
3300005556\|Ga0066707_10144638	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1502	Open in IMG/M
3300005650\|Ga0075038_11290763	All Organisms → cellular organisms → Bacteria → Proteobacteria	748	Open in IMG/M
3300005713\|Ga0066905_101392827	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	634	Open in IMG/M
3300005764\|Ga0066903_100998925	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1529	Open in IMG/M
3300005764\|Ga0066903_107997543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	542	Open in IMG/M
3300005842\|Ga0068858_101962001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	579	Open in IMG/M
3300005937\|Ga0081455_10003672	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	17560	Open in IMG/M
3300005993\|Ga0080027_10136311	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	936	Open in IMG/M
3300006041\|Ga0075023_100154528	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	848	Open in IMG/M
3300006055\|Ga0097691_1014968	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3600	Open in IMG/M
3300006175\|Ga0070712_101288938	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	636	Open in IMG/M
3300006806\|Ga0079220_12111761	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	505	Open in IMG/M
3300006844\|Ga0075428_102018890	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	597	Open in IMG/M
3300006969\|Ga0075419_10267042	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1147	Open in IMG/M
3300007076\|Ga0075435_101935666	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	518	Open in IMG/M
3300009038\|Ga0099829_11277612	Not Available	607	Open in IMG/M
3300009088\|Ga0099830_10110648	Not Available	2064	Open in IMG/M
3300009143\|Ga0099792_10643299	Not Available	680	Open in IMG/M
3300009521\|Ga0116222_1241287	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	779	Open in IMG/M
3300009523\|Ga0116221_1069370	All Organisms → cellular organisms → Bacteria → Proteobacteria	1596	Open in IMG/M
3300009525\|Ga0116220_10083247	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1349	Open in IMG/M
3300009624\|Ga0116105_1183839	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	569	Open in IMG/M
3300009792\|Ga0126374_11553843	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	545	Open in IMG/M
3300009793\|Ga0105077_106229	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia lata	853	Open in IMG/M
3300009812\|Ga0105067_1055694	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	638	Open in IMG/M
3300010038\|Ga0126315_10542066	Not Available	746	Open in IMG/M
3300010043\|Ga0126380_10246235	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	1234	Open in IMG/M
3300010043\|Ga0126380_10694011	Not Available	817	Open in IMG/M
3300010043\|Ga0126380_11095935	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	678	Open in IMG/M
3300010046\|Ga0126384_10096024	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2174	Open in IMG/M
3300010047\|Ga0126382_11140904	All Organisms → cellular organisms → Bacteria → Proteobacteria	694	Open in IMG/M
3300010047\|Ga0126382_12404865	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	512	Open in IMG/M
3300010147\|Ga0126319_1423430	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	552	Open in IMG/M
3300010159\|Ga0099796_10375748	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	618	Open in IMG/M
3300010162\|Ga0131853_11047810	Not Available	624	Open in IMG/M
3300010358\|Ga0126370_10107728	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1944	Open in IMG/M
3300010361\|Ga0126378_10814330	Not Available	1043	Open in IMG/M
3300010366\|Ga0126379_11239591	All Organisms → cellular organisms → Bacteria	852	Open in IMG/M
3300010375\|Ga0105239_11958308	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	680	Open in IMG/M
3300010398\|Ga0126383_11088206	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	889	Open in IMG/M
3300010856\|Ga0126358_1234821	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	607	Open in IMG/M
3300011120\|Ga0150983_11208636	Not Available	687	Open in IMG/M
3300011270\|Ga0137391_11072552	Not Available	653	Open in IMG/M
3300011412\|Ga0137424_1035056	Not Available	854	Open in IMG/M
3300011438\|Ga0137451_1271447	All Organisms → cellular organisms → Bacteria	533	Open in IMG/M
3300011444\|Ga0137463_1067411	Not Available	1340	Open in IMG/M
3300011444\|Ga0137463_1333088	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	549	Open in IMG/M
3300012041\|Ga0137430_1168416	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49	632	Open in IMG/M
3300012199\|Ga0137383_11095439	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	577	Open in IMG/M
3300012202\|Ga0137363_10572833	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	952	Open in IMG/M
3300012202\|Ga0137363_11192825	Not Available	647	Open in IMG/M
3300012232\|Ga0137435_1138156	All Organisms → cellular organisms → Bacteria	742	Open in IMG/M
3300012361\|Ga0137360_10754044	Not Available	837	Open in IMG/M
3300012362\|Ga0137361_10021755	All Organisms → cellular organisms → Bacteria → Proteobacteria	4903	Open in IMG/M
3300012487\|Ga0157321_1011471	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	693	Open in IMG/M
3300012918\|Ga0137396_10658826	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	773	Open in IMG/M
3300012925\|Ga0137419_10155598	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1655	Open in IMG/M
3300012961\|Ga0164302_10069494	All Organisms → cellular organisms → Bacteria	1832	Open in IMG/M
3300012971\|Ga0126369_10068339	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3105	Open in IMG/M
3300012971\|Ga0126369_10089299	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2758	Open in IMG/M
3300012971\|Ga0126369_11116190	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	878	Open in IMG/M
3300014052\|Ga0120109_1012081	Not Available	1901	Open in IMG/M
3300014152\|Ga0181533_1197965	All Organisms → cellular organisms → Bacteria	779	Open in IMG/M
3300014320\|Ga0075342_1081193	Not Available	825	Open in IMG/M
3300014495\|Ga0182015_10838088	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	577	Open in IMG/M
3300014498\|Ga0182019_10067920	Not Available	2107	Open in IMG/M
3300014968\|Ga0157379_10580345	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1045	Open in IMG/M
3300015052\|Ga0137411_1173254	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1870	Open in IMG/M
3300015053\|Ga0137405_1193127	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	611	Open in IMG/M
3300016294\|Ga0182041_12189569	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	516	Open in IMG/M
3300016319\|Ga0182033_11052019	Not Available	725	Open in IMG/M
3300016341\|Ga0182035_11919125	Not Available	537	Open in IMG/M
3300017935\|Ga0187848_10389753	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	574	Open in IMG/M
3300017936\|Ga0187821_10208904	Not Available	752	Open in IMG/M
3300017955\|Ga0187817_10752301	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	622	Open in IMG/M
3300018019\|Ga0187874_10040535	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2225	Open in IMG/M
3300018019\|Ga0187874_10386416	All Organisms → cellular organisms → Bacteria	565	Open in IMG/M
3300018028\|Ga0184608_10319122	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	682	Open in IMG/M
3300018058\|Ga0187766_11103171	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	570	Open in IMG/M
3300018466\|Ga0190268_11253060	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	620	Open in IMG/M
3300019161\|Ga0184602_121316	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	598	Open in IMG/M
3300019257\|Ga0180115_1164703	Not Available	567	Open in IMG/M
3300019789\|Ga0137408_1363706	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49	632	Open in IMG/M
3300020580\|Ga0210403_10010724	All Organisms → cellular organisms → Bacteria → Proteobacteria	7449	Open in IMG/M
3300020580\|Ga0210403_10834820	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49	730	Open in IMG/M
3300021086\|Ga0179596_10100217	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49	1314	Open in IMG/M
3300021168\|Ga0210406_11170376	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	561	Open in IMG/M
3300021478\|Ga0210402_10206854	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1804	Open in IMG/M
3300021478\|Ga0210402_11886678	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	523	Open in IMG/M
3300021560\|Ga0126371_10143800	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2439	Open in IMG/M
3300021560\|Ga0126371_10875688	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1043	Open in IMG/M
3300021860\|Ga0213851_1161971	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	537	Open in IMG/M
3300021861\|Ga0213853_11228991	All Organisms → cellular organisms → Bacteria	663	Open in IMG/M
3300022527\|Ga0242664_1068956	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49	680	Open in IMG/M
3300022714\|Ga0242671_1083932	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	583	Open in IMG/M
3300025315\|Ga0207697_10477837	All Organisms → cellular organisms → Bacteria → Proteobacteria	551	Open in IMG/M
3300025457\|Ga0208850_1009318	Not Available	1902	Open in IMG/M
3300025898\|Ga0207692_10558829	Not Available	732	Open in IMG/M
3300025905\|Ga0207685_10115310	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1171	Open in IMG/M
3300025905\|Ga0207685_10520392	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	629	Open in IMG/M
3300025915\|Ga0207693_10395187	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1081	Open in IMG/M
3300025949\|Ga0207667_11599006	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	620	Open in IMG/M
3300026217\|Ga0209871_1047288	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	816	Open in IMG/M
3300026304\|Ga0209240_1049139	Not Available	1590	Open in IMG/M
3300026317\|Ga0209154_1037521	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2203	Open in IMG/M
3300026319\|Ga0209647_1160151	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	923	Open in IMG/M
3300026345\|Ga0257148_1011436	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	680	Open in IMG/M
3300026369\|Ga0257152_1023649	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	657	Open in IMG/M
3300026870\|Ga0208762_1001944	Not Available	760	Open in IMG/M
3300027169\|Ga0209897_1052970	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	594	Open in IMG/M
3300027523\|Ga0208890_1002608	Not Available	1954	Open in IMG/M
3300027729\|Ga0209248_10237902	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	532	Open in IMG/M
3300027767\|Ga0209655_10109926	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49	917	Open in IMG/M
3300027783\|Ga0209448_10026352	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1931	Open in IMG/M
3300027821\|Ga0209811_10319466	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	599	Open in IMG/M
3300027854\|Ga0209517_10238050	Not Available	1098	Open in IMG/M
3300027854\|Ga0209517_10603554	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	581	Open in IMG/M
3300027903\|Ga0209488_10215983	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1444	Open in IMG/M
3300027905\|Ga0209415_10049319	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5456	Open in IMG/M
3300027948\|Ga0209858_1000327	All Organisms → cellular organisms → Bacteria	3010	Open in IMG/M
3300028885\|Ga0307304_10124366	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1054	Open in IMG/M
3300030007\|Ga0311338_10300573	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1772	Open in IMG/M
3300030606\|Ga0299906_10677151	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	776	Open in IMG/M
3300030877\|Ga0265777_117484	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	573	Open in IMG/M
3300030885\|Ga0265743_108622	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	678	Open in IMG/M
3300030902\|Ga0308202_1107744	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49	583	Open in IMG/M
3300030989\|Ga0308196_1019570	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	781	Open in IMG/M
3300030991\|Ga0073994_10024970	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	789	Open in IMG/M
3300031028\|Ga0302180_10652046	Not Available	503	Open in IMG/M
3300031152\|Ga0307501_10161424	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49	616	Open in IMG/M
3300031242\|Ga0265329_10068836	Not Available	1120	Open in IMG/M
3300031422\|Ga0308186_1025525	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49	590	Open in IMG/M
3300031469\|Ga0170819_12724220	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49	591	Open in IMG/M
3300031572\|Ga0318515_10119489	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. PW1	1392	Open in IMG/M
3300031573\|Ga0310915_10041479	All Organisms → cellular organisms → Bacteria → Proteobacteria	2933	Open in IMG/M
3300031573\|Ga0310915_11148996	All Organisms → cellular organisms → Bacteria → Proteobacteria	538	Open in IMG/M
3300031744\|Ga0306918_11204679	Not Available	584	Open in IMG/M
3300031744\|Ga0306918_11312880	Not Available	556	Open in IMG/M
3300031770\|Ga0318521_10601477	Not Available	665	Open in IMG/M
3300031846\|Ga0318512_10336381	All Organisms → cellular organisms → Bacteria	754	Open in IMG/M
3300031858\|Ga0310892_11033422	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	580	Open in IMG/M
3300031893\|Ga0318536_10132372	All Organisms → cellular organisms → Bacteria	1263	Open in IMG/M
3300031944\|Ga0310884_10541015	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	689	Open in IMG/M
3300031945\|Ga0310913_10121936	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1781	Open in IMG/M
3300032035\|Ga0310911_10782635	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	552	Open in IMG/M
3300032160\|Ga0311301_11092217	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076	1039	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	91.20%
Host-Associated	Host-Associated	8.80%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	77.36%
Aquatic	Environmental → Aquatic	13.84%
Plants	Host-Associated → Plants	7.55%
Human	Host-Associated → Human	0.63%
Arthropoda	Host-Associated → Arthropoda	0.63%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	76.10%
Freshwater	Environmental → Aquatic → Freshwater	8.80%
Sediment	Environmental → Aquatic → Sediment	5.03%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.77%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.77%
Peat	Environmental → Terrestrial → Peat	1.26%
Digestive System	Host-Associated → Human → Digestive System	0.63%
Digestive System	Host-Associated → Arthropoda → Digestive System	0.63%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	61.64%
Loam	Environmental → Terrestrial → Soil → Loam	7.55%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	6.29%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	5.03%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	4.40%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.77%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.14%
Sand	Environmental → Terrestrial → Soil → Sand	2.52%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.89%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.26%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.63%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	0.63%
Gut	Host-Associated → Arthropoda → Digestive System → Gut	0.63%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.63%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	35.85%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	16.35%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	5.03%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.03%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	4.40%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.77%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.77%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.77%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	3.14%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.14%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	2.52%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	2.52%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.89%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	1.26%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.26%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.26%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.26%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.63%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.63%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.63%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	0.63%
Unclassified	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified	0.63%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.63%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	11.32%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	10.69%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	10.06%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	6.92%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	4.40%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	3.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.77%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.14%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	2.52%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	1.89%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	1.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.89%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.89%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.89%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.89%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	1.26%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	1.26%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	1.26%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	1.26%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.26%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.26%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.26%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	1.26%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	1.26%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	1.26%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.63%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	0.63%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	0.63%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.63%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.63%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.63%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.63%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.63%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.63%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.63%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.63%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.63%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	0.63%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	0.63%
Palsa	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa	0.63%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	0.63%
Termite Gut	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut	0.63%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.63%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.63%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.63%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.63%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.63%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.63%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.63%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.63%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000655	Forest soil microbial communities from Amazon forest - 2010 replicate II A100	Environmental	Open in IMG/M
3300000886	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina	Environmental	Open in IMG/M
3300001593	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2	Environmental	Open in IMG/M
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental	Open in IMG/M
3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Host-Associated	Open in IMG/M
3300004798	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005168	Soil and rhizosphere microbial communities from Laval, Canada - mgLPC	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005650	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_055 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005993	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046	Environmental	Open in IMG/M
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental	Open in IMG/M
3300006055	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009521	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG	Environmental	Open in IMG/M
3300009523	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG	Environmental	Open in IMG/M
3300009525	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG	Environmental	Open in IMG/M
3300009624	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009793	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40	Environmental	Open in IMG/M
3300009812	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60	Environmental	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010147	Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010162	Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2)	Host-Associated	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010856	Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300011412	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2	Environmental	Open in IMG/M
3300011438	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2	Environmental	Open in IMG/M
3300011444	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2	Environmental	Open in IMG/M
3300012041	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012232	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012487	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510	Host-Associated	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300014052	Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M	Environmental	Open in IMG/M
3300014152	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG	Environmental	Open in IMG/M
3300014320	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1	Environmental	Open in IMG/M
3300014495	Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG	Environmental	Open in IMG/M
3300014498	Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015052	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015053	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300017935	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40	Environmental	Open in IMG/M
3300017936	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1	Environmental	Open in IMG/M
3300017955	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2	Environmental	Open in IMG/M
3300018019	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300019161	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019257	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300021086	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300021860	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021861	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022527	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022714	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025457	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes)	Environmental	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026217	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)	Environmental	Open in IMG/M
3300026304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)	Environmental	Open in IMG/M
3300026317	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)	Environmental	Open in IMG/M
3300026319	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)	Environmental	Open in IMG/M
3300026345	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-A	Environmental	Open in IMG/M
3300026369	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A	Environmental	Open in IMG/M
3300026870	Soil and rhizosphere microbial communities from Laval, Canada - mgLMC (SPAdes)	Environmental	Open in IMG/M
3300027169	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes)	Environmental	Open in IMG/M
3300027523	Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)	Environmental	Open in IMG/M
3300027729	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)	Environmental	Open in IMG/M
3300027767	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)	Environmental	Open in IMG/M
3300027783	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)	Environmental	Open in IMG/M
3300027821	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027854	Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300027905	Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)	Environmental	Open in IMG/M
3300027948	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes)	Environmental	Open in IMG/M
3300028885	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185	Environmental	Open in IMG/M
3300030007	I_Palsa_E1 coassembly	Environmental	Open in IMG/M
3300030606	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125	Environmental	Open in IMG/M
3300030877	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030885	Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030902	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030989	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030991	Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031028	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2	Environmental	Open in IMG/M
3300031152	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S	Environmental	Open in IMG/M
3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Host-Associated	Open in IMG/M
3300031422	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031469	Fir Spring Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031572	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031770	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17	Environmental	Open in IMG/M
3300031823	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05	Environmental	Open in IMG/M
3300031846	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031893	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300031945	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082	Environmental	Open in IMG/M
3300032035	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170	Environmental	Open in IMG/M
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.31
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.31
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F041908

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
AF_2010_repII_A100DRAFT_10831991	3300000655	Forest Soil	VLEMKVGPSGSAIRSLIPSHRKLLQSKAVVVSVAEKPGR*
AL3A1W_10569182	3300000886	Permafrost	EMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ*
JGI12635J15846_101986661	3300001593	Forest Soil	MKVGPSGSAIGSLIPSRRGPLWSKATVVSAAERLDND
JGI12053J15887_100850621	3300001661	Forest Soil	CTRVKEAPSSSAIRSLIPSHRKLLWSKAVVVRVAAI*
JGI24748J21848_10458731	3300002074	Corn, Switchgrass And Miscanthus Rhizosphere	VLEMKEGPSGSAIRSLIPSHHERLWSKATVVSVAETSGR*
Ga0058859_117137971	3300004798	Host-Associated	ATVLEMKEGPSGSAIRSLIPSHRERLWSKATVVSVAETSGR*
Ga0066672_100223411	3300005167	Soil	MKEGPSGSAIRSLIPSHRKLLSSKATVVNVAEKSEHDSGRHG*
Ga0066809_100081281	3300005168	Soil	VTVREMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETPGQ*
Ga0070705_1009907022	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	RATVLEMKEGPSGSAIRSLIPSHRERLWSKATVVSVAETSGR*
Ga0066701_107419761	3300005552	Soil	VREMKEGPSGSAIRSLIPSHRKLLWSKVTVVSVAETPGR*
Ga0066701_108149001	3300005552	Soil	REMKEGPSGSAIRSLIPSHRKLLRSKAVVVSVAETSGR*
Ga0066692_104915062	3300005555	Soil	TVREMKEGPSGSAIRSLIPSHRKLLWSKVTVVSVAETPGR*
Ga0066707_101446384	3300005556	Soil	MKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETPGQ*
Ga0075038_112907632	3300005650	Permafrost Soil	MKEGPSGSAIRSLIPSHRKLLSSKAMVVNVAETSGQ*
Ga0066905_1013928271	3300005713	Tropical Forest Soil	SKRRCVTVLEMKVGPSGSAIRSLIPSHRELLRSNAVVVSVAEKSGQ*
Ga0066903_1009989253	3300005764	Tropical Forest Soil	MKEDPSGSAIRSLIPNYRKLLRSKAVVVSVAEKSGQ*
Ga0066903_1079975432	3300005764	Tropical Forest Soil	EDPSDSAIRSLIPNHRKLLRPKAVVVSVAEESEQ*
Ga0068858_1019620011	3300005842	Switchgrass Rhizosphere	MKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETPGR*
Ga0081455_1000367216	3300005937	Tabebuia Heterophylla Rhizosphere	MKEGPSGSAIRPLIQSHRELLGPKAALVSVADTPGP*
Ga0080027_101363112	3300005993	Prmafrost Soil	MKEGPSGSAIRSLIPSHRELLSSKAMVVNVAEKSE*
Ga0075023_1001545282	3300006041	Watersheds	MKEGPSGSAIRSLIPSHRKLLSSKAMVVNVAEKSGQ*
Ga0097691_10149685	3300006055	Arctic Peat Soil	MKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ*
Ga0070712_1012889382	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MKEGPSGSAIRSLILSHRKLLSSKAMVVNVAETSGQ*
Ga0079220_121117611	3300006806	Agricultural Soil	PEMKEGPSDSAIRSLIPNHRKLLRSKAVVVNVAEKLGR*
Ga0075428_1020188901	3300006844	Populus Rhizosphere	KEGPSGSAIRSLIPSHRERLWSKATVVSVAETSGP*
Ga0075419_102670422	3300006969	Populus Rhizosphere	MEEGPSGSAIRSLIPNHRELLRSKAGVVSIAETSGQ*
Ga0075435_1019356661	3300007076	Populus Rhizosphere	EMKEGPSGSAIRSLIPSHRKLLWSKSMVVSVAEKSGR*
Ga0099829_112776122	3300009038	Vadose Zone Soil	MKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSG
Ga0099830_101106481	3300009088	Vadose Zone Soil	TVREMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ*
Ga0099792_106432991	3300009143	Vadose Zone Soil	MKEGPSGSAIRSLIPSHRELLSSKAMVVNVAEKSG*
Ga0116222_12412871	3300009521	Peatlands Soil	PSGSAIRSLIPSHRKLLSSKAMVVNVAEKSEQDSDRHD*
Ga0116221_10693702	3300009523	Peatlands Soil	MKEGLSGSAIRSLIPSHRKLLSSKAMVVNVAETSGQ*
Ga0116220_100832472	3300009525	Peatlands Soil	MKDGPSGSAIRSLIPSHRKLLSSKAMVVNVAETSGQ*
Ga0116105_11838392	3300009624	Peatland	VREMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ*
Ga0126374_115538431	3300009792	Tropical Forest Soil	EMKEGPSGSVIRSLIPSHREPLRSKAVVVSVAETPGQ*
Ga0105077_1062292	3300009793	Groundwater Sand	MKEGASGSAIRSLIPSHRELLRSKAVVVSVTEKSGL*
Ga0105067_10556941	3300009812	Groundwater Sand	ATVREMKEGPSGSAIRSLNPSHCKLLRSKAVVVSVAEKPGL*
Ga0126315_105420662	3300010038	Serpentine Soil	MKEGPSGSAIRSLIPSHRKLLLSKAMVVNVADKSEQDSSRQG*
Ga0126380_102462353	3300010043	Tropical Forest Soil	MKEDPSDSAIRSLIPNHRKLLRSKAVVVNVAEKSGQ*
Ga0126380_106940111	3300010043	Tropical Forest Soil	MRNCAGDEGPSGSVIKSLIPGHRELLRSKAAVVSIAEKGE
Ga0126380_110959352	3300010043	Tropical Forest Soil	MKEDPSGSAIRSLIPNHRKLLRSKAVVVNVAEKSEQ*
Ga0126384_100960243	3300010046	Tropical Forest Soil	MRLHATVLEMKEGPSGSAIRSLIPKHRKLLRSKAVVVSVAEKSGR*
Ga0126382_111409042	3300010047	Tropical Forest Soil	MKEGPSGSAIKSLVLSHRKLLWSKAVVVRCGNAGTMIR
Ga0126382_124048651	3300010047	Tropical Forest Soil	MKEDPSGSAIRSLIPNYRKLLRSKAAVVSVAEKSEQ*
Ga0126319_14234301	3300010147	Soil	GPSGSAIRSLIPSHRELLRSKAVVVSVAEKSGHDPVRHG*
Ga0099796_103757481	3300010159	Vadose Zone Soil	KEGPTGSAIRSLIPSHRKLLRSKAVVVSVAETSGHDPGRHG*
Ga0131853_110478102	3300010162	Termite Gut	MKEGPSSSVIREPISSHRKLLRAKAVVVSVAETPGPDF
Ga0126370_101077281	3300010358	Tropical Forest Soil	TVLEMKVGPSGSAIRPLIPSHRKLLLPKSVVVSVAEKSGQ*
Ga0126378_108143301	3300010361	Tropical Forest Soil	MKEGPSGSAIMSLIPSHCKLLSSKAMVVNVAEKSGR*
Ga0126379_112395912	3300010366	Tropical Forest Soil	MKEGPSGSAIRSLIPSHCKLLSSKAMVVNVAEKSGMIPAGKV
Ga0105239_119583081	3300010375	Corn Rhizosphere	EMKEGPSGSAIRSLIPSHRKLLWSKVTVVSVAETPGR*
Ga0126383_110882061	3300010398	Tropical Forest Soil	TVLEMKVGPSGSAIRSLIPSHRKLLRSKAVVVSVAEKSGQ*
Ga0126358_12348212	3300010856	Boreal Forest Soil	REMKEGPSGSAIRSLIPSHRKLLWSKATVVSVAETSGR*
Ga0150983_112086361	3300011120	Forest Soil	MKEGPSGSAIRSLIPSHRELLSSKATVVNVAEKSE*
Ga0137391_110725522	3300011270	Vadose Zone Soil	MKEGPSGSAIRSLIPSHRELLSSKAMVVNVAEKLE*
Ga0137424_10350563	3300011412	Soil	TVRKMEVGPPGSAIRSLIPSYRELLRSRAVVASVTETSGR*
Ga0137451_12714471	3300011438	Soil	TVQEMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAEKSGR*
Ga0137463_10674112	3300011444	Soil	MKEGPSGSAIGSLIPSQRELLRSKAVVVSVAEMSGQ*
Ga0137463_13330881	3300011444	Soil	RATVLEMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAEKSGHDPVRHG*
Ga0137430_11684161	3300012041	Soil	TVLEMKEGPSGSAIRSSIPSHRERLWSKATVVSVAEKPGH*
Ga0137383_110954392	3300012199	Vadose Zone Soil	MKDGPSGSAIRLLIPSHRKLLSSKAMVVNVAETSGQ*
Ga0137363_105728331	3300012202	Vadose Zone Soil	MKEGPSGSAIRSLMPSHRELLSSKATVVNVAEKSE*
Ga0137363_111928251	3300012202	Vadose Zone Soil	EGPSGSAIRSLIPSHRELLRSKAVVVSVAETPGQ*
Ga0137435_11381562	3300012232	Soil	MKEGPLGSVIRSLISSHRKLLRSKAMVVSVAETSVTIQPL*
Ga0137360_107540442	3300012361	Vadose Zone Soil	MKEGPSGSVIRSLIPSHREALRSKAVVVSVAETPGQ*
Ga0137361_100217558	3300012362	Vadose Zone Soil	MKEGPSGSAIRSLIPSHCKLLSSKAMVVNVAEKSG
Ga0157321_10114711	3300012487	Arabidopsis Rhizosphere	KEGPSDSAIRSLISNHRKLLRSKAGVVSVAEKSGR*
Ga0137396_106588261	3300012918	Vadose Zone Soil	MKEGPSGSAIRSLIPSHRKLLWSKVTVVSVAETPGR*
Ga0137419_101555982	3300012925	Vadose Zone Soil	MKEGPSGSAIRSLIPSHRKLLSSKAMVVNVAETSGL*
Ga0164302_100694942	3300012961	Soil	MKGGPSGSAIRPLIPSHRKLLWSKAMVVSVAGNAGTM
Ga0126369_100683393	3300012971	Tropical Forest Soil	MKEGPSGSAIMSLIPSHCKLLSSKAMVVSIEKKPK*
Ga0126369_100892991	3300012971	Tropical Forest Soil	KEDPSDSAIRSLIPNHRKLLRSKAVVVSVTEKSGQ*
Ga0126369_111161902	3300012971	Tropical Forest Soil	SKRRCVTVLEMKVGPSGSAIRSLIPSHRKLLRSKAVVVSVAETPGR*
Ga0120109_10120812	3300014052	Permafrost	AVREMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ*
Ga0181533_11979651	3300014152	Bog	MKEGPSGSAIRSLIPSHCKLLWSKATVVNVAEKPEQEF
Ga0075342_10811932	3300014320	Natural And Restored Wetlands	MKEGPSGSVIRSLIPSHRKLLRSKAVVVSVAEKSGHHPGKHG*
Ga0182015_108380881	3300014495	Palsa	TRLRATVREMKEGPSGSAIRSLIPSHRELLRSKAAVVSVAETSGQ*
Ga0182019_100679203	3300014498	Fen	MKEGPSGSAIRSLIPSHRKLLWSKAMVGSVAEKPGQ*
Ga0157379_105803453	3300014968	Switchgrass Rhizosphere	EMKEGPSGSAIRSLIPSHRERLWSKAMVVSVAETSGR*
Ga0137411_11732541	3300015052	Vadose Zone Soil	MTEGPSGSAIRSLIPSHCKLLSSKAMVVNVAEKSGR
Ga0137405_11931271	3300015053	Vadose Zone Soil	GTVREMKEGPSGSAIRSLIPSHRKLLWSKVTVVSVAETPGR*
Ga0182041_121895691	3300016294	Soil	ATVREMKEGPSGSVIRSLIPSHREPLRSKAVVVSVAETPGQ
Ga0182033_110520191	3300016319	Soil	MKEDPSDSAIRSLIPNHRKLLRSKAVVVNVAEKSG
Ga0182035_119191251	3300016341	Soil	KEGPSGSAIRSLIPSHRELLRSKTVVVSVAETPGQ
Ga0187848_103897531	3300017935	Peatland	RLRATVREMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ
Ga0187821_102089042	3300017936	Freshwater Sediment	RCVTVREMKEGPSGSVIRSLIPSHCKLLSSKAMVVNVAEKSGR
Ga0187817_107523011	3300017955	Freshwater Sediment	TVREMKEGPSGSAIRSLIPSHRKLLWSKVTVVSVAETPGR
Ga0187874_100405353	3300018019	Peatland	WEMKVGPSGSVIRSLIPSHRELLRSKAVVVSVAETSGQ
Ga0187874_103864162	3300018019	Peatland	VREMKEGPSGSAIRSLIPSHRELLSSKAMVVKVAETSGQ
Ga0184608_103191221	3300018028	Groundwater Sediment	EMKEGPSGSAIRSLIPSHRKLLRSKAVVVSVAETSGHDPGRHG
Ga0187766_111031711	3300018058	Tropical Peatland	CVTVREMKAGPSGSAIRSLITSHCKLLSSKAPVVNVAEKSGR
Ga0190268_112530601	3300018466	Soil	EMKEGPSGSAIRSLIPSHRKLLRSKVVVVSVAEKSGHDPGRHG
Ga0184602_1213162	3300019161	Soil	MKEGPSGSAIRSLIPSHRKLLSSKAMVVNVAETSGQ
Ga0180115_11647031	3300019257	Groundwater Sediment	ATVLEMKEGPSGSAIRSLIPSHRELLRPKAVVVSVAETSGQ
Ga0137408_13637062	3300019789	Vadose Zone Soil	MKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETPGQ
Ga0210403_100107247	3300020580	Soil	MKEGPSGSAIRSLIPSHRKLLWSKVTVVSVAETPGR
Ga0210403_108348202	3300020580	Soil	MKEGPSGSAIRSLIPSHRELLSSKATVVNVAEKSE
Ga0179596_101002171	3300021086	Vadose Zone Soil	MKEGPSGSAIRSLIPSHRELLSSKAMVVNVAEKSG
Ga0210406_111703761	3300021168	Soil	MKEGPSGSVIRSLIPSHRELLRSKAVVVSVAETPGQ
Ga0210402_102068541	3300021478	Soil	MKEGPSGSAIRSLIPSHRKLLSSKAMVVNVAEKSGQ
Ga0210402_118866782	3300021478	Soil	REMEEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ
Ga0126371_101438001	3300021560	Tropical Forest Soil	MKEGPSGSAIMSLIPSHCKLLSSKAMVVNVAEKSGR
Ga0126371_108756882	3300021560	Tropical Forest Soil	MRLHATVLEMKEGPSGSAIRSLIPKHRKLLRSKAVVVSVAEKSGR
Ga0213851_11619711	3300021860	Watersheds	RATVREMKEGPSGSAIRSLIPSHRELLRSKVVVVSVAETSGQ
Ga0213853_112289912	3300021861	Watersheds	MKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETPG
Ga0242664_10689561	3300022527	Soil	MKEGPSGSAIRSLIPSHRELLRSKAVVVSVAEKPGQ
Ga0242671_10839321	3300022714	Soil	RRYATVREMKEGPSGSAIRSLIPSHRELLSSKATVVNVAEKSE
Ga0207697_104778371	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	KMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETPGQ
Ga0208850_10093182	3300025457	Arctic Peat Soil	MKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ
Ga0207692_105588291	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	VTVREMKEGPSGSAIRSLIPSHCKLLSSKALVVNVAEKSGR
Ga0207685_101153101	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	GSDGCATVLEMKEGPSGSVIRSLIPSHRELLRSNAVVVSVAEKSGR
Ga0207685_105203921	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	EMEEGPSGSAIRSLIPSHHKLLRSKAVVVSVVEKSGL
Ga0207693_103951873	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MKEGPSGSAIRSLILSHRKLLSSKAMVVNVAETSGQ
Ga0207667_115990062	3300025949	Corn Rhizosphere	TVLKMKEGPSGSAIRSLIPSHRELLRSKALVVSVAETSGR
Ga0209871_10472882	3300026217	Permafrost Soil	MKEGPSGSAIRSLIPSHRELLSSKAMVVNVAEKSE
Ga0209240_10491391	3300026304	Grasslands Soil	MKEGPSGSAIRSLIPSHRKLLWSKPVVVSVAETPGQ
Ga0209154_10375213	3300026317	Soil	MKEGPSGSAIRSLIPSHRKLLSSKATVVNVAEKSEHDSGRHG
Ga0209647_11601511	3300026319	Grasslands Soil	MKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETLGQ
Ga0257148_10114361	3300026345	Soil	VREMKEGPSGSAIRSLIPSHCKLLSSKAMVVNVAEKSGR
Ga0257152_10236491	3300026369	Soil	EMKEGPSGSAIRSLIPSHCKLLSSKAMVVNVAEKSGR
Ga0208762_10019441	3300026870	Soil	KEGPSGSAIRSLIPSHRELLRSKAVVVSVAETPGQ
Ga0209897_10529702	3300027169	Groundwater Sand	MKEGASGSAIRSLIPSHRELLRSKAVVVSVTEKSGL
Ga0208890_10026083	3300027523	Soil	EMKEGPSGSAIRSLIPSHRELLRSKAVVASVAETSGQ
Ga0209248_102379021	3300027729	Bog Forest Soil	MKDGPSGSAIRSLIPSHRKLLSSKAMVVNVAEKSGQ
Ga0209655_101099263	3300027767	Bog Forest Soil	MKEGPSGSAIGSLIPSHRELLSSKATVVNVAEKSEQDFDRHD
Ga0209448_100263523	3300027783	Bog Forest Soil	MKDGPSGSAIRSLIPSHRKLLSSKAMVVNVAETSGQ
Ga0209811_103194661	3300027821	Surface Soil	EMKEGPSGSAIRSLIPSHHERLWSKATVVSVAETSGR
Ga0209517_102380502	3300027854	Peatlands Soil	MKEGPSGSAIRSLIPSHRKLLSSKAMVVNVAEMPGQ
Ga0209517_106035542	3300027854	Peatlands Soil	EMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ
Ga0209488_102159831	3300027903	Vadose Zone Soil	MKAGPSGSAIRSLIPSHRELLRSKAVVVSVAETSG
Ga0209415_100493194	3300027905	Peatlands Soil	MKEGLSGSAIRSLIPSHRKLLSSKAMVVNVAETSGQ
Ga0209858_10003274	3300027948	Groundwater Sand	EMEEGPSGSAIRSPIPSHRELLRPKAVVVSVAEKPGR
Ga0307304_101243664	3300028885	Soil	IREMKEGPSGSAIRSLIPSHRELLRSKAGVVSVTETPGR
Ga0311338_103005731	3300030007	Palsa	MKEGPSGSAIRSLIPSHRELLSSKAMVVKVAETSGQ
Ga0299906_106771511	3300030606	Soil	KRRCATVLEMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGR
Ga0265777_1174841	3300030877	Soil	RATVREMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGR
Ga0265743_1086221	3300030885	Soil	TVREMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ
Ga0308202_11077442	3300030902	Soil	ATVREMKEGPSGSAIRSLIPSHRELLRSNAVVVSVAETSGQ
Ga0308196_10195702	3300030989	Soil	MKDGPSGSAIRLLIPSHRKLLSSKAMVVNVAETSGQ
Ga0073994_100249701	3300030991	Soil	TVREMKEGPSGSAIRSLIPSHRELLSSKATVVNVAEKSE
Ga0302180_106520462	3300031028	Palsa	MKEGPSGSAIRSLIPSHRELLRPKAVVVSGAETSGQ
Ga0307501_101614241	3300031152	Soil	VLEMKEGPSGSVIRSPIPSHRELLRSNAVVVSVAETSGQ
Ga0265329_100688361	3300031242	Rhizosphere	LRATVREMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ
Ga0308186_10255251	3300031422	Soil	TVREMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGL
Ga0170819_127242201	3300031469	Forest Soil	MKEGPSGSAIRSPIPSHRELLRSKAVVVSVAETSGQ
Ga0318515_101194891	3300031572	Soil	GSAIRSLIPNHRKLLRSKAVVVSVAEKSGQDPGEPRHVT
Ga0310915_100414791	3300031573	Soil	RRCATVLEMKEDPSDSAIRSLIPNHRKLLRSKAVVVNVAEKSGQ
Ga0310915_111489961	3300031573	Soil	SKRRCVTVLERKAGPSGSAIRSLIPSDRKLLRSKAVVVSVAEK
Ga0306918_112046791	3300031744	Soil	KEDPSDSAIRSLIPNHRKLLRSKAVVVNVAEKSGQ
Ga0306918_113128801	3300031744	Soil	MKEGPSGSAIRSLIPNHRKLLWSKLTVVSVAETPGR
Ga0318521_106014772	3300031770	Soil	MKEDPSDSAIRSLIPNHRKLLRSKAVVVNVAEKSGQ
Ga0307478_104650782	3300031823	Hardwood Forest Soil	VTSNAGPHGGCVTVREMKAGPSGSAIRSLTPSHCKLLSSKAMVVNVAEKSGR
Ga0318512_103363812	3300031846	Soil	MKDGPSGSAIRSLIPSHRKLLWSKVTVVSVAETPG
Ga0310892_110334222	3300031858	Soil	REMKEGPSGSAIRSLIPSHRKLLWSKVTVVSVAETPGR
Ga0318536_101323722	3300031893	Soil	CATVLEMKEDPSDSAIRSLIPNHRKLLRSKAVVVNVAEKSGQ
Ga0310884_105410152	3300031944	Soil	VLEMKEGPSGSAIRSLIPSHRERLWPKAMVVSVAETSRR
Ga0310913_101219361	3300031945	Soil	EMKEDPSDSAIRSLIPNHRKLLRSKAVVVNVAEKSGQ
Ga0310911_107826352	3300032035	Soil	VTVLEMKEGPSGSAIRSLIPSHRKLLWSKSMVVSVAEKSGR
Ga0311301_110922171	3300032160	Peatlands Soil	MKDGPSGSAIRSLIPSHRKLLSSKAMAVNVAEKSGQ

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign