Basic Information | |
---|---|
Family ID | F041592 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 159 |
Average Sequence Length | 45 residues |
Representative Sequence | MGRKERCPQCGSKKITITGNLKKCEVCKYEWAGKPGRKTSKKEKIRF |
Number of Associated Samples | 77 |
Number of Associated Scaffolds | 159 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Archaea |
% of genes with valid RBS motifs | 82.39 % |
% of genes near scaffold ends (potentially truncated) | 38.99 % |
% of genes from short scaffolds (< 2000 bps) | 76.10 % |
Associated GOLD sequencing projects | 69 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Archaea (87.421 % of family members) |
NCBI Taxonomy ID | 2157 |
Taxonomy | All Organisms → cellular organisms → Archaea |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment (22.642 % of family members) |
Environment Ontology (ENVO) | Unclassified (42.138 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) (32.075 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 14.67% Coil/Unstructured: 85.33% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 159 Family Scaffolds |
---|---|---|
PF00118 | Cpn60_TCP1 | 6.29 |
PF00382 | TFIIB | 2.52 |
PF14947 | HTH_45 | 1.89 |
PF03692 | CxxCxxCC | 1.89 |
PF01037 | AsnC_trans_reg | 1.26 |
PF01294 | Ribosomal_L13e | 1.26 |
PF03143 | GTP_EFTU_D3 | 1.26 |
PF16762 | RHH_6 | 1.26 |
PF00005 | ABC_tran | 1.26 |
PF08734 | GYD | 1.26 |
PF13524 | Glyco_trans_1_2 | 1.26 |
PF08271 | TF_Zn_Ribbon | 0.63 |
PF02567 | PhzC-PhzF | 0.63 |
PF02852 | Pyr_redox_dim | 0.63 |
PF05239 | PRC | 0.63 |
PF08264 | Anticodon_1 | 0.63 |
PF00352 | TBP | 0.63 |
PF04034 | Ribo_biogen_C | 0.63 |
PF03726 | PNPase | 0.63 |
PF00571 | CBS | 0.63 |
PF01927 | Mut7-C | 0.63 |
PF01402 | RHH_1 | 0.63 |
PF01656 | CbiA | 0.63 |
PF13549 | ATP-grasp_5 | 0.63 |
PF07364 | DUF1485 | 0.63 |
PF13594 | Obsolete Pfam Family | 0.63 |
PF01361 | Tautomerase | 0.63 |
PF02195 | ParBc | 0.63 |
PF02142 | MGS | 0.63 |
PF00288 | GHMP_kinases_N | 0.63 |
PF01957 | NfeD | 0.63 |
PF06397 | Desulfoferrod_N | 0.63 |
PF03144 | GTP_EFTU_D2 | 0.63 |
PF01105 | EMP24_GP25L | 0.63 |
PF01479 | S4 | 0.63 |
PF13463 | HTH_27 | 0.63 |
PF12675 | DUF3795 | 0.63 |
PF07973 | tRNA_SAD | 0.63 |
PF01247 | Ribosomal_L35Ae | 0.63 |
PF06093 | Spt4 | 0.63 |
PF05048 | NosD | 0.63 |
PF13229 | Beta_helix | 0.63 |
PF04126 | Cyclophil_like | 0.63 |
PF13424 | TPR_12 | 0.63 |
PF01176 | eIF-1a | 0.63 |
PF00932 | LTD | 0.63 |
PF01139 | RtcB | 0.63 |
PF07690 | MFS_1 | 0.63 |
PF01725 | Ham1p_like | 0.63 |
PF00483 | NTP_transferase | 0.63 |
PF10604 | Polyketide_cyc2 | 0.63 |
PF01513 | NAD_kinase | 0.63 |
PF03599 | CdhD | 0.63 |
PF07366 | SnoaL | 0.63 |
PF03061 | 4HBT | 0.63 |
COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
---|---|---|---|
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 6.29 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.26 |
COG4352 | Ribosomal protein L13E | Translation, ribosomal structure and biogenesis [J] | 1.26 |
COG0127 | Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase family | Nucleotide transport and metabolism [F] | 0.63 |
COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.63 |
COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.63 |
COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 0.63 |
COG1456 | CO dehydrogenase/acetyl-CoA synthase gamma subunit (corrinoid Fe-S protein) | Energy production and conversion [C] | 0.63 |
COG1656 | Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domain | General function prediction only [R] | 0.63 |
COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 0.63 |
COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.63 |
COG2033 | Desulfoferrodoxin, superoxide reductase-like (SORL) domain | Energy production and conversion [C] | 0.63 |
COG2042 | Ribosome biogenesis protein Tsr3 (rRNA maturation) | Translation, ribosomal structure and biogenesis [J] | 0.63 |
COG2069 | CO dehydrogenase/acetyl-CoA synthase delta subunit (corrinoid Fe-S protein) | Energy production and conversion [C] | 0.63 |
COG2101 | TATA-box binding protein (TBP), component of TFIID and TFIIIB | Transcription [K] | 0.63 |
COG2451 | Ribosomal protein L35AE/L33A | Translation, ribosomal structure and biogenesis [J] | 0.63 |
COG5476 | Microcystin degradation protein MlrC, contains DUF1485 domain | General function prediction only [R] | 0.63 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.94 % |
Unclassified | root | N/A | 10.06 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000393|WOR_102559 | All Organisms → cellular organisms → Archaea | 1267 | Open in IMG/M |
3300001749|JGI24025J20009_10063824 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 1286 | Open in IMG/M |
3300001749|JGI24025J20009_10097152 | All Organisms → cellular organisms → Archaea | 859 | Open in IMG/M |
3300001751|JGI2172J19969_10009472 | All Organisms → cellular organisms → Archaea | 3972 | Open in IMG/M |
3300001751|JGI2172J19969_10055349 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 1285 | Open in IMG/M |
3300001751|JGI2172J19969_10089253 | All Organisms → cellular organisms → Archaea | 918 | Open in IMG/M |
3300001751|JGI2172J19969_10154922 | Not Available | 639 | Open in IMG/M |
3300001752|JGI2173J19968_10209739 | All Organisms → cellular organisms → Archaea | 540 | Open in IMG/M |
3300001753|JGI2171J19970_10087046 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon RBG_13_38_9 | 1120 | Open in IMG/M |
3300001753|JGI2171J19970_10231601 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon RBG_13_46_16b | 590 | Open in IMG/M |
3300001753|JGI2171J19970_10254898 | All Organisms → cellular organisms → Archaea | 558 | Open in IMG/M |
3300001782|WOR52_10026203 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 6694 | Open in IMG/M |
3300001782|WOR52_10038320 | All Organisms → cellular organisms → Archaea | 6788 | Open in IMG/M |
3300001854|JGI24422J19971_10044603 | All Organisms → cellular organisms → Archaea | 2555 | Open in IMG/M |
3300001854|JGI24422J19971_10064460 | All Organisms → cellular organisms → Archaea | 2026 | Open in IMG/M |
3300001854|JGI24422J19971_10066764 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1979 | Open in IMG/M |
3300001854|JGI24422J19971_10109349 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1389 | Open in IMG/M |
3300001854|JGI24422J19971_10166354 | All Organisms → cellular organisms → Archaea | 1007 | Open in IMG/M |
3300001854|JGI24422J19971_10183445 | Not Available | 932 | Open in IMG/M |
3300001854|JGI24422J19971_10191737 | All Organisms → cellular organisms → Archaea | 901 | Open in IMG/M |
3300001854|JGI24422J19971_10310752 | All Organisms → cellular organisms → Archaea | 625 | Open in IMG/M |
3300001854|JGI24422J19971_10332645 | All Organisms → cellular organisms → Archaea | 595 | Open in IMG/M |
3300002053|SMTZ23_10011116 | All Organisms → cellular organisms → Archaea | 12930 | Open in IMG/M |
3300002053|SMTZ23_10040607 | All Organisms → cellular organisms → Archaea | 15297 | Open in IMG/M |
3300002530|C687J35503_10076969 | All Organisms → cellular organisms → Archaea | 869 | Open in IMG/M |
3300003332|GBSed_10004199 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Thermococcus | 8985 | Open in IMG/M |
3300005782|Ga0079367_1028330 | All Organisms → cellular organisms → Archaea | 2525 | Open in IMG/M |
3300005782|Ga0079367_1198797 | All Organisms → cellular organisms → Archaea | 777 | Open in IMG/M |
3300005832|Ga0074469_11018149 | All Organisms → cellular organisms → Archaea | 1111 | Open in IMG/M |
3300007896|Ga0111484_1097340 | All Organisms → cellular organisms → Archaea | 575 | Open in IMG/M |
3300008517|Ga0111034_1053594 | All Organisms → cellular organisms → Archaea | 1626 | Open in IMG/M |
3300008517|Ga0111034_1085038 | All Organisms → cellular organisms → Archaea | 2716 | Open in IMG/M |
3300009034|Ga0115863_1045990 | All Organisms → cellular organisms → Archaea | 5655 | Open in IMG/M |
3300009034|Ga0115863_1051725 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 5285 | Open in IMG/M |
3300009034|Ga0115863_1238783 | All Organisms → cellular organisms → Bacteria | 2166 | Open in IMG/M |
3300009034|Ga0115863_1253325 | All Organisms → cellular organisms → Archaea | 2092 | Open in IMG/M |
3300009034|Ga0115863_1752601 | All Organisms → cellular organisms → Archaea | 1088 | Open in IMG/M |
3300009136|Ga0118735_10131895 | All Organisms → cellular organisms → Archaea | 791 | Open in IMG/M |
3300009150|Ga0114921_10215193 | All Organisms → cellular organisms → Archaea | 1347 | Open in IMG/M |
3300009150|Ga0114921_10527374 | All Organisms → cellular organisms → Archaea | 865 | Open in IMG/M |
3300009150|Ga0114921_10685471 | All Organisms → cellular organisms → Archaea | 756 | Open in IMG/M |
3300009150|Ga0114921_11030290 | All Organisms → cellular organisms → Archaea | 614 | Open in IMG/M |
3300009488|Ga0114925_10256553 | All Organisms → cellular organisms → Archaea | 1175 | Open in IMG/M |
3300009499|Ga0114930_10066028 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2130 | Open in IMG/M |
3300009499|Ga0114930_10236294 | All Organisms → cellular organisms → Archaea | 906 | Open in IMG/M |
3300009499|Ga0114930_10523120 | All Organisms → cellular organisms → Archaea | 532 | Open in IMG/M |
3300009528|Ga0114920_10373065 | All Organisms → cellular organisms → Archaea | 967 | Open in IMG/M |
3300009528|Ga0114920_11165199 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 528 | Open in IMG/M |
3300009529|Ga0114919_10035361 | All Organisms → cellular organisms → Archaea | 3738 | Open in IMG/M |
3300009943|Ga0117933_1067073 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota | 5773 | Open in IMG/M |
3300010324|Ga0129297_10073933 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1619 | Open in IMG/M |
3300010324|Ga0129297_10498162 | All Organisms → cellular organisms → Archaea | 536 | Open in IMG/M |
3300010328|Ga0129298_10087475 | All Organisms → cellular organisms → Archaea | 1479 | Open in IMG/M |
3300010430|Ga0118733_106864087 | All Organisms → cellular organisms → Archaea | 593 | Open in IMG/M |
3300012931|Ga0153915_10713384 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1159 | Open in IMG/M |
3300012964|Ga0153916_10113269 | All Organisms → cellular organisms → Archaea | 2590 | Open in IMG/M |
3300012964|Ga0153916_11077082 | All Organisms → cellular organisms → Archaea | 884 | Open in IMG/M |
3300012964|Ga0153916_11523153 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon BA2 | 744 | Open in IMG/M |
3300012964|Ga0153916_12223993 | All Organisms → cellular organisms → Archaea → TACK group | 616 | Open in IMG/M |
3300014903|Ga0164321_10103922 | All Organisms → cellular organisms → Archaea | 1190 | Open in IMG/M |
3300014903|Ga0164321_10474565 | All Organisms → cellular organisms → Archaea | 627 | Open in IMG/M |
3300018070|Ga0184631_10036780 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1736 | Open in IMG/M |
3300019736|Ga0194019_1067072 | All Organisms → cellular organisms → Archaea | 524 | Open in IMG/M |
3300022217|Ga0224514_10268356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 619 | Open in IMG/M |
3300022221|Ga0224506_10028393 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2933 | Open in IMG/M |
3300022221|Ga0224506_10239753 | Not Available | 827 | Open in IMG/M |
3300022221|Ga0224506_10528650 | All Organisms → cellular organisms → Archaea | 511 | Open in IMG/M |
3300022223|Ga0224501_10452090 | All Organisms → cellular organisms → Archaea | 624 | Open in IMG/M |
3300022551|Ga0212089_10014130 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 5318 | Open in IMG/M |
3300022551|Ga0212089_10547639 | All Organisms → cellular organisms → Archaea | 509 | Open in IMG/M |
3300022551|Ga0212089_10558759 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 502 | Open in IMG/M |
(restricted) 3300022938|Ga0233409_10126562 | Not Available | 827 | Open in IMG/M |
3300024263|Ga0209978_10001229 | All Organisms → cellular organisms → Archaea | 10619 | Open in IMG/M |
3300024263|Ga0209978_10032497 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2597 | Open in IMG/M |
3300024263|Ga0209978_10049488 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Roizmanbacteria → Candidatus Roizmanbacteria bacterium GW2011_GWA2_35_8 | 2120 | Open in IMG/M |
3300024263|Ga0209978_10228771 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 940 | Open in IMG/M |
3300024263|Ga0209978_10237572 | All Organisms → cellular organisms → Archaea | 920 | Open in IMG/M |
3300024263|Ga0209978_10523284 | All Organisms → cellular organisms → Archaea | 563 | Open in IMG/M |
3300024353|Ga0209979_1093594 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1251 | Open in IMG/M |
3300024432|Ga0209977_10337398 | All Organisms → cellular organisms → Archaea | 721 | Open in IMG/M |
(restricted) 3300024528|Ga0255045_10123283 | All Organisms → cellular organisms → Archaea | 964 | Open in IMG/M |
(restricted) 3300024529|Ga0255044_10161892 | All Organisms → cellular organisms → Archaea | 862 | Open in IMG/M |
3300025143|Ga0209314_10264713 | All Organisms → cellular organisms → Archaea | 547 | Open in IMG/M |
3300025164|Ga0209521_10618906 | All Organisms → cellular organisms → Archaea | 541 | Open in IMG/M |
3300025167|Ga0209642_10568492 | All Organisms → cellular organisms → Archaea | 620 | Open in IMG/M |
3300025314|Ga0209323_10542831 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 668 | Open in IMG/M |
3300027742|Ga0209121_10051189 | All Organisms → cellular organisms → Archaea | 2117 | Open in IMG/M |
3300027742|Ga0209121_10095679 | Not Available | 1281 | Open in IMG/M |
3300027742|Ga0209121_10105964 | All Organisms → cellular organisms → Archaea | 1180 | Open in IMG/M |
(restricted) 3300027856|Ga0255054_10028511 | All Organisms → cellular organisms → Archaea | 2836 | Open in IMG/M |
(restricted) 3300027881|Ga0255055_10249699 | Not Available | 962 | Open in IMG/M |
(restricted) 3300027881|Ga0255055_10357952 | All Organisms → cellular organisms → Archaea | 787 | Open in IMG/M |
3300027888|Ga0209635_10030430 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 4373 | Open in IMG/M |
3300027888|Ga0209635_10157788 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 1856 | Open in IMG/M |
3300027888|Ga0209635_10329216 | All Organisms → cellular organisms → Archaea | 1206 | Open in IMG/M |
3300027888|Ga0209635_10462418 | All Organisms → cellular organisms → Archaea | 975 | Open in IMG/M |
3300027888|Ga0209635_10801547 | All Organisms → cellular organisms → Archaea | 675 | Open in IMG/M |
3300027888|Ga0209635_11116135 | All Organisms → cellular organisms → Archaea | 533 | Open in IMG/M |
3300027893|Ga0209636_10058199 | All Organisms → cellular organisms → Archaea | 3805 | Open in IMG/M |
3300027893|Ga0209636_10341773 | All Organisms → cellular organisms → Archaea | 1298 | Open in IMG/M |
3300027893|Ga0209636_10846761 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 693 | Open in IMG/M |
3300027893|Ga0209636_10966259 | All Organisms → cellular organisms → Archaea | 630 | Open in IMG/M |
3300027893|Ga0209636_11033907 | Not Available | 599 | Open in IMG/M |
3300027893|Ga0209636_11204018 | All Organisms → cellular organisms → Archaea | 534 | Open in IMG/M |
3300027893|Ga0209636_11208788 | All Organisms → cellular organisms → Archaea | 532 | Open in IMG/M |
3300027893|Ga0209636_11255611 | All Organisms → cellular organisms → Archaea | 517 | Open in IMG/M |
3300027901|Ga0209427_10103128 | Not Available | 2544 | Open in IMG/M |
3300027901|Ga0209427_10104309 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2526 | Open in IMG/M |
3300027901|Ga0209427_10118639 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2328 | Open in IMG/M |
3300027901|Ga0209427_10305256 | All Organisms → cellular organisms → Archaea | 1269 | Open in IMG/M |
3300027901|Ga0209427_10868348 | All Organisms → cellular organisms → Archaea | 630 | Open in IMG/M |
3300028167|Ga0268285_1071064 | All Organisms → cellular organisms → Archaea | 815 | Open in IMG/M |
3300028920|Ga0272441_11095119 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon RBG_13_38_9 | 601 | Open in IMG/M |
3300031255|Ga0315554_1084391 | All Organisms → cellular organisms → Archaea | 1202 | Open in IMG/M |
3300031257|Ga0315555_1014011 | All Organisms → cellular organisms → Archaea | 4875 | Open in IMG/M |
3300031275|Ga0307437_1209578 | All Organisms → cellular organisms → Archaea | 518 | Open in IMG/M |
3300031351|Ga0307427_1165008 | All Organisms → cellular organisms → Archaea | 503 | Open in IMG/M |
3300031355|Ga0307421_1219800 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 560 | Open in IMG/M |
3300031357|Ga0307435_1033565 | All Organisms → cellular organisms → Archaea | 1380 | Open in IMG/M |
3300031379|Ga0307434_1063072 | All Organisms → cellular organisms → Archaea | 1132 | Open in IMG/M |
3300031551|Ga0315548_1212106 | All Organisms → cellular organisms → Archaea | 611 | Open in IMG/M |
(restricted) 3300031587|Ga0315308_1012969 | All Organisms → cellular organisms → Archaea | 4297 | Open in IMG/M |
(restricted) 3300031587|Ga0315308_1082428 | Not Available | 1355 | Open in IMG/M |
(restricted) 3300031587|Ga0315308_1146137 | Not Available | 923 | Open in IMG/M |
(restricted) 3300031587|Ga0315308_1248277 | All Organisms → cellular organisms → Archaea | 634 | Open in IMG/M |
(restricted) 3300031587|Ga0315308_1308951 | All Organisms → cellular organisms → Archaea | 540 | Open in IMG/M |
(restricted) 3300031593|Ga0315307_1023720 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2494 | Open in IMG/M |
(restricted) 3300031593|Ga0315307_1069665 | All Organisms → cellular organisms → Archaea | 1306 | Open in IMG/M |
(restricted) 3300031604|Ga0315309_1115503 | All Organisms → cellular organisms → Archaea | 1127 | Open in IMG/M |
(restricted) 3300031604|Ga0315309_1197767 | Not Available | 778 | Open in IMG/M |
3300031620|Ga0315552_1132685 | All Organisms → cellular organisms → Archaea | 821 | Open in IMG/M |
3300031698|Ga0315537_1074249 | All Organisms → cellular organisms → Archaea | 1751 | Open in IMG/M |
3300031698|Ga0315537_1381680 | Not Available | 530 | Open in IMG/M |
3300031772|Ga0315288_10248475 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1894 | Open in IMG/M |
(restricted) 3300031806|Ga0315306_10038413 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 1892 | Open in IMG/M |
(restricted) 3300031806|Ga0315306_10049469 | All Organisms → cellular organisms → Archaea | 1646 | Open in IMG/M |
(restricted) 3300031806|Ga0315306_10097881 | Not Available | 1126 | Open in IMG/M |
(restricted) 3300031806|Ga0315306_10158083 | Not Available | 853 | Open in IMG/M |
(restricted) 3300031806|Ga0315306_10258415 | All Organisms → cellular organisms → Archaea | 633 | Open in IMG/M |
(restricted) 3300031806|Ga0315306_10364564 | All Organisms → cellular organisms → Archaea | 509 | Open in IMG/M |
3300031862|Ga0315280_10407958 | All Organisms → cellular organisms → Archaea | 623 | Open in IMG/M |
3300031862|Ga0315280_10429706 | All Organisms → cellular organisms → Archaea | 597 | Open in IMG/M |
(restricted) 3300031876|Ga0315310_10057772 | All Organisms → cellular organisms → Archaea | 2043 | Open in IMG/M |
(restricted) 3300031876|Ga0315310_10071628 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1777 | Open in IMG/M |
(restricted) 3300031876|Ga0315310_10202715 | All Organisms → cellular organisms → Archaea | 889 | Open in IMG/M |
(restricted) 3300031876|Ga0315310_10339215 | All Organisms → cellular organisms → Archaea | 622 | Open in IMG/M |
(restricted) 3300031876|Ga0315310_10382142 | Not Available | 572 | Open in IMG/M |
(restricted) 3300031876|Ga0315310_10407744 | All Organisms → cellular organisms → Archaea | 547 | Open in IMG/M |
(restricted) 3300031877|Ga0315314_1173736 | All Organisms → cellular organisms → Archaea | 798 | Open in IMG/M |
(restricted) 3300031877|Ga0315314_1240294 | All Organisms → cellular organisms → Archaea | 623 | Open in IMG/M |
(restricted) 3300031877|Ga0315314_1268588 | All Organisms → cellular organisms → Archaea | 573 | Open in IMG/M |
(restricted) 3300031898|Ga0315312_1000477 | All Organisms → cellular organisms → Archaea | 46939 | Open in IMG/M |
3300031999|Ga0315274_11145292 | All Organisms → cellular organisms → Archaea | 777 | Open in IMG/M |
3300032046|Ga0315289_10214196 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2087 | Open in IMG/M |
3300032173|Ga0315268_10017600 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 7151 | Open in IMG/M |
3300032173|Ga0315268_10057989 | All Organisms → cellular organisms → Archaea | 3656 | Open in IMG/M |
3300032262|Ga0316194_11002582 | All Organisms → cellular organisms → Archaea | 526 | Open in IMG/M |
3300032263|Ga0316195_10816481 | Not Available | 502 | Open in IMG/M |
3300033429|Ga0316193_10900963 | All Organisms → cellular organisms → Archaea → TACK group | 704 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 22.64% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 20.13% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 11.95% |
Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 4.40% |
Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 3.77% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 3.14% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 3.14% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.14% |
Sediment, Intertidal | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal | 3.14% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 3.14% |
Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 3.14% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.52% |
Marine Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment | 2.52% |
Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 1.89% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.26% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.26% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.26% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.63% |
Marine Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment | 0.63% |
Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents | 0.63% |
Marine Hydrothermal Vent Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent Sediment | 0.63% |
Hot Spring Fe-Si Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Fe-Si Sediment | 0.63% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.63% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.63% |
Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.63% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.63% |
Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 0.63% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000393 | GB background transcript assembly | Environmental | Open in IMG/M |
3300001749 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 | Environmental | Open in IMG/M |
3300001751 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 | Environmental | Open in IMG/M |
3300001752 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 | Environmental | Open in IMG/M |
3300001753 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-24_28 | Environmental | Open in IMG/M |
3300001782 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_deep_samples | Environmental | Open in IMG/M |
3300001854 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 | Environmental | Open in IMG/M |
3300002053 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_SMTZ | Environmental | Open in IMG/M |
3300002530 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_3 | Environmental | Open in IMG/M |
3300003332 | Marine hydrothermal vent sediment microbial communities from Guaymas Basin, Gulf of California - Sample 1 | Environmental | Open in IMG/M |
3300005782 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf, PM3 | Environmental | Open in IMG/M |
3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
3300007896 | Microbial communities from sediment of the River Tyne Estuary, UK ? Live_176d_3 | Environmental | Open in IMG/M |
3300008517 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 175 cmbsf. Combined Assembly of Gp0128389 and Gp0131431 MM4PM4 | Environmental | Open in IMG/M |
3300009034 | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea | Environmental | Open in IMG/M |
3300009136 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsf | Environmental | Open in IMG/M |
3300009150 | Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG | Environmental | Open in IMG/M |
3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
3300009499 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG | Environmental | Open in IMG/M |
3300009528 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG | Environmental | Open in IMG/M |
3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
3300009943 | Combined Assembly of Gp0139325, Gp0139347, Gp0139348 | Environmental | Open in IMG/M |
3300010324 | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I18A1 metaG | Environmental | Open in IMG/M |
3300010328 | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I19B2 metaG | Environmental | Open in IMG/M |
3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
3300018070 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1 | Environmental | Open in IMG/M |
3300019736 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_5-6_MG | Environmental | Open in IMG/M |
3300022217 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24 | Environmental | Open in IMG/M |
3300022221 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1 | Environmental | Open in IMG/M |
3300022223 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_8_1 | Environmental | Open in IMG/M |
3300022551 | Boni_combined assembly | Environmental | Open in IMG/M |
3300022938 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MG | Environmental | Open in IMG/M |
3300024263 | Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024353 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024432 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
3300025143 | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I19B2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
3300025314 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2 | Environmental | Open in IMG/M |
3300027742 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
3300027856 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23 | Environmental | Open in IMG/M |
3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
3300027893 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes) | Environmental | Open in IMG/M |
3300027901 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes) | Environmental | Open in IMG/M |
3300028167 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_120m | Environmental | Open in IMG/M |
3300028920 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6N | Environmental | Open in IMG/M |
3300031255 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-70 | Environmental | Open in IMG/M |
3300031257 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-80 | Environmental | Open in IMG/M |
3300031275 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-90 | Environmental | Open in IMG/M |
3300031351 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-190 | Environmental | Open in IMG/M |
3300031355 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-70 | Environmental | Open in IMG/M |
3300031357 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-70 | Environmental | Open in IMG/M |
3300031379 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-220 | Environmental | Open in IMG/M |
3300031551 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-110 | Environmental | Open in IMG/M |
3300031587 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP3 | Environmental | Open in IMG/M |
3300031593 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP2 | Environmental | Open in IMG/M |
3300031604 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP4 | Environmental | Open in IMG/M |
3300031620 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-70 | Environmental | Open in IMG/M |
3300031698 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-70 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031806 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP1 | Environmental | Open in IMG/M |
3300031862 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40 | Environmental | Open in IMG/M |
3300031876 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP5 | Environmental | Open in IMG/M |
3300031877 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP9 | Environmental | Open in IMG/M |
3300031898 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP7 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032262 | Coastal sediment microbial communities from Maine, United States - Cross River sediment 1 | Environmental | Open in IMG/M |
3300032263 | Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1 | Environmental | Open in IMG/M |
3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
WOR_1025593 | 3300000393 | Hydrothermal Vents | MGRQERCPQCGSKKIVIADDLKKCKVCRYEWTGKPRGKTSKKDKVRF* |
JGI24025J20009_100638242 | 3300001749 | Marine | MGRKERCPQCGSKKITIIGNLKKCNVCKYEWTGKPRKKTSKKEKVRF* |
JGI24025J20009_100971522 | 3300001749 | Marine | MGRKERCPQCGSKKIRITANQKECKVCKNTWAGKLGGKTPKKEKVRF* |
JGI2172J19969_100094723 | 3300001751 | Marine Sediment | MGRKERCPQCGSKKIAITDNLKKCRVCKYEWTGKPKGKACKKDKVRF* |
JGI2172J19969_100553494 | 3300001751 | Marine Sediment | MGRKERCPRCGSKKFTITANQKECEICKFTWTGKSGRKTSKKEEVRF* |
JGI2172J19969_100892533 | 3300001751 | Marine Sediment | MGRQERCPQCRSKKIVIIDDLKKCKVCRYXWTGKPRGKTSKKDKVRF* |
JGI2172J19969_101549222 | 3300001751 | Marine Sediment | MGRKERCPRCGSKKFRITANQKECKVCKFTWTGKSGRKTSKKEKVRF* |
JGI2173J19968_102097392 | 3300001752 | Marine Sediment | MGRKERCPRCGSRKIRITANQKECKVCKNIWTGKVGGKTIKKGKIRF* |
JGI2171J19970_100870461 | 3300001753 | Marine Sediment | MGRKERCPRCGSKKITITANQKECKVCKFTWTGKSGGKTSKKEKV |
JGI2171J19970_102316012 | 3300001753 | Marine Sediment | MGRKERCPRCGSKKFRITANQKECEVCKFTWTGKSGRKTSKKEKVRF* |
JGI2171J19970_102548981 | 3300001753 | Marine Sediment | MGRKERCPRCGSKKIKITANQKECKVCKFTWTGKFGGKTSKKEKVRF* |
WOR52_100262031 | 3300001782 | Marine Sediment | CPHCGSKKIKITDDVKKCRVCKYEWTGKPRGKTSKKEKVRF* |
WOR52_100383203 | 3300001782 | Marine Sediment | LMGRKERCPQCGSKKITIAGNLKKCKVCKYEWTGKPRRKTHKKEKVRF* |
JGI24422J19971_100446033 | 3300001854 | Marine Sediment | MGRKERCPRCGSKKIRITANQKECKVCKNTWTGKLGGKTSKKEKVRF* |
JGI24422J19971_100644604 | 3300001854 | Marine Sediment | MGRQERCPQCGSKKIVITDYLKKCKVCKYEWTGKPRGKTSKKDKVRF* |
JGI24422J19971_100667641 | 3300001854 | Marine Sediment | CGSKKITITANQKECKVCKFTWTAKSGGKTYKKEKVRF* |
JGI24422J19971_101093492 | 3300001854 | Marine Sediment | MGRKERCPRCGSKKIKIAANQKECKVCKYVWAGKLGGKTSKKEKVRF* |
JGI24422J19971_101663542 | 3300001854 | Marine Sediment | MGRKERCPQCGSKKIVTTGDPKKCNVCRYEWTGKPRGKTPKKQKVRF* |
JGI24422J19971_101834451 | 3300001854 | Marine Sediment | MGRKERCPRCGGKKITITANQKECKVCKFTWTGKSGGKTYKKE |
JGI24422J19971_101917374 | 3300001854 | Marine Sediment | MGRQERCPQCGSKKIVIAADLKKCKVCRYEWAGKPRGKTSKKDKVRF* |
JGI24422J19971_103107521 | 3300001854 | Marine Sediment | MGRQERCPQCGSKKITITENLKKCAICKYAWSGKPRGKTSKKEKFRF* |
JGI24422J19971_103326451 | 3300001854 | Marine Sediment | MGRQERCPQCGSKKIVIADDLKECKVCKYEWTGKPRGKTSKKDKVRF* |
SMTZ23_1001111620 | 3300002053 | Marine Sediment | MGRKERCPQCGSKKITIIGNLKKCNVCKHEWTGKPRKKTLKKEKVRF* |
SMTZ23_100406075 | 3300002053 | Marine Sediment | MGRKERCPHCGSKKIKITDDLKKCRVCKYEWTRKPRGKTSKKEKVRF* |
C687J35503_100769691 | 3300002530 | Soil | MGRKERCLHCGSKKITITGNLKKCEVCKYEWAGKPRKKTSKKEKIRF* |
GBSed_100041999 | 3300003332 | Marine Hydrothermal Vent Sediment | MGRKERCPQCGSKKITITENLKKCKVCKFEWSGKPKEKTAKKEKVRF* |
Ga0079367_10283307 | 3300005782 | Marine Sediment | MGRKERCPRCGSKKIKIAANQKECKVCKYAWAGKHGGKTSKKDKVRF* |
Ga0079367_11987972 | 3300005782 | Marine Sediment | MGRKERCPRCGSKKIMITANQKECKVCKNTWAGKLGGKTSKKEKVRF* |
Ga0074469_110181494 | 3300005832 | Sediment (Intertidal) | MGRKERCPQCGSKKITIAGNLKKCNVCKYEWGGKPRGKTSKRK |
Ga0111484_10973401 | 3300007896 | Sediment | MGRQEQCPRCGSKKIIITTNEKECKVCKNTWSGKVGGKTAKKGKVRF* |
Ga0111034_10535941 | 3300008517 | Marine Sediment | MGRKERCPRCGSKKIKIAANQKECKVCKYTWAGKLGGKTSKKDKVRF* |
Ga0111034_10850384 | 3300008517 | Marine Sediment | MGRKERCPRCGSKKIKIAANQKECKVCKYAWAGKLGGKTSKKDKVRF* |
Ga0115863_10459904 | 3300009034 | Sediment, Intertidal | MGRKERCPQCGSKKITVAGNLKKCKVCKYEWTGKPRGKTSKKEKVRF* |
Ga0115863_10517252 | 3300009034 | Sediment, Intertidal | MGRKEQCPQCGSKKITITGNLKKCKVCKYEWAGKPGGKTPKKEKVRF* |
Ga0115863_12387833 | 3300009034 | Sediment, Intertidal | PHCGSKKITITGILKKCKVCKYEWSGKPGGKTPKKEKVRF* |
Ga0115863_12533252 | 3300009034 | Sediment, Intertidal | MGRKERCPHCGSKKITIAEDVKKCKVCKYEWSGKPREKTPKKEKVRF* |
Ga0115863_17526013 | 3300009034 | Sediment, Intertidal | MGRKERCPQCGSKKFTITANQKECKVCKFTWTGKPGGKTSKKEKVRF* |
Ga0118735_101318951 | 3300009136 | Marine Sediment | MGRKERCPRCGSKKIRITANQKECKVCKNTWAGKLGGKTPKKEKVRF* |
Ga0114921_102151932 | 3300009150 | Deep Subsurface | MGRKERCPQCGSKKIAITGNLKKCKVCKYEWEGKPRGKTSKKEKVRF* |
Ga0114921_105273742 | 3300009150 | Deep Subsurface | MGRKERCPHCGSKKITITEDVKKCKVCKYEWSGKPREKTPKKEKVRF* |
Ga0114921_106854711 | 3300009150 | Deep Subsurface | MGRKERCPQCGSKKFTITANQKECKVCKFTWTGKPGGKTFKKEKVRF* |
Ga0114921_110302901 | 3300009150 | Deep Subsurface | ERCPQCGSKKIVITGDLKKCKVCKYEWTGRPRRKTPKKQKIRF* |
Ga0114925_102565531 | 3300009488 | Deep Subsurface | MGRKEQCPRCGSKKIRITANQKECKVCKNTWAGKLG |
Ga0114930_100660282 | 3300009499 | Deep Subsurface | MGRKERYPKCGSKKFIITANQKECKVCKNTWAGKVGGKTAKKGKVRF* |
Ga0114930_102362941 | 3300009499 | Deep Subsurface | MGRKERCPRCGSRKIRITANQKECKVCKNTWTGKLGGKTSKKEKVRF* |
Ga0114930_105231202 | 3300009499 | Deep Subsurface | KEQSPKCGSKKIIKTTNQKECKVCKNTWTGKVGGKTSKKGKVRF* |
Ga0114920_103730652 | 3300009528 | Deep Subsurface | MGRKEQCPKCGSKKIKITTNQKECKVCKNTWTGKVGGKTSKKGKVRF* |
Ga0114920_111651991 | 3300009528 | Deep Subsurface | KCGSKKIRITANQKECNVCKNTWAGKLGGKTSKKEKVRF* |
Ga0114919_100353614 | 3300009529 | Deep Subsurface | MEQTGMGRKERCPQCGSKKIIITEELKKCKVCKYEWTGRPGGKTLKKDKVRF* |
Ga0117933_10670731 | 3300009943 | Hot Spring Fe-Si Sediment | MGRKERCPNCGSKKITITGNLKKCKVCKYEWSGKPGGKTPKKEKVRF* |
Ga0129297_100739332 | 3300010324 | Lake Sediment | MGRKERCPQCGSKKITITGNLKKCEVCKYEWAGKPRRKTSKKEKIRF* |
Ga0129297_104981621 | 3300010324 | Lake Sediment | MGRKERCPQCGSKKITITGNLKKCEVCKYEWAGRPKRKTSKKEKTRF* |
Ga0129298_100874754 | 3300010328 | Lake Sediment | MGRKERCPQCGSKKITITENMKKCEICKYAWSGKPTKKTS |
Ga0118733_1068640872 | 3300010430 | Marine Sediment | MGRKEQCPKCGSKKIIITKNQKECKVCKNTWAGKVGGKTS |
Ga0153915_107133842 | 3300012931 | Freshwater Wetlands | MGRKERCPQCGSKKITITGNLKKCEVCKYAWAGKAGRKTSKKEKVRF* |
Ga0153916_101132693 | 3300012964 | Freshwater Wetlands | MGRKERCPQCGSKKITMAGNVKKCEVCKHEWVGKPGRKTSKKERTRF* |
Ga0153916_110770823 | 3300012964 | Freshwater Wetlands | MGRKERCPQCGSKKIALTGNLKKCEVCKHEWAGKLGRKTSKKEKTRF* |
Ga0153916_115231531 | 3300012964 | Freshwater Wetlands | MGRKERCPQCGSKKITLTGNLKKCEVCKHEWAGKPGRKTS |
Ga0153916_122239931 | 3300012964 | Freshwater Wetlands | KITLTGNLKKCEVCKHEWAGKPGRKTSKKEKTRF* |
Ga0164321_101039221 | 3300014903 | Marine Sediment | MGRKEQCPKCGSKKIIITTNQKECKVCKNTWAGKVGGKTSKKGKVRF* |
Ga0164321_104745651 | 3300014903 | Marine Sediment | MGRKEQCPKCGSKKIGTTVNQKECKVCKNIWTGKVGHKTSKRGKVRF* |
Ga0184631_100367803 | 3300018070 | Groundwater Sediment | MGRKERCLHCGSKKITITGNLKKCEVCKYEWAGKPRKKTSKKEKIRF |
Ga0194019_10670722 | 3300019736 | Sediment | MGRKERCPRCGSKKIKIAANQKECKVCKFTWTGKSGGKTSKKDKVRF |
Ga0224514_102683562 | 3300022217 | Sediment | MGRKERCPQCGSKKITIAGNLKKCNVCKYEWTGKPR |
Ga0224506_100283931 | 3300022221 | Sediment | MGRKERCPQCGSKKITIAGNLKKCNVCKYEWGGKPR |
Ga0224506_102397532 | 3300022221 | Sediment | MGRKERCPQCGSKKITIAGNLKKCNVCKYEWGGKP |
Ga0224506_105286501 | 3300022221 | Sediment | MGRKERCPRCGSKKIKIAANQKECKVCKYAWAGKYGGKTSKKDKVRF |
Ga0224501_104520903 | 3300022223 | Sediment | MGRKERCPHCGSKKITITGDLKKCKVCKYEWAGKPRKGTPKKEKVRF |
Ga0212089_100141305 | 3300022551 | Lake Sediment | MGRKERCPQCGSKKITITGNLKKCEVCKYEWAGKPRRKTSKKEKIRF |
Ga0212089_105476392 | 3300022551 | Lake Sediment | MGRKERCPQCGSKKITITENMKKCEICKYAWSGKPTKKASKKEKVRF |
Ga0212089_105587591 | 3300022551 | Lake Sediment | PQCGSKKITITGNLKKCTICKYAWAGKPGRKTSKKERVRF |
(restricted) Ga0233409_101265621 | 3300022938 | Seawater | MGRKEQCPKCGSKKIIITTNQKECKVCKNTWAGKVGGKTSKKGKVRF |
Ga0209978_1000122913 | 3300024263 | Deep Subsurface | MGRKERCPHCGSKKITITEDVKKCKVCKYEWSGKPREKTPKKEKVRF |
Ga0209978_100324973 | 3300024263 | Deep Subsurface | MGRKERCPQCGSKKIAITGNLKKCKVCKYEWEGKPRGKTSKKEKVRF |
Ga0209978_100494881 | 3300024263 | Deep Subsurface | MGRQERCPQCGSKKIVITGDLKKCKVCKYEWTGKPRGK |
Ga0209978_102287712 | 3300024263 | Deep Subsurface | MGRKERCPQCGSKKITITGNLKKCRVCKYEWTGKPGGKTP |
Ga0209978_102375722 | 3300024263 | Deep Subsurface | MGRKERCPHCGSKKITIAEDVKKCKVCKYEWSGKPREKTPKKEKVRF |
Ga0209978_105232841 | 3300024263 | Deep Subsurface | MGRKERCPQCGSKKFTITANQKECKVCKFTWTGKPGGKTFKKDKIRF |
Ga0209979_10935942 | 3300024353 | Deep Subsurface | MGRKERYPKCGSKKFIITANQKECKVCKNTWAGKVGGKTAKKGKVRF |
Ga0209977_103373981 | 3300024432 | Deep Subsurface | MGRKEQCPRCGSKKIRITANQKECKVCKNTWAGKLGGKTPKKEKVRF |
(restricted) Ga0255045_101232831 | 3300024528 | Seawater | MGRKEQCPKCGSKKIGTTVNQKECKVCKNIWTGKVGHKTSKRGKVRF |
(restricted) Ga0255044_101618922 | 3300024529 | Seawater | MGRKERCPKCGSKKIIISTNQKECKVCKNTWAGKVGGKTSKKGKVRF |
Ga0209314_102647132 | 3300025143 | Lake Sediment | MGRKERCPQCGSKKITITENMKKCEICKYAWAGKPTKKTSKKEKVRF |
Ga0209521_106189061 | 3300025164 | Soil | LHCGSKKITITGNLKKCEVCKYEWAGKPRKKTSKKEKIRF |
Ga0209642_105684922 | 3300025167 | Soil | MGRKERCPQCGSKKITITGNLKKCEVCKYEWAGKPGRKTSKKEKIRF |
Ga0209323_105428312 | 3300025314 | Soil | MGRKERCLHCGSKKITITGNLKKCEVCKYEWAGKPRKKTS |
Ga0209121_100511892 | 3300027742 | Marine | MGRKERCPQCGSKKIRITANQKECKVCKNTWAGKLGGKTPKKEKVRF |
Ga0209121_100956791 | 3300027742 | Marine | MGRKERCPRCGSKKIKIAANQKECKVCKYTWAGKLGGKTSKKEKVRF |
Ga0209121_101059641 | 3300027742 | Marine | MGRKERCPQCGSKKIDVTDNLKKCRVCKYEWTGKPKAKTSKKDKVR |
(restricted) Ga0255054_100285113 | 3300027856 | Seawater | MGRKEQCPKCGSKKIIITKNQKECKVCKNTWAGKVGGKTSKKGKVRF |
(restricted) Ga0255055_102496992 | 3300027881 | Seawater | MGRTEQCPKCGSKKIKITTNQKECKVCKNIWTGKVGGKTSKKGKVRF |
(restricted) Ga0255055_103579522 | 3300027881 | Seawater | MGRKEQCPKCGSKKIIIITNQKECKVCKNIWAGKVGGKTSKKGKVRF |
Ga0209635_100304301 | 3300027888 | Marine Sediment | MGRKERCSRCGSKKIKITANQKECKVCKNTWAGKVGGKTSKKEKFDS |
Ga0209635_101577881 | 3300027888 | Marine Sediment | MGRKERCPRCGSKKFTITANQKECEICKFTWTGKSGRKTSKKEEVRF |
Ga0209635_103292161 | 3300027888 | Marine Sediment | MVRKERCPRCGSKKIKVTANQKECKVCKNIWTGKVGGKTSKKGKVRF |
Ga0209635_104624182 | 3300027888 | Marine Sediment | MGRKERCPRCGSKKITINANQKECKVCKFTWTGKSGGKTSKKEKVRF |
Ga0209635_108015471 | 3300027888 | Marine Sediment | MGRKERCPRCGSKKIRITANQKECKVCKFTWTGKSGGKKSKKE |
Ga0209635_111161352 | 3300027888 | Marine Sediment | MGRKERCPHCGSKKIKITDDVKKCRVCKYEWTGKPRGKTSKK |
Ga0209636_100581995 | 3300027893 | Marine Sediment | MGRKERCPRFGSKKIKIAANQKECKVCKYAWAGKLGGKTSKKDKVRF |
Ga0209636_103417732 | 3300027893 | Marine Sediment | MGRKERCPRCGSKKIRITANQKECKVCKFTWTGKSGGKKSKKEKVRF |
Ga0209636_108467612 | 3300027893 | Marine Sediment | KQMGRKERCPQCGSKKITITGNLKKCNVCKYEWTGKPRGKTSKKQKVRF |
Ga0209636_109662592 | 3300027893 | Marine Sediment | MGRKERCPRCGSKKIKITANQKECKVCKFTWTGKFGGKTSKKEKVRF |
Ga0209636_110339071 | 3300027893 | Marine Sediment | MGRKERCSRCGSKKIKITANQKECKVCKNTWAGKVGGKTSKKEKVRF |
Ga0209636_112040181 | 3300027893 | Marine Sediment | MGRTERCPKCGSKKITITENLKKCKVCKYEWTGKHRAKTSKKDKVRF |
Ga0209636_112087882 | 3300027893 | Marine Sediment | MGRKERCPQCGSKKITITANQKECKVCKFTWTAKSGGKTYKKE |
Ga0209636_112556111 | 3300027893 | Marine Sediment | MGRKERCPRCGSKKIRITANQKECKVCKNTWSGKLGGKTSKKEKVRF |
Ga0209427_101031284 | 3300027901 | Marine Sediment | RSRKIRITANQKECKVCKFTWTGKLGGKTSKKEKVRF |
Ga0209427_101043091 | 3300027901 | Marine Sediment | MGRKERCPRCGSKKIKITANQKECKVCKNTWAGKVGGKTSKKEKVRF |
Ga0209427_101186393 | 3300027901 | Marine Sediment | MGRKERCPQCGSKKITIAGNLKKCNVCKYEWTGKPRGKTS |
Ga0209427_103052563 | 3300027901 | Marine Sediment | MGRKERCPRCGSRKIRITANQKECKVCKNIWTGKVGGKTIKKGKIRF |
Ga0209427_108683481 | 3300027901 | Marine Sediment | MGRKERCPRCGSKKIRITANQKECKVCKNTWTGKLGGKTSKKEKVRF |
Ga0268285_10710642 | 3300028167 | Saline Water | MGRKERCPRCGSKKFTITANQKECKVCKFTWTGKSGGKTSKKDK |
Ga0272441_110951191 | 3300028920 | Marine Sediment | ERCPRCGSKKIKITANQKECNVCKNIWTGKVGGKTSKKGKVRF |
Ga0315554_10843911 | 3300031255 | Salt Marsh Sediment | MGRKERCPRCGSKKFTITANQKECKVCKNTWAGKPGGKT |
Ga0315555_10140112 | 3300031257 | Salt Marsh Sediment | MGRKERCPRCGSKKIKIAANEKECKVCKYTWAGKLGGKTSKKDKVRF |
Ga0307437_12095782 | 3300031275 | Salt Marsh | TDGADGFMGRKERCPQCGSKKITIIGNLKKCNVCKYEWTGKPRKKTSKKEKVRF |
Ga0307427_11650081 | 3300031351 | Salt Marsh | MGRKERCPRCGSKKFTITANQKECKVCKFTWTGKS |
Ga0307421_12198001 | 3300031355 | Salt Marsh | CGSKKFTITANQKECKVCKNTWAGKSGGKTSKKDKVRF |
Ga0307435_10335651 | 3300031357 | Salt Marsh | MGRKERCPRCGSKKFTITANQKECKVCKFTWTGKSGGKTSKKDKVR |
Ga0307434_10630721 | 3300031379 | Salt Marsh | MGRKERCPRCGSKKFTITANQKECKVCKFTWTGKSGGKTS |
Ga0315548_12121061 | 3300031551 | Salt Marsh Sediment | MGRKERCPRCGSKKITITANQKECKVCKHAWAGKSGGKTSKKEKVRF |
(restricted) Ga0315308_10129694 | 3300031587 | Sediment | MGRKERCPQCGSKKITITGNLKKCEVCKYEWAGKPGRKTSKKEKTRFR |
(restricted) Ga0315308_10824281 | 3300031587 | Sediment | MGRKERCPQCGSKKITITGNVKKCEVCKYAWAGKPGRKTSKKEKIRF |
(restricted) Ga0315308_11461371 | 3300031587 | Sediment | QCGSKKITIIENLKKCEICKYAWSGKPTKKASKKEKVRF |
(restricted) Ga0315308_12482773 | 3300031587 | Sediment | MGRKEQCPQCGSKKITITENLKKCNVCKYAWTGKPR |
(restricted) Ga0315308_13089511 | 3300031587 | Sediment | MGRKERCPVCGSKKITIAEDLKRCKVCKYEWAGKPRRKTSKKEKTRF |
(restricted) Ga0315307_10237202 | 3300031593 | Sediment | MGRKERCPQCGSKKITITGNVKKCEVCKREWVGKLGRKTSKKEKTRF |
(restricted) Ga0315307_10696651 | 3300031593 | Sediment | RKERCPQCGSKKITITGNLKKCEVCKYEWAGKPRRKTSKKEKTRF |
(restricted) Ga0315309_11155031 | 3300031604 | Sediment | MGRKERCPQCGSKKITITGSLKKCEVCKYEWAGKPGRKTS |
(restricted) Ga0315309_11977671 | 3300031604 | Sediment | ERCPQCGSKKITITENMKKCEICKYAWSGKPTKKASKKEKVRF |
Ga0315552_11326852 | 3300031620 | Salt Marsh Sediment | MGRKERCPRCGSKKIKITANQKECKVYKFTWTGKSGG |
Ga0315537_10742493 | 3300031698 | Salt Marsh Sediment | MGRKERCPRCGSKKIKITANQKECKVYKFTWTGKSGGKTSKKEKVRF |
Ga0315537_13816801 | 3300031698 | Salt Marsh Sediment | MGRKERCPQCGSKKIMIIGNLKKCNVCKYEWTGKPRKKTSK |
Ga0315288_102484752 | 3300031772 | Sediment | MGRKERCLHCGSKKITITGNLKKCEVCKYEWAGKPRKKTSKKEKTRF |
(restricted) Ga0315306_100384134 | 3300031806 | Sediment | MGRKERCPQCGSKKITITENMKTCKICKYTWAGKPGKKTSKKEKVRF |
(restricted) Ga0315306_100494691 | 3300031806 | Sediment | MGRKEQCPQCGSKKITITENLKKCEICKYAWAGKPRKKTSKKEKVRF |
(restricted) Ga0315306_100978812 | 3300031806 | Sediment | MGRKERCPQCGSKKITITENLKKCKICKYAWTGRLGKKTSKKEKVRF |
(restricted) Ga0315306_101580832 | 3300031806 | Sediment | KLMGRKERCPQCGSKKITITENMKKCEICKYAWSGKPTKKTSKKEKVRF |
(restricted) Ga0315306_102584152 | 3300031806 | Sediment | PQCGSKKITITGNLKKCEVCKYAWAGKPGRKTSKKEKIRF |
(restricted) Ga0315306_103645642 | 3300031806 | Sediment | MGRKERCPQCGSKKITITENLKTCKICKYTWAGKPGKKTSKKEKVRF |
Ga0315280_104079582 | 3300031862 | Sediment | MGRKERCPQCGSKKITITGNLKKCEVCKYEWAGKPGRKTSKKEKTRF |
Ga0315280_104297061 | 3300031862 | Sediment | MGRKERCPQCGSKKITIIGNLKKCEVCKYEWAGKPRRKTSKKEKTRF |
(restricted) Ga0315310_100577721 | 3300031876 | Sediment | KKITITGNLKKCNVCKYEWAGKPSRRTLKKEKVRF |
(restricted) Ga0315310_100716281 | 3300031876 | Sediment | MGRKERCPQCGSKKITITGNLKKCEVCKYEWAGKP |
(restricted) Ga0315310_102027152 | 3300031876 | Sediment | MGRKEQCPQCGSKKITITENMKKCEICKYVWSGKPRKKTSKKEKVRF |
(restricted) Ga0315310_103392153 | 3300031876 | Sediment | GSKKITITGNLKKCEVCKYEWAGKPRRKTSKKEKTRF |
(restricted) Ga0315310_103821422 | 3300031876 | Sediment | MGRKERCPQCGSKKITITENMKKCEICKYAWSGKPTKKTSKKEKVRF |
(restricted) Ga0315310_104077441 | 3300031876 | Sediment | MGRKERCPQCGSKKIAITENLKKCNVCKYAWTGKPRSKTSKKEK |
(restricted) Ga0315314_11737362 | 3300031877 | Sediment | KKITITGNLKKCEVCKYEWAGKPRRKTSKKEKIRF |
(restricted) Ga0315314_12402942 | 3300031877 | Sediment | MGRKERCPQCGSKKITITGNLKKCEVCKYEWAGKSRRKTSKKEKIRF |
(restricted) Ga0315314_12685882 | 3300031877 | Sediment | MGRKERCPQCGSKKITITENLKKCEVCRYEWAGKPRRKTS |
(restricted) Ga0315312_100047765 | 3300031898 | Sediment | MGRKERCPQCGSKKITITGNLKKCEVCNYAWAGKPGRKTSKKEKIRFR |
Ga0315274_111452921 | 3300031999 | Sediment | KQMGRKERCLHCGSKKITITGNLKKCEVCKYEWAGKPRKKTSKKEKIRF |
Ga0315289_102141963 | 3300032046 | Sediment | MGRKERCLQCGSKKITITGNLKKCEVCKYEWAGKPRKKTSKKEKIRF |
Ga0315268_1001760010 | 3300032173 | Sediment | MGRKERCPQCGSKKITVAGDVKKCGVCKHEWVGKSGRKTSKKEKTRF |
Ga0315268_100579891 | 3300032173 | Sediment | MGRKERCPQCGSKKITITENLKKCEVCKHEWAGKHGRKTSKKEKT |
Ga0316194_110025822 | 3300032262 | Sediment | MGRKECCPKCGSKKIGITLNQKECKVCKNIWVGRHGGKTSKKGKVRF |
Ga0316195_108164811 | 3300032263 | Sediment | MGRQEQCPRCGSKKIIIITNEKECKVCKNTWSGKVGGKTSKKGKVRF |
Ga0316193_109009631 | 3300033429 | Sediment | GRKEQCPKCGSKKIGTTLNQKECKVCKNIWTGKVGHKTSKRGKVRF |
⦗Top⦘ |