NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F041474

Metagenome / Metatranscriptome Family F041474

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F041474
Family Type Metagenome / Metatranscriptome
Number of Sequences 160
Average Sequence Length 47 residues
Representative Sequence ADEVYQQFVMVDALAQFCTDKMDLEQTVKWGEEKIKAIYAKFA
Number of Associated Samples 139
Number of Associated Scaffolds 160

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.38 %
% of genes near scaffold ends (potentially truncated) 94.38 %
% of genes from short scaffolds (< 2000 bps) 88.75 %
Associated GOLD sequencing projects 132
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(15.625 % of family members)
Environment Ontology (ENVO) Unclassified
(29.375 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(49.375 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 54.93%    β-sheet: 0.00%    Coil/Unstructured: 45.07%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 160 Family Scaffolds
PF00528BPD_transp_1 23.75
PF00005ABC_tran 16.88
PF04072LCM 7.50
PF13442Cytochrome_CBB3 4.38
PF12911OppC_N 3.75
PF08402TOBE_2 3.12
PF02627CMD 1.88
PF13416SBP_bac_8 1.88
PF00296Bac_luciferase 1.88
PF01547SBP_bac_1 1.88
PF01436NHL 1.25
PF05598DUF772 0.62
PF00903Glyoxalase 0.62
PF13011LZ_Tnp_IS481 0.62
PF07681DoxX 0.62
PF01522Polysacc_deac_1 0.62
PF01556DnaJ_C 0.62
PF00982Glyco_transf_20 0.62
PF06808DctM 0.62
PF00378ECH_1 0.62
PF00664ABC_membrane 0.62
PF01497Peripla_BP_2 0.62
PF00672HAMP 0.62
PF13683rve_3 0.62
PF12697Abhydrolase_6 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 160 Family Scaffolds
COG3315O-Methyltransferase involved in polyketide biosynthesisSecondary metabolites biosynthesis, transport and catabolism [Q] 7.50
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 1.88
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 1.88
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.88
COG0380Trehalose-6-phosphate synthase, GT20 familyCarbohydrate transport and metabolism [G] 0.62
COG0484DnaJ-class molecular chaperone with C-terminal Zn finger domainPosttranslational modification, protein turnover, chaperones [O] 0.62
COG0614ABC-type Fe3+-hydroxamate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.62
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.62
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.62
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.62
COG4558ABC-type hemin transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.62
COG4592ABC-type Fe2+-enterobactin transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.62
COG4594ABC-type Fe3+-citrate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.62
COG4607ABC-type enterochelin transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.62


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.00 %
UnclassifiedrootN/A15.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000363|ICChiseqgaiiFebDRAFT_10848846All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300000550|F24TB_12237523All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300000890|JGI11643J12802_12055432All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1617Open in IMG/M
3300000891|JGI10214J12806_10374698All Organisms → cellular organisms → Bacteria → Proteobacteria784Open in IMG/M
3300000953|JGI11615J12901_10755669All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300004009|Ga0055437_10283369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales549Open in IMG/M
3300004114|Ga0062593_102889877All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium549Open in IMG/M
3300004463|Ga0063356_100853515All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1279Open in IMG/M
3300005295|Ga0065707_10597590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium688Open in IMG/M
3300005332|Ga0066388_103701196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium780Open in IMG/M
3300005332|Ga0066388_104092444Not Available743Open in IMG/M
3300005354|Ga0070675_100102803All Organisms → cellular organisms → Bacteria → Proteobacteria2408Open in IMG/M
3300005440|Ga0070705_100868935All Organisms → cellular organisms → Bacteria → Proteobacteria723Open in IMG/M
3300005441|Ga0070700_101983640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium505Open in IMG/M
3300005457|Ga0070662_101100504All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300005526|Ga0073909_10350690All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales684Open in IMG/M
3300005545|Ga0070695_101758278All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300005546|Ga0070696_100124261All Organisms → cellular organisms → Bacteria → Proteobacteria1871Open in IMG/M
3300005547|Ga0070693_101358304All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria551Open in IMG/M
3300005549|Ga0070704_101058243All Organisms → cellular organisms → Bacteria → Proteobacteria736Open in IMG/M
3300005615|Ga0070702_100428762All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300005616|Ga0068852_101725246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii649Open in IMG/M
3300005713|Ga0066905_100087136All Organisms → cellular organisms → Bacteria2073Open in IMG/M
3300005764|Ga0066903_102516368All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium997Open in IMG/M
3300005843|Ga0068860_100095485All Organisms → cellular organisms → Bacteria → Proteobacteria2834Open in IMG/M
3300005843|Ga0068860_100363098All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1427Open in IMG/M
3300006049|Ga0075417_10523151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium598Open in IMG/M
3300006058|Ga0075432_10381832All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium604Open in IMG/M
3300006163|Ga0070715_10130183All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300006194|Ga0075427_10032327All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300006755|Ga0079222_11077960All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300006794|Ga0066658_10252973All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300006806|Ga0079220_10642613All Organisms → cellular organisms → Bacteria → Proteobacteria765Open in IMG/M
3300006847|Ga0075431_101464099All Organisms → cellular organisms → Bacteria → Proteobacteria642Open in IMG/M
3300006852|Ga0075433_10774218All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria839Open in IMG/M
3300006853|Ga0075420_101002171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia719Open in IMG/M
3300006854|Ga0075425_101096810All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300006854|Ga0075425_101160595All Organisms → cellular organisms → Bacteria → Proteobacteria878Open in IMG/M
3300006871|Ga0075434_100328705All Organisms → cellular organisms → Bacteria1549Open in IMG/M
3300006871|Ga0075434_100365231All Organisms → cellular organisms → Bacteria1464Open in IMG/M
3300006880|Ga0075429_100866248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium791Open in IMG/M
3300006903|Ga0075426_10550109All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300006904|Ga0075424_100575748All Organisms → cellular organisms → Bacteria1202Open in IMG/M
3300006904|Ga0075424_102794792All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300006969|Ga0075419_10469042All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii871Open in IMG/M
3300006969|Ga0075419_11538840Not Available500Open in IMG/M
3300007265|Ga0099794_10811098All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300009038|Ga0099829_10870792All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium748Open in IMG/M
3300009094|Ga0111539_10649634Not Available1228Open in IMG/M
3300009094|Ga0111539_11657662All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300009098|Ga0105245_12880258All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300009100|Ga0075418_10703395Not Available1089Open in IMG/M
3300009101|Ga0105247_10715583All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300009156|Ga0111538_13865631Not Available518Open in IMG/M
3300009162|Ga0075423_10552577All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1212Open in IMG/M
3300009162|Ga0075423_10803852All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium995Open in IMG/M
3300010043|Ga0126380_10436935All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium984Open in IMG/M
3300010043|Ga0126380_10459049Not Available965Open in IMG/M
3300010047|Ga0126382_11287821Not Available660Open in IMG/M
3300010359|Ga0126376_12474353All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300010359|Ga0126376_12593937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria555Open in IMG/M
3300010362|Ga0126377_12966582Not Available547Open in IMG/M
3300010362|Ga0126377_13457438All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium511Open in IMG/M
3300010371|Ga0134125_12079683All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria617Open in IMG/M
3300010398|Ga0126383_11256036Not Available831Open in IMG/M
3300010400|Ga0134122_10069536Not Available2734Open in IMG/M
3300011270|Ga0137391_10750056All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium808Open in IMG/M
3300011271|Ga0137393_10236826All Organisms → cellular organisms → Bacteria1547Open in IMG/M
3300012096|Ga0137389_11602702Not Available547Open in IMG/M
3300012208|Ga0137376_11319248All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium612Open in IMG/M
3300012361|Ga0137360_10965597All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria735Open in IMG/M
3300012509|Ga0157334_1024112Not Available695Open in IMG/M
3300012582|Ga0137358_10286419All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1119Open in IMG/M
3300012683|Ga0137398_10136254Not Available1582Open in IMG/M
3300012685|Ga0137397_10983813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei622Open in IMG/M
3300012897|Ga0157285_10382121All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300012930|Ga0137407_10945667All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium816Open in IMG/M
3300012931|Ga0153915_10263560All Organisms → cellular organisms → Bacteria1913Open in IMG/M
3300012951|Ga0164300_11042742All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300012971|Ga0126369_12302532All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. G22625Open in IMG/M
3300015201|Ga0173478_10521023All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300015245|Ga0137409_10044765All Organisms → cellular organisms → Bacteria4229Open in IMG/M
3300015371|Ga0132258_10011616All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria18451Open in IMG/M
3300015371|Ga0132258_10559083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2868Open in IMG/M
3300015371|Ga0132258_10655101All Organisms → cellular organisms → Bacteria2641Open in IMG/M
3300015371|Ga0132258_12397657All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1322Open in IMG/M
3300015372|Ga0132256_101903665All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria702Open in IMG/M
3300016270|Ga0182036_10237586All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1357Open in IMG/M
3300017927|Ga0187824_10019827All Organisms → cellular organisms → Bacteria → Proteobacteria1980Open in IMG/M
3300017930|Ga0187825_10014620All Organisms → cellular organisms → Bacteria2626Open in IMG/M
3300018058|Ga0187766_11408545Not Available512Open in IMG/M
3300018060|Ga0187765_10869374Not Available607Open in IMG/M
3300018422|Ga0190265_13182541All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300019377|Ga0190264_11132875All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300019881|Ga0193707_1021739All Organisms → cellular organisms → Bacteria2122Open in IMG/M
3300020004|Ga0193755_1024842All Organisms → cellular organisms → Bacteria1984Open in IMG/M
3300025538|Ga0210132_1044480Not Available648Open in IMG/M
3300025580|Ga0210138_1080900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales775Open in IMG/M
3300025711|Ga0207696_1181969All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium555Open in IMG/M
3300025899|Ga0207642_10578993Not Available696Open in IMG/M
3300025908|Ga0207643_10692938Not Available658Open in IMG/M
3300025916|Ga0207663_10347691Not Available1122Open in IMG/M
3300025922|Ga0207646_10761750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi863Open in IMG/M
3300025923|Ga0207681_10009287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium6006Open in IMG/M
3300025927|Ga0207687_11788015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia526Open in IMG/M
3300025933|Ga0207706_10592524All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria953Open in IMG/M
3300025933|Ga0207706_10630276All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300025981|Ga0207640_10009557All Organisms → cellular organisms → Bacteria → Proteobacteria5434Open in IMG/M
3300025981|Ga0207640_10701141All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria868Open in IMG/M
3300026035|Ga0207703_10725832All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria946Open in IMG/M
3300026345|Ga0257148_1004393Not Available975Open in IMG/M
3300026475|Ga0257147_1027279All Organisms → cellular organisms → Bacteria → Proteobacteria814Open in IMG/M
3300026482|Ga0257172_1075783All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium618Open in IMG/M
3300027646|Ga0209466_1098343All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium592Open in IMG/M
3300027695|Ga0209966_1125931All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium590Open in IMG/M
3300027787|Ga0209074_10363319All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300027873|Ga0209814_10046624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1806Open in IMG/M
3300027880|Ga0209481_10045170All Organisms → cellular organisms → Bacteria2029Open in IMG/M
3300027903|Ga0209488_10074567All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Alcanivoracaceae → Alcanivorax2519Open in IMG/M
3300027903|Ga0209488_10755589All Organisms → cellular organisms → Bacteria → Proteobacteria693Open in IMG/M
3300027909|Ga0209382_11579214All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium macuxiense650Open in IMG/M
3300028380|Ga0268265_10049335All Organisms → cellular organisms → Bacteria → Proteobacteria3165Open in IMG/M
3300028380|Ga0268265_11572494All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300028828|Ga0307312_11026169Not Available546Open in IMG/M
3300031198|Ga0307500_10226862All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium568Open in IMG/M
3300031538|Ga0310888_10672645All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium633Open in IMG/M
3300031547|Ga0310887_10138812Not Available1259Open in IMG/M
3300031548|Ga0307408_100485961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1078Open in IMG/M
3300031572|Ga0318515_10136507All Organisms → cellular organisms → Bacteria1303Open in IMG/M
3300031640|Ga0318555_10064331All Organisms → cellular organisms → Bacteria1885Open in IMG/M
3300031679|Ga0318561_10514298All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300031719|Ga0306917_10493220All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium961Open in IMG/M
3300031736|Ga0318501_10206187All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1030Open in IMG/M
3300031740|Ga0307468_100859741All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300031782|Ga0318552_10527339All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium603Open in IMG/M
3300031796|Ga0318576_10186928Not Available973Open in IMG/M
3300031820|Ga0307473_10787995All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300031892|Ga0310893_10098890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1067Open in IMG/M
3300031892|Ga0310893_10550504All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium523Open in IMG/M
3300031940|Ga0310901_10043153All Organisms → cellular organisms → Bacteria1442Open in IMG/M
3300031962|Ga0307479_10269298All Organisms → cellular organisms → Bacteria → Proteobacteria1683Open in IMG/M
3300032001|Ga0306922_10413442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1444Open in IMG/M
3300032002|Ga0307416_100190403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1934Open in IMG/M
3300032002|Ga0307416_101778977All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300032043|Ga0318556_10020776All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2934Open in IMG/M
3300032055|Ga0318575_10138440All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1204Open in IMG/M
3300032059|Ga0318533_10391820All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1014Open in IMG/M
3300032064|Ga0318510_10509435All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300032094|Ga0318540_10640225All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300032180|Ga0307471_102951012Not Available604Open in IMG/M
3300032205|Ga0307472_100314248All Organisms → cellular organisms → Bacteria1267Open in IMG/M
3300032205|Ga0307472_100538158All Organisms → cellular organisms → Bacteria → Proteobacteria1016Open in IMG/M
3300032770|Ga0335085_11736791All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300033412|Ga0310810_10002782All Organisms → cellular organisms → Bacteria → Proteobacteria18916Open in IMG/M
3300033433|Ga0326726_10006486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria10525Open in IMG/M
3300033502|Ga0326731_1017826All Organisms → cellular organisms → Bacteria1738Open in IMG/M
3300033551|Ga0247830_10223525All Organisms → cellular organisms → Bacteria → Proteobacteria1415Open in IMG/M
3300034659|Ga0314780_225606All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300034668|Ga0314793_007484All Organisms → cellular organisms → Bacteria1448Open in IMG/M
3300034674|Ga0314799_009609All Organisms → cellular organisms → Bacteria918Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere15.62%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.25%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.12%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.12%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.12%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.50%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.88%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.88%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.88%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.88%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.25%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.25%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.25%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.25%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.25%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.25%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.25%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.25%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.62%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.62%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.62%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006194Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012509Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6EnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300025538Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025580Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025711Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026345Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-AEnvironmentalOpen in IMG/M
3300026475Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-AEnvironmentalOpen in IMG/M
3300026482Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-BEnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033502Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fractionEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034659Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034668Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034674Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiFebDRAFT_1084884613300000363SoilYQQFVMVDALAQFCTDKLDLEQTVKWGEEKIKAIYAKFA*
F24TB_1223752323300000550SoilFVMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKFV*
JGI11643J12802_1205543223300000890SoilTTGYPGPLTPAADEVYQQFIMIDTVAQFCSDRLDLEAAMKWGEDKMKS
JGI10214J12806_1037469823300000891SoilDEVYQQFIMVDALAQFCTDKMDLEQTVKWADEKIKAIYAKF*
JGI11615J12901_1075566923300000953SoilMIDTVAQFCSDRLDLEAAVKWGEEKIKGIYAKFA*
Ga0055437_1028336913300004009Natural And Restored WetlandsDEVYQQFVMVDALAQFCTDKMDLEQTIKWGEDKIKAIHAKFA*
Ga0062593_10288987713300004114SoilGPVTAASDEVYQQFVMIDACAQFCSDKMDLEQTVKWAEEKIKGIYAKFV*
Ga0063356_10085351523300004463Arabidopsis Thaliana RhizosphereVYQQFVMIDAVAQFCADKMDLEQTVKWAEEKLKSIYAKFV*
Ga0065707_1059759023300005295Switchgrass RhizosphereTPAADEVYQQFVMVDALAQYCVDKLDLEAAVKWGEEKIKAIHAKFA*
Ga0066388_10370119623300005332Tropical Forest SoilADEVYQQFVMVDALAQFCVDKLDLEGAVKWGEEKIKAIYAKFA*
Ga0066388_10409244413300005332Tropical Forest SoilVYQQFVMVDALAQFCTDKMDLEQTVKWGEDKIKAIHAKFA*
Ga0070675_10010280313300005354Miscanthus RhizospherePAADEVYQQFVMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFA*
Ga0070705_10086893523300005440Corn, Switchgrass And Miscanthus RhizosphereGYPGPCSAAADEVYQQFIMIDAVAQFCTDKMDLEQTVKWGEDKLKAIYSKFV*
Ga0070700_10198364023300005441Corn, Switchgrass And Miscanthus RhizosphereADEVYQQFVMVDALAQFATDKMDLEQTVKWGEEKIKAIHAKFA*
Ga0070662_10110050423300005457Corn RhizosphereYQQFVMVDALAQFCTDKLDLEQTVKWGEEKIKGIYSKFA*
Ga0073909_1035069023300005526Surface SoilPAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAIYAKFV*
Ga0070695_10175827823300005545Corn, Switchgrass And Miscanthus RhizosphereEVYQQFVLVDALAQYCVDKLDLEAAVKWGEEKIKAIHAKFA*
Ga0070696_10012426133300005546Corn, Switchgrass And Miscanthus RhizosphereVYQQFIMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFV*
Ga0070693_10135830413300005547Corn, Switchgrass And Miscanthus RhizospherePEYHFTQGYPGPVTAASDEVYQQFVMIDACAQFCSDKMDLEQTVKWAEEKIKGIYAKFV*
Ga0070704_10105824313300005549Corn, Switchgrass And Miscanthus RhizosphereTGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTIKWGEEKIKAIYAKFV*
Ga0070702_10042876213300005615Corn, Switchgrass And Miscanthus RhizospherePAADEVYQQFIMVDALAQFATDKMDLEQTVKWAEDKIKAVYAKYV*
Ga0068852_10172524613300005616Corn RhizospherePAADEVYQQFVMVDALAQFCADKLDLEGAVRWGEEKIKSIYGKFA*
Ga0066905_10008713613300005713Tropical Forest SoilMVDALAQFATDKMDLEQTVKWAEDKIKAIYAKFV*
Ga0066903_10251636813300005764Tropical Forest SoilYPGPVTAASDEVYQQFVLIDTVAQFCVGKMDLEQAMKWSGDKLHEIYAKFV*
Ga0068860_10009548543300005843Switchgrass RhizosphereGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTIKWAEEKIKAIYAKFV*
Ga0068860_10036309813300005843Switchgrass RhizosphereEVYQQFIMVDALAQYCTDKLDLEATVKWAEEKIKAVYAKFA*
Ga0075417_1052315123300006049Populus RhizosphereTPAADEVYQQFVMIDTVAQFCSDRLDLEAAVKWGDEKIKSIYAKFA*
Ga0075432_1038183223300006058Populus RhizosphereVYQQFVMVDALAQFCTDKMDLEQTVKWAEEKIKAIYAKFA*
Ga0070715_1013018323300006163Corn, Switchgrass And Miscanthus RhizospherePGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKYV*
Ga0075427_1003232723300006194Populus RhizosphereTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAIYAKFV*
Ga0079222_1107796013300006755Agricultural SoilAEYHFTTGYPGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTVKWAEDKIKAVYAKYV*
Ga0066658_1025297313300006794SoilDAEYHFTTGYPGQVTPAADEVYQQFAMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFV
Ga0079220_1064261313300006806Agricultural SoilDEVYQQFVMVDALAQFCTDKMDLEQTVKWGEEKIKAIYAKFV*
Ga0075431_10146409913300006847Populus RhizosphereDEVYQQFVMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKFA*
Ga0075433_1077421813300006852Populus RhizosphereYQQFVMIDAVAQFCTDKMDLETTIKWGEDRIKAIYAKFA*
Ga0075420_10100217123300006853Populus RhizosphereDEVYQQFVMIDTVAQFCSDRLDLEAAVKWGDEKIKSIYAKFA*
Ga0075425_10109681013300006854Populus RhizosphereADEVYQQFIMVDALAQFATDKMDLEQTVKWAEDKIKAVYAKYV*
Ga0075425_10116059523300006854Populus RhizospherePLTPAADEVYQQFVMVDALAQFCTDKMDLEQTVKWGEEKIKAIYAKFV*
Ga0075434_10032870513300006871Populus RhizosphereQFVMVDALAQFCTDKMDLEQTVKWGEEKIKAIYAKFV*
Ga0075434_10036523133300006871Populus RhizosphereEYHFTMGYPGPCTPAADEVYQQFVMVDALAQFCTDKMDLETTIKWGEDKIKAIYAKFA*
Ga0075429_10086624823300006880Populus RhizosphereGPLTPAADEVYQQFVMVDALAQFCADKLDLEQAVKWGEEKIKSIYAKFA*
Ga0075426_1055010913300006903Populus RhizosphereQQFIMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKYV*
Ga0075424_10057574823300006904Populus RhizosphereYHFTTGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAVYAKYV*
Ga0075424_10279479223300006904Populus RhizosphereADEVYQQFIMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKYV*
Ga0075419_1046904223300006969Populus RhizosphereTTGYPGPLTPAADEVYQQFVMVDALAQFCTDKLDLEQTVKWGEEKIKAIYAKFA*
Ga0075419_1153884013300006969Populus RhizosphereDEVYQQFIMVDALAQYCTDKLDLEAAVKWAEEKIKAVYAKFA*
Ga0099794_1081109823300007265Vadose Zone SoilAEYHFTTGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKFA*
Ga0099829_1087079223300009038Vadose Zone SoilPAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKFV*
Ga0111539_1064963413300009094Populus RhizospherePGPLTPAADEVYQQFVMVDALAQFCTDKMDLEQTVKWADEKIKAIYAKFA*
Ga0111539_1165766223300009094Populus RhizosphereYQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAIYAKFV*
Ga0105245_1288025813300009098Miscanthus RhizosphereVYQQFVMVDALAQYCVDKLDLEAAVKWGEEKIKAIHAKFA*
Ga0075418_1070339513300009100Populus RhizosphereDEVYQQFVLIDAAAQFCADKMDLEQTIKWGEDKLKSIYAKFV*
Ga0105247_1071558313300009101Switchgrass RhizosphereDEVYQQFVMVDALAQFCTDKMDLEQTVKWGEDKIKAIYAKSA*
Ga0111538_1386563113300009156Populus RhizosphereYQQFVMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFA*
Ga0075423_1055257713300009162Populus RhizosphereHFTTGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFA*
Ga0075423_1080385223300009162Populus RhizosphereMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKYV*
Ga0126380_1043693513300010043Tropical Forest SoilVRPDAVRLHQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAIYAKFV*
Ga0126380_1045904923300010043Tropical Forest SoilYHFTTGYPGPLTPAADEVYQQFVMVDALAQFCTDKMDLEQTVKWADEKIKAIYAKFA*
Ga0126382_1128782113300010047Tropical Forest SoilHFTTGYPGPLTPAADEVYQQFVMVDALAQYATDKMDLEQTVKWADEKIKAIYAKFA*
Ga0126376_1247435323300010359Tropical Forest SoilGYPGPLTPAADEIYQQFIMVDALAQYCVDKLDLEAAVKWGEEKIKAIHAKFA*
Ga0126376_1259393713300010359Tropical Forest SoilPLTPAADEVYQQFIMVDTLAQFCVDKLDLEGAVKWGEEKIKQIYAKFA*
Ga0126377_1296658223300010362Tropical Forest SoilMVDALAQFCTDKMDLEQTVKWGEEKIKAVYAKSA*
Ga0126377_1345743823300010362Tropical Forest SoilVSADEVYQQFVMVDGLAQFCTDKMDLEQTVKWGEDKIKAIYAKSA*
Ga0134125_1207968313300010371Terrestrial SoilSPEYHYTIGYPGPLTVAADEVYQQFVLIDAAAQFCTDKMDLEQTIKWGEDKLKAIYSKFV
Ga0126383_1125603613300010398Tropical Forest SoilLTPAADEVYQQFVMVDALAQFCTDKMDLEQTVKWADEKIRAIYAKFA*
Ga0134122_1006953613300010400Terrestrial SoilEVYQQFVMIDACAQFCSDKMDLEQTVKWAEEKIKGIYAKFV*
Ga0137391_1075005623300011270Vadose Zone SoilYHFTTGYPGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFV*
Ga0137393_1023682633300011271Vadose Zone SoilEYHFTTGYPGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFV*
Ga0137389_1160270213300012096Vadose Zone SoilPGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTIKWGEEKIKAIYAKFV*
Ga0137376_1131924823300012208Vadose Zone SoilFTTGYPGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTIKWGEEKIKAIYAKFV*
Ga0137360_1096559713300012361Vadose Zone SoilHYTMDYPGPSSPAADEVYQQCVMIDPTAQFCTEKMDLETTVKWGEDKIRAIYAKFA*
Ga0157334_102411223300012509SoilMVDALAQFCTDKMDLEQTVKWGEEKIKGVHAKFA*
Ga0137358_1028641913300012582Vadose Zone SoilPGPLTPAADEVYQQFVMVDALAQFCTDKMDLEQTVKWGEEKIKAIYAKFV*
Ga0137398_1013625433300012683Vadose Zone SoilPLTPAADEVYQQFIMVDALAQFATDKMDLEQTIKWGEEKIKAIYAKFV*
Ga0137397_1098381323300012685Vadose Zone SoilVTTLSKQFVMVDALAQYCVDRLDLEAAVKWGEEKIKAIHAKFA*
Ga0157285_1038212123300012897SoilPGQLTPAADEVYQQFVLVDALAQFCADKLDLEGAVKWGEEKIKSIYAKFA*
Ga0137407_1094566713300012930Vadose Zone SoilQFVMVDALAQFATDKMDLEQTVKWAEDKIKAVYAKYV*
Ga0153915_1026356043300012931Freshwater WetlandsYQQFVMVDALAQFATDKMDLEQTIKWGDERIKAIYAKFA*
Ga0164300_1104274213300012951SoilDEVYQQFVLVDALAQFCADKLDLEGAVKWGEEKIKAIHAKFA*
Ga0126369_1230253213300012971Tropical Forest SoilGFPGPLTPAADEVYQQFVMVDALAQFCTDKMDLEQTVKWADEKIKAIYAKFA*
Ga0173478_1052102313300015201SoilMVDALAQFCTDKMDLEQTVKWAEEKIKAIYAKFA*
Ga0137409_1004476553300015245Vadose Zone SoilDEVYQQFIMVDALAQFATDKMDLEQTIKWAEEKIKAIYAKFV*
Ga0132258_10011616143300015371Arabidopsis RhizosphereYHFTTGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAIYAKFV*
Ga0132258_1055908343300015371Arabidopsis RhizosphereAADEVYQQFIMVDALAQFCTDKMDLEQTVKWGEEKIKGVHAKFA*
Ga0132258_1065510113300015371Arabidopsis RhizospherePAADEVYQQFIMVDALAQYCTDKLDLEATVKWGEEKIKAVYAKFA*
Ga0132258_1239765723300015371Arabidopsis RhizosphereVYQQFIMVDALAQYCTDKLDLEAAVKWAEEKIKAVYAKFA*
Ga0132256_10190366523300015372Arabidopsis RhizosphereAADEVYQQFVLIDAAAQFCTDKMDLEQTIKWGEDKLKAIYAKFI*
Ga0182036_1023758633300016270SoilYHFTTGYPGPLTPAADEVYQQFVMVDALAQFCTDKMDLEQTVKWGEEKIKGIHAKFA
Ga0187824_1001982713300017927Freshwater SedimentQFVMVDALAQFATDKMDLEQTIKWGEERIKAIYAKFV
Ga0187825_1001462013300017930Freshwater SedimentPLTPAADEVYQQFVMVDALAQFATDKMDLEQTIKWGEERIKAIYAKFV
Ga0187766_1140854513300018058Tropical PeatlandYQQFIMVDALAQYCTDKLDLEATVRWADDKIKAVYAKFA
Ga0187765_1086937413300018060Tropical PeatlandLTPAADEVYQQFVMVDALAQFCTDKLDLEQAVKWGEERIKGIYSKFV
Ga0190265_1318254113300018422SoilTTGYPGPLTPAADEVYQQFVMVDALAQFCADKMDLEQTVKWGEDKIKAIYAKFA
Ga0190264_1113287513300019377SoilPGPLTQAADEVYQQFVMVDALAQFCTDKMDLEQTVKWAEDKIKAIYAKF
Ga0193707_102173933300019881SoilVYQQFVMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKFA
Ga0193755_102484233300020004SoilVTRRNGERVDALAQFCVDKLDLEGAVKWGEDKIKAVYAKFA
Ga0210132_104448023300025538Natural And Restored WetlandsEVYQQFVMVDALAQFCTDKMDLEQTIKWADEKIKAIHAKFA
Ga0210138_108090013300025580Natural And Restored WetlandsFTTGHPGPLTPAADEVYQQFVMVDALAQFCTDKMDLEQTIKWGEDKIKAIHAKFA
Ga0207696_118196913300025711Switchgrass RhizosphereQDAEYHFTTGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAVYAKY
Ga0207642_1057899323300025899Miscanthus RhizosphereADEVYQQFIMVDALAQFCTDKMDLEATIKWGEDKIKAVYAKYA
Ga0207643_1069293813300025908Miscanthus RhizosphereGPFNPAADEVYQQFIMVDALAQYCTDKLDLEATVKWAEEKIKAVYAKFA
Ga0207663_1034769113300025916Corn, Switchgrass And Miscanthus RhizosphereDAEYHFTTGYPGPLTPAADEVYQQFIMVDALAQFCTDKMDLEQTVKWGEEKIKGVHAKFA
Ga0207646_1076175023300025922Corn, Switchgrass And Miscanthus RhizosphereVYQQFVMVDALAQFCTDKMDLEQTVKWGEEKIKAIYAKFV
Ga0207681_1000928713300025923Switchgrass RhizosphereYQQFVMVDALAQYCVDKLDLEAAVKWGEEKIKAIHAKFA
Ga0207687_1178801523300025927Miscanthus RhizosphereQQFVMVDALAQYCVDKLDLEAAVKWGEEKIKAIHAKFA
Ga0207706_1059252413300025933Corn RhizosphereYTIGYPGPLTVAADEVYQQFILIDAAAQFCTDKMDLEQTIKWGEDKLKAIYAKFI
Ga0207706_1063027613300025933Corn RhizosphereGPCSAAADEVYQQFIMIDAVAQFCTDKMDLEQTVKWGEDKLKAIYSKFV
Ga0207640_1000955763300025981Corn RhizosphereEYHFTTGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFA
Ga0207640_1070114113300025981Corn RhizosphereGYPGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTIKWAEEKIKAIYAKFV
Ga0207703_1072583213300026035Switchgrass RhizosphereEVYQQFIMVDALAQYCTDKLDLEATVKWAEEKIKAVYAKFA
Ga0257148_100439323300026345SoilEVYQQFVMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKFV
Ga0257147_102727923300026475SoilGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKFV
Ga0257172_107578323300026482SoilAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKFV
Ga0209466_109834313300027646Tropical Forest SoilMRPDAVRLHQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAIYAKFV
Ga0209966_112593113300027695Arabidopsis Thaliana RhizospherePLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFA
Ga0209074_1036331923300027787Agricultural SoilAEYHFTTGYPGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTVKWAEDKIKAVYAKYV
Ga0209814_1004662433300027873Populus RhizosphereEYHFTTGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAIYAKFV
Ga0209481_1004517013300027880Populus RhizospherePAADEVYQQFVMVDALAQFCTDKLDLEQTVKWGEEKIKAIYAKFA
Ga0209488_1007456733300027903Vadose Zone SoilGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFV
Ga0209488_1075558923300027903Vadose Zone SoilGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTIKWGEEKIKAIYAKFV
Ga0209382_1157921413300027909Populus RhizosphereYPGPLTPAADEVYQQFVMVDALAQFCSDKLDLEQTIKWGEEKIKAIYAKFA
Ga0268265_1004933553300028380Switchgrass RhizosphereYHFTIGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFA
Ga0268265_1157249413300028380Switchgrass RhizosphereGALTPAADEVYQQFVMVDALAQFWTDKMDLEATIKWGEDKIKAVYAKFV
Ga0307312_1102616913300028828SoilVYQQFIMVDALAQFATDKMDLEQTIKWGEEKIKAIYAKFV
Ga0307500_1022686213300031198SoilVYQQFVMVDALAQFCTDKMDLEMTIKWGEDKIRAIYAKFA
Ga0310888_1067264523300031538SoilFIMIDAVAQFCTDKMDLEQTVKWGEDKLKAIYSKFV
Ga0310887_1013881233300031547SoilYQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAVYAKYV
Ga0307408_10048596113300031548RhizosphereTGYPGPLTPAADEVYQQFVMVDALAQFCTDKMDLEQTVKWGEEKIKAIYAKFA
Ga0318515_1013650723300031572SoilVYQQFIMVDALAQFCTDKLDLERAIKWGEEKIKAVYATVA
Ga0318555_1006433133300031640SoilEYHFTMGYPGPCSPAADEVYQQFVMIDAVAQFCTDKMDLETTIKWGEDKIKAIYAKFA
Ga0318561_1051429813300031679SoilIMVDALAQFCTDKLDLERAIKWGEEKIKAVYTTVA
Ga0306917_1049322013300031719SoilDEVYQQFVMVDALAQFCTDKLDLEQAVKWGEEKIKAIHAKFV
Ga0318501_1020618713300031736SoilMGYPGPCSPAADEVYQQFVMIDAVAQFCTDKMDLETTIKWGEDKIKAIYAKFA
Ga0307468_10085974123300031740Hardwood Forest SoilDAEYHFTTGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAIYAKFV
Ga0318552_1052733923300031782SoilLTPAADEVYQQFVMVDALAQFCTDKLDLEQAVKWGEEKIKAIHAKFV
Ga0318576_1018692813300031796SoilVYQQFVMVDALAQFCTDKMDLEQTVKWGEEKIKGIHAKFA
Ga0307473_1078799523300031820Hardwood Forest SoilPADEVYQQFVMVDALAQFCTDKMDLEQTVKWGEDKIKAIYAKSA
Ga0310893_1009889013300031892SoilGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAIYAKFV
Ga0310893_1055050423300031892SoilDEVYQQFIMIDAVAQFCTDKMDLEQTVKWGEDKLKAIYSKFV
Ga0310901_1004315323300031940SoilLTPAADEVYQQFILVDALAQYCVDKLDLEAAVKWGEEKIKAIHAKFA
Ga0307479_1026929833300031962Hardwood Forest SoilTTGYPGPLTPAADEVYQQFVMVDALAQFCTDKMDLEQTVKWGEERIKAIYAKFV
Ga0306922_1041344213300032001SoilQDAEYHFTTGYPGPLTPAADEVYQQFVMVDALAQFCTDKMDLEQTVKWGEEKIKGIHAKF
Ga0307416_10019040333300032002RhizosphereVMVDALAQFCTDKMDLEQTVKWGEEKIKAIYAKFA
Ga0307416_10177897723300032002RhizosphereADEVYQQFVMVDALAQFCTDKMDLEQTVKWGEEKIKAIYAKFA
Ga0318556_1002077613300032043SoilDYHFTTGYPGPLTPAADEVYQQFVMVDALAQFCTDKLDLEQAVKWGEEKIKAIHAKFV
Ga0318575_1013844023300032055SoilPGPCSPAADEVYQQFVMIDAVAQFCTDKMDLETTIKWGEDKIKAIYAKFA
Ga0318533_1039182023300032059SoilVMVDALAQFCTDKLDLEQAVKWGEEKIKAIHAKFV
Ga0318510_1050943523300032064SoilPGPLTPAADEVYQQFVMVDALAQFCTDKLDLEQAVKWGEEKIKAIHAKFV
Ga0318540_1064022523300032094SoilVYQQFIMVDALAQFCTDKLDLERAIKWGEEKIKAVYTTVA
Ga0307471_10295101223300032180Hardwood Forest SoilPAADEVYQQFVLIDAAAQFCADKMDLEQTIKWGEDKLKSIYAKFV
Ga0307472_10031424813300032205Hardwood Forest SoilGYPGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKYV
Ga0307472_10053815813300032205Hardwood Forest SoilGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTIKWAEEKIKAIYAKFV
Ga0335085_1173679113300032770SoilEQFVLIDAVAQYCADRMDLEHTVKWADDKLNRIYAKFA
Ga0310810_10002782193300033412SoilQDAEYHFTTGYPGQLTPAADEVYQQFVMVDALAQFCTDKLDLEGAVKWGEEKIKQIYAKF
Ga0326726_10006486103300033433Peat SoilFIMVDALAQFATDKMDLEQTIKWGEEKIKAIYAKFV
Ga0326731_101782613300033502Peat SoilQFIMVDALAQFATDKMDLEQTIKWGEEKIKAIYAKFV
Ga0247830_1022352523300033551SoilGPLTPAADEVYQQFVMVDALAQFCTDKLDLEATVKWGEEKIKSIYAKFA
Ga0314780_225606_2_1453300034659SoilLTPAADEVYQQFVMVDALAQFCADKMDLEQTVKWGEDKIKAIYAKFA
Ga0314793_007484_1269_14483300034668SoilAEYHFTTGYPGPLTPAADEVYQQFILVDALAQYCVDKLDLEAAVKWGEEKIKAIHAKFA
Ga0314799_009609_9_1523300034674SoilLTPAADEVYQQFAMVDALAQFCADKLDLEGAVRWGEEKIKSIYGKFA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.