Basic Information | |
---|---|
Family ID | F041467 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 160 |
Average Sequence Length | 45 residues |
Representative Sequence | DIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEADILADDLL |
Number of Associated Samples | 137 |
Number of Associated Scaffolds | 160 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 7.50 % |
% of genes near scaffold ends (potentially truncated) | 90.00 % |
% of genes from short scaffolds (< 2000 bps) | 91.88 % |
Associated GOLD sequencing projects | 127 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.125 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.875 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.625 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.62% β-sheet: 0.00% Coil/Unstructured: 78.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 160 Family Scaffolds |
---|---|---|
PF00574 | CLP_protease | 3.12 |
PF05653 | Mg_trans_NIPA | 1.88 |
PF13396 | PLDc_N | 1.25 |
PF00440 | TetR_N | 1.25 |
PF00294 | PfkB | 0.62 |
PF14690 | zf-ISL3 | 0.62 |
PF13302 | Acetyltransf_3 | 0.62 |
PF12773 | DZR | 0.62 |
PF11271 | PorA | 0.62 |
PF13701 | DDE_Tnp_1_4 | 0.62 |
PF06736 | TMEM175 | 0.62 |
PF00903 | Glyoxalase | 0.62 |
COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
---|---|---|---|
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 6.25 |
COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 6.25 |
COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 3.12 |
COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.12 % |
Unclassified | root | N/A | 16.88 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10910084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101216015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 643 | Open in IMG/M |
3300003368|JGI26340J50214_10008120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 3378 | Open in IMG/M |
3300004152|Ga0062386_101058212 | Not Available | 673 | Open in IMG/M |
3300005328|Ga0070676_10215947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1264 | Open in IMG/M |
3300005334|Ga0068869_100394579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1137 | Open in IMG/M |
3300005434|Ga0070709_10059320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2429 | Open in IMG/M |
3300005434|Ga0070709_10886945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 704 | Open in IMG/M |
3300005435|Ga0070714_102158936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 542 | Open in IMG/M |
3300005436|Ga0070713_101984084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
3300005436|Ga0070713_102205905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 533 | Open in IMG/M |
3300005439|Ga0070711_101487506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 590 | Open in IMG/M |
3300005439|Ga0070711_101896778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 523 | Open in IMG/M |
3300005467|Ga0070706_102014523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 523 | Open in IMG/M |
3300005549|Ga0070704_101631484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 595 | Open in IMG/M |
3300005557|Ga0066704_10547899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 754 | Open in IMG/M |
3300005844|Ga0068862_100084969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2749 | Open in IMG/M |
3300005921|Ga0070766_10469374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 833 | Open in IMG/M |
3300006163|Ga0070715_10215682 | Not Available | 984 | Open in IMG/M |
3300006172|Ga0075018_10531262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 617 | Open in IMG/M |
3300006175|Ga0070712_101069512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 699 | Open in IMG/M |
3300006577|Ga0074050_12048128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 574 | Open in IMG/M |
3300006881|Ga0068865_100234407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1441 | Open in IMG/M |
3300007076|Ga0075435_100895846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 774 | Open in IMG/M |
3300009012|Ga0066710_103703200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 575 | Open in IMG/M |
3300009089|Ga0099828_11621158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 570 | Open in IMG/M |
3300009098|Ga0105245_10645042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1089 | Open in IMG/M |
3300009098|Ga0105245_12197252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 606 | Open in IMG/M |
3300009177|Ga0105248_10607316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1234 | Open in IMG/M |
3300009522|Ga0116218_1197543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 908 | Open in IMG/M |
3300009522|Ga0116218_1343863 | Not Available | 667 | Open in IMG/M |
3300009525|Ga0116220_10272821 | Not Available | 741 | Open in IMG/M |
3300009698|Ga0116216_10137522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1502 | Open in IMG/M |
3300009698|Ga0116216_10376317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 863 | Open in IMG/M |
3300009764|Ga0116134_1084090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1167 | Open in IMG/M |
3300010048|Ga0126373_11249195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 809 | Open in IMG/M |
3300010335|Ga0134063_10607250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 557 | Open in IMG/M |
3300010343|Ga0074044_10386215 | Not Available | 917 | Open in IMG/M |
3300010366|Ga0126379_12532609 | Not Available | 611 | Open in IMG/M |
3300010379|Ga0136449_100344576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2682 | Open in IMG/M |
3300010379|Ga0136449_102075006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 836 | Open in IMG/M |
3300010379|Ga0136449_102932508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
3300010396|Ga0134126_12279348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 590 | Open in IMG/M |
3300010396|Ga0134126_12474446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 565 | Open in IMG/M |
3300010876|Ga0126361_10652163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1132 | Open in IMG/M |
3300011003|Ga0138514_100109370 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300012096|Ga0137389_10268382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1438 | Open in IMG/M |
3300012200|Ga0137382_11326505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 507 | Open in IMG/M |
3300012208|Ga0137376_11473532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 572 | Open in IMG/M |
3300012210|Ga0137378_10255080 | Not Available | 1632 | Open in IMG/M |
3300012924|Ga0137413_10888384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 691 | Open in IMG/M |
3300013297|Ga0157378_12026340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 626 | Open in IMG/M |
3300013307|Ga0157372_11355009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 821 | Open in IMG/M |
3300014164|Ga0181532_10088480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1952 | Open in IMG/M |
3300014969|Ga0157376_11035692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 844 | Open in IMG/M |
3300015242|Ga0137412_10891907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 645 | Open in IMG/M |
3300016341|Ga0182035_10123683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1940 | Open in IMG/M |
3300016422|Ga0182039_11083684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 721 | Open in IMG/M |
3300017924|Ga0187820_1004953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3092 | Open in IMG/M |
3300017924|Ga0187820_1056275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1072 | Open in IMG/M |
3300017932|Ga0187814_10366047 | Not Available | 558 | Open in IMG/M |
3300017933|Ga0187801_10013292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2722 | Open in IMG/M |
3300017943|Ga0187819_10605098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
3300017943|Ga0187819_10728354 | Not Available | 558 | Open in IMG/M |
3300017955|Ga0187817_11018132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
3300017970|Ga0187783_11160277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 556 | Open in IMG/M |
3300017972|Ga0187781_10406692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 972 | Open in IMG/M |
3300017973|Ga0187780_10326456 | Not Available | 1081 | Open in IMG/M |
3300018037|Ga0187883_10341063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 766 | Open in IMG/M |
3300018060|Ga0187765_10314519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 943 | Open in IMG/M |
3300018060|Ga0187765_10913891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 595 | Open in IMG/M |
3300018062|Ga0187784_10132703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2033 | Open in IMG/M |
3300018085|Ga0187772_10223386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1272 | Open in IMG/M |
3300018085|Ga0187772_10520268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 840 | Open in IMG/M |
3300018086|Ga0187769_10685021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 775 | Open in IMG/M |
3300018086|Ga0187769_11332036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 543 | Open in IMG/M |
3300018482|Ga0066669_10266210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1367 | Open in IMG/M |
3300020170|Ga0179594_10090279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1091 | Open in IMG/M |
3300020580|Ga0210403_10736519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 788 | Open in IMG/M |
3300020583|Ga0210401_10193089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1893 | Open in IMG/M |
3300020583|Ga0210401_10658047 | Not Available | 909 | Open in IMG/M |
3300021088|Ga0210404_10168595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1158 | Open in IMG/M |
3300021171|Ga0210405_10597282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 860 | Open in IMG/M |
3300021180|Ga0210396_11360507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 589 | Open in IMG/M |
3300021362|Ga0213882_10446887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 549 | Open in IMG/M |
3300021401|Ga0210393_10740210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 801 | Open in IMG/M |
3300021401|Ga0210393_11476671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 541 | Open in IMG/M |
3300021402|Ga0210385_10315763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1161 | Open in IMG/M |
3300021403|Ga0210397_10048631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2712 | Open in IMG/M |
3300021403|Ga0210397_10316555 | Not Available | 1149 | Open in IMG/M |
3300021403|Ga0210397_11079990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 623 | Open in IMG/M |
3300021407|Ga0210383_11530586 | Not Available | 551 | Open in IMG/M |
3300021474|Ga0210390_11134847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 633 | Open in IMG/M |
3300021479|Ga0210410_10716195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 883 | Open in IMG/M |
3300024279|Ga0247692_1008361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1622 | Open in IMG/M |
3300025906|Ga0207699_10814253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 687 | Open in IMG/M |
3300025907|Ga0207645_10266832 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1134 | Open in IMG/M |
3300025912|Ga0207707_10275383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1458 | Open in IMG/M |
3300025915|Ga0207693_10448932 | Not Available | 1008 | Open in IMG/M |
3300025916|Ga0207663_11605603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 523 | Open in IMG/M |
3300025921|Ga0207652_10560672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1026 | Open in IMG/M |
3300025927|Ga0207687_11577086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 564 | Open in IMG/M |
3300025929|Ga0207664_10560599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1025 | Open in IMG/M |
3300025932|Ga0207690_10614554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 888 | Open in IMG/M |
3300025986|Ga0207658_11624392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 591 | Open in IMG/M |
3300026088|Ga0207641_12463425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 519 | Open in IMG/M |
3300027071|Ga0209214_1037042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
3300027110|Ga0208488_1062403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 627 | Open in IMG/M |
3300027165|Ga0208608_116030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
3300027729|Ga0209248_10263393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
3300027857|Ga0209166_10673737 | Not Available | 522 | Open in IMG/M |
3300027884|Ga0209275_10497990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 694 | Open in IMG/M |
3300028784|Ga0307282_10141623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1135 | Open in IMG/M |
3300028828|Ga0307312_10073961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2071 | Open in IMG/M |
3300029943|Ga0311340_10071583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 3962 | Open in IMG/M |
3300030494|Ga0310037_10303176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 680 | Open in IMG/M |
3300030730|Ga0307482_1259053 | Not Available | 548 | Open in IMG/M |
3300031184|Ga0307499_10119584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 742 | Open in IMG/M |
3300031199|Ga0307495_10002701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2010 | Open in IMG/M |
3300031543|Ga0318516_10018016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3558 | Open in IMG/M |
3300031549|Ga0318571_10118609 | Not Available | 885 | Open in IMG/M |
3300031564|Ga0318573_10333818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 813 | Open in IMG/M |
3300031572|Ga0318515_10004557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5693 | Open in IMG/M |
3300031572|Ga0318515_10584203 | Not Available | 594 | Open in IMG/M |
3300031713|Ga0318496_10853689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 502 | Open in IMG/M |
3300031718|Ga0307474_10177907 | Not Available | 1613 | Open in IMG/M |
3300031724|Ga0318500_10283402 | Not Available | 809 | Open in IMG/M |
3300031740|Ga0307468_101858662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 572 | Open in IMG/M |
3300031751|Ga0318494_10237903 | Not Available | 1042 | Open in IMG/M |
3300031765|Ga0318554_10419213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 759 | Open in IMG/M |
3300031770|Ga0318521_10395624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 823 | Open in IMG/M |
3300031780|Ga0318508_1069717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 951 | Open in IMG/M |
3300031782|Ga0318552_10164305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1118 | Open in IMG/M |
3300031782|Ga0318552_10168123 | Not Available | 1105 | Open in IMG/M |
3300031782|Ga0318552_10252932 | Not Available | 894 | Open in IMG/M |
3300031782|Ga0318552_10307979 | Not Available | 805 | Open in IMG/M |
3300031796|Ga0318576_10261465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 817 | Open in IMG/M |
3300031799|Ga0318565_10180553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1026 | Open in IMG/M |
3300031799|Ga0318565_10359724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 706 | Open in IMG/M |
3300031835|Ga0318517_10112262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1202 | Open in IMG/M |
3300031846|Ga0318512_10250027 | Not Available | 875 | Open in IMG/M |
3300031879|Ga0306919_10142471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1740 | Open in IMG/M |
3300031912|Ga0306921_10538766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1355 | Open in IMG/M |
3300032010|Ga0318569_10513682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 558 | Open in IMG/M |
3300032044|Ga0318558_10423833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 663 | Open in IMG/M |
3300032052|Ga0318506_10309296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 701 | Open in IMG/M |
3300032063|Ga0318504_10419556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 638 | Open in IMG/M |
3300032065|Ga0318513_10529879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 577 | Open in IMG/M |
3300032067|Ga0318524_10278545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 863 | Open in IMG/M |
3300032068|Ga0318553_10339208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 787 | Open in IMG/M |
3300032160|Ga0311301_11400197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 872 | Open in IMG/M |
3300032174|Ga0307470_11286093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 598 | Open in IMG/M |
3300032205|Ga0307472_101048430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 768 | Open in IMG/M |
3300032261|Ga0306920_102877116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 653 | Open in IMG/M |
3300032770|Ga0335085_10779654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1054 | Open in IMG/M |
3300032828|Ga0335080_12132167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 540 | Open in IMG/M |
3300032954|Ga0335083_10567039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 940 | Open in IMG/M |
3300033134|Ga0335073_10774171 | Not Available | 1034 | Open in IMG/M |
3300034199|Ga0370514_078506 | Not Available | 837 | Open in IMG/M |
3300034817|Ga0373948_0104787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 670 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.88% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.12% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.25% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.25% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.00% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.12% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.12% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.50% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.50% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.88% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.25% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.25% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.25% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.25% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.25% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.25% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.25% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.25% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.25% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.25% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.62% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.62% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.62% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.62% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.62% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.62% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.62% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.62% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.62% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.62% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.62% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.62% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.62% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
3300027165 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF035 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_109100841 | 3300001593 | Forest Soil | DQAEPVPDEEHQRLMDCARRGEVTKITADQADILGGG* |
JGIcombinedJ26739_1012160151 | 3300002245 | Forest Soil | MLPKLAVPVPDEEHNRLMTCARRGEVTKITAGQADVLADDLM* |
JGI26340J50214_100081203 | 3300003368 | Bog Forest Soil | LRHLYRIEDDIPLMLPKLAVPVSDEEHNRLMKCARRGEVTTITAGQADVLADDPV* |
Ga0062386_1010582122 | 3300004152 | Bog Forest Soil | KLAVPVSDEEHNRLMKCARRGEVTTITAGQADVLADDPV* |
Ga0070676_102159472 | 3300005328 | Miscanthus Rhizosphere | LRRLYRIENDIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAGMLADELL* |
Ga0068869_1003945791 | 3300005334 | Miscanthus Rhizosphere | PLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAEMLADELL* |
Ga0070709_100593203 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | AVPVPEEEHRRLMKCARRGEVTTVTAGSGFQADMLTGTD* |
Ga0070709_108869451 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LYRIENDIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAGLLADDLI* |
Ga0070714_1021589362 | 3300005435 | Agricultural Soil | KLAVPVPDEEHNRLMKCARRGEVTAITAGEAGMLADEML* |
Ga0070713_1019840842 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LYRIENDIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAGMLADELL* |
Ga0070713_1022059051 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | DIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAEMLADEML* |
Ga0070711_1014875061 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | DIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEADMLADELL* |
Ga0070711_1018967781 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAGMLADELL* |
Ga0070706_1020145232 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RLYRIENGIPLMLPKLGEPVPDEEHSRLMKCARRGEVTTITAGETDALADNLG* |
Ga0070704_1016314841 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | RLRRLYRIQDGIPLMLPSQAVPVPDEEHRRLMKCARRGEVTTVTTGSGFQADMLTGTD* |
Ga0066704_105478992 | 3300005557 | Soil | AVPVPDEEHKRLMNCARRGEVTKITAGEADVLADDLI* |
Ga0068862_1000849691 | 3300005844 | Switchgrass Rhizosphere | VPVPDEEHNRLMKCARRGEVTAITAGEAGMLADELL* |
Ga0070766_104693742 | 3300005921 | Soil | PARAEPVPDEEHDRLMKCARRGEVTAITAGQSDVLAD* |
Ga0070715_102156822 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | IPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAGLLADDLI* |
Ga0075018_105312622 | 3300006172 | Watersheds | IPFMLPKLAVPVPEEEHNRLMKCARRGEVTAITAGETEMLADDLL* |
Ga0070712_1010695122 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | NDIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAEMLADEML* |
Ga0074050_120481281 | 3300006577 | Soil | RLYRIENDIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEADILADDLL* |
Ga0068865_1002344072 | 3300006881 | Miscanthus Rhizosphere | IENDIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAEMLADELL* |
Ga0075435_1008958462 | 3300007076 | Populus Rhizosphere | NDIPLMLPKLAVPVPDEEHIRLMKCARRGEVTAITAGEAGMLADELL* |
Ga0066710_1037032001 | 3300009012 | Grasslands Soil | RLRRLYRIEAGIPLMLPRQAVPVPEEEHSRLMKCARRGEVTTITAGSGFQADVLAGTDLA |
Ga0099828_116211581 | 3300009089 | Vadose Zone Soil | PKLAVPVPDEEHNRLMRCARRGEVTKITAGQADVLADDLM* |
Ga0105245_106450421 | 3300009098 | Miscanthus Rhizosphere | DIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAGMLADELL* |
Ga0105245_121972521 | 3300009098 | Miscanthus Rhizosphere | RIENDIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAVEAEMLADELL* |
Ga0105248_106073161 | 3300009177 | Switchgrass Rhizosphere | MLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAGMLADELL* |
Ga0116218_11975431 | 3300009522 | Peatlands Soil | YRIENDIPLMLPKLAVPVSDEEHNRLMKCARRGEVTMITAGQADVLADDPV* |
Ga0116218_13438631 | 3300009522 | Peatlands Soil | EPVPDEEHIRLMKCARLGQAAVTAREAGLLADDQT* |
Ga0116220_102728212 | 3300009525 | Peatlands Soil | LRRLYRIQDGVPLMLARQAVPVPEEEHNRLMKCARRGEVTAITAGQADILAGD* |
Ga0116216_101375222 | 3300009698 | Peatlands Soil | PLMLARQAVPVPDEEHNRLMKCARRGEVTAITAGQADILADD* |
Ga0116216_103763171 | 3300009698 | Peatlands Soil | MLPKLAVPVSDEEHNRLMKCARRGEVTMITAGQADVLADDPV* |
Ga0116134_10840901 | 3300009764 | Peatland | RIENDIPLMLPKLAVPVSDEEHNRLMKCARRGEVTRITADQADVLADDPGVTR* |
Ga0126373_112491951 | 3300010048 | Tropical Forest Soil | QAVPVPEEEHQRLMKCARRGEVTRVTAGQADILSGD* |
Ga0134063_106072501 | 3300010335 | Grasslands Soil | PFMLPKLAVPVPEEEHNRLMKCARRGEVTAITAGEDGLLAGDLG* |
Ga0074044_103862152 | 3300010343 | Bog Forest Soil | LRRLYRIEDGIPLMLARQAVPVPEEEHRRMMKCARRDEVTAITAGQADILASD* |
Ga0126379_125326092 | 3300010366 | Tropical Forest Soil | PLMLASQAVPVPEEEHHRLMKCARRGEVTAITAGQADILTGD* |
Ga0136449_1003445763 | 3300010379 | Peatlands Soil | LRRLYRIEDGIPLMLASQAVPVSEEEHRRLMKAAVTRITATPVT* |
Ga0136449_1020750062 | 3300010379 | Peatlands Soil | LRRLYRIENDIPLMLPKLAVPVSDEEHNRLMKCARRGEVTMITAGQADVLADDPV* |
Ga0136449_1029325082 | 3300010379 | Peatlands Soil | LRRLYRIENDIPLMLPKLAVPVSDEEHNRLMKCARRGEVTRITADQADVLADDPGVTR* |
Ga0134126_122793481 | 3300010396 | Terrestrial Soil | DIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEADILADELL* |
Ga0134126_124744462 | 3300010396 | Terrestrial Soil | LYRIENDIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAEMLADEML* |
Ga0126361_106521631 | 3300010876 | Boreal Forest Soil | DIPVMLPKLAVPVPDEEHERLMKCARRGEVTRITAGEADVLAD* |
Ga0138514_1001093701 | 3300011003 | Soil | DIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEADILADDLL* |
Ga0137389_102683822 | 3300012096 | Vadose Zone Soil | LYNPLLRRLYRIENDIPLMLPKLAVPVPDEEHNRLMKCARRGEVTKITAGQADVLADDLM |
Ga0137382_113265051 | 3300012200 | Vadose Zone Soil | MLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEPDMLADDVADDLA* |
Ga0137376_114735321 | 3300012208 | Vadose Zone Soil | RLYRIENDIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAEMLADELL* |
Ga0137378_102550802 | 3300012210 | Vadose Zone Soil | PKLAVPVPDEEHNRLMKCARRGEVTAITAGEADILADDLL* |
Ga0137413_108883842 | 3300012924 | Vadose Zone Soil | YRIEDDIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEADIGADDLL* |
Ga0157378_120263401 | 3300013297 | Miscanthus Rhizosphere | VPVPDEEHNRLMKCARRGEVTAITAGEAEMLADEMH* |
Ga0157372_113550091 | 3300013307 | Corn Rhizosphere | MLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAEMLADELL* |
Ga0181532_100884801 | 3300014164 | Bog | IPLMLPKLAVPVSDEEHNRLMKCARRGEVTRITADQADVLADDPGVTR* |
Ga0157376_110356921 | 3300014969 | Miscanthus Rhizosphere | RLYRIENDIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAGMLADELL* |
Ga0137412_108919072 | 3300015242 | Vadose Zone Soil | VPVPDEEHNRLMKCARRGEVTAITAGEADIGADDLL* |
Ga0182035_101236832 | 3300016341 | Soil | DGVPLMLAHQAVPVPEEEHHRLMKCARRGEVTAITAGQADILAGD |
Ga0182039_110836841 | 3300016422 | Soil | EDGIPLMLAHQAVPVPEEEHQRLVKCARRGEVTRVTAGQTDILGEDGMARPG |
Ga0187820_10049533 | 3300017924 | Freshwater Sediment | MLASQAVPVPEEEHHRLMKCARRGEVTAITAGQAGILTGD |
Ga0187820_10562753 | 3300017924 | Freshwater Sediment | ANQAVPVPEEEHQRLMACARRGEVTRATAGQADILSGD |
Ga0187814_103660472 | 3300017932 | Freshwater Sediment | ARQAVPVPEEEHNRLMKCARRGEVTAITAGQADILDGD |
Ga0187801_100132921 | 3300017933 | Freshwater Sediment | QAVPVPEEEHNRLMKCARRGEVTAITAGQADILDGD |
Ga0187819_106050981 | 3300017943 | Freshwater Sediment | PRLHRLYRIQDGVPLMLPRQAVPVPEEEHQRLMKCARRGEVTAITAGQGDIMAGD |
Ga0187819_107283541 | 3300017943 | Freshwater Sediment | LASQAVPVPEEEHNRLMKCARRGEVTAITAGQADILAD |
Ga0187817_110181322 | 3300017955 | Freshwater Sediment | GVPLMLANQAVPVPEEEHQRLLKCARRGEVTRITAGQMDILSGD |
Ga0187783_111602771 | 3300017970 | Tropical Peatland | MLPALAEPVPDEEHNRLVKCARRGQATSTAREAGLLAADEQTA |
Ga0187781_104066921 | 3300017972 | Tropical Peatland | NQAVPVPEEEHQRLMKCARRGEVARITAGQTDILGEDGS |
Ga0187780_103264561 | 3300017973 | Tropical Peatland | MLARQAVPVPEEDHNRLMKCARRGEVTAITAGGGEILGD |
Ga0187883_103410631 | 3300018037 | Peatland | KLAVPVSDEEHNRLMKCARRGEVTRITADQADVLADDPGVTR |
Ga0187765_103145192 | 3300018060 | Tropical Peatland | KDGVPVMLPKLAVPVPDEEHDRLMKCARRGEVTTITAGEPGVLADDLT |
Ga0187765_109138912 | 3300018060 | Tropical Peatland | LMLASQAVPVPEEEHHRLMKCARRGEVTAITASQADILTGD |
Ga0187784_101327031 | 3300018062 | Tropical Peatland | QAVPVPEEEHQRLMKCARRGEVARITAGQTDILGEDGS |
Ga0187772_102233864 | 3300018085 | Tropical Peatland | MRANQAVPVPDEGHQRLMKCARRGEVTRITADQADVLGDDRK |
Ga0187772_105202682 | 3300018085 | Tropical Peatland | RLYRIEDGIPLMLANQAVPVPEEEHQRLMGCARRGEVTRATAGQADILSGD |
Ga0187769_106850211 | 3300018086 | Tropical Peatland | EDGIPLMLANQAVPVPEEEHQRLVKCARRGEVTRITADEAGILGDEGR |
Ga0187769_113320362 | 3300018086 | Tropical Peatland | MLPKRAVPVPDEEHTRLLTCARRGEVTAITADEILADDLD |
Ga0066669_102662101 | 3300018482 | Grasslands Soil | PRLRRLYRIENDIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGETGILADELL |
Ga0179594_100902791 | 3300020170 | Vadose Zone Soil | VPVPDEEHNRLMKCARRGEVTAITAGEAEMLADELL |
Ga0210403_107365191 | 3300020580 | Soil | PKLAVPVPEEEHNRLMKCARRGEVTAITAGEDGLLAGDLGEPGDLGEPGDLG |
Ga0210401_101930893 | 3300020583 | Soil | RLRWLYRIEDGIPLMLASQAVAVPEQEHERLMRCARLGEVTAITAGQADVLAGD |
Ga0210401_106580472 | 3300020583 | Soil | RRLYRIENDIPFMLPKLAVPVPEEEHNRLMKCARRGEVTAITAGEPDMLADDVADDLA |
Ga0210404_101685951 | 3300021088 | Soil | FMLPKLAVPVPEEEHNRLMKCARRGEVTAITAGEDGLLADDLG |
Ga0210405_105972822 | 3300021171 | Soil | NDIPFMLPKLAVPVPEEEHNRLMKCARRGEVTAITAGEDGLLAGDLGEPGDLG |
Ga0210396_113605072 | 3300021180 | Soil | RLRRLYRIENDIPFMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEADLLADDLG |
Ga0213882_104468871 | 3300021362 | Exposed Rock | LPRQAVPVPDEEHNRLMKCARRGEVTTITAGDVLPDDLH |
Ga0210393_107402102 | 3300021401 | Soil | LYRIEDGIPLMLAHQAVPVPGEEHERLMKCARRGEASLTAGQDGTADD |
Ga0210393_114766711 | 3300021401 | Soil | RRLYRIENDVPLMLPRQAEPVPDEEHSRLMKCARLGQATVTAGESSLLAAD |
Ga0210385_103157632 | 3300021402 | Soil | DIPLLLPARAEPVPDEEHDRLMKCARRGEVTAITAGQSDVLAD |
Ga0210397_100486311 | 3300021403 | Soil | ASQAVAVPEQEHERLMRCARLGEVTAITAGQADVLAGD |
Ga0210397_103165551 | 3300021403 | Soil | KLAVPVPDEEHNRLMKCARRGEVTAITAGEADLLADDLG |
Ga0210397_110799902 | 3300021403 | Soil | NDIPFMLPKLAVPVPEEEHNRLMKCARRGEVTAITAGEDGLLADDLG |
Ga0210383_115305861 | 3300021407 | Soil | IPLMLANQAVAVPEQEHERLMRSARRGEVTAITAGQTDILAGE |
Ga0210390_111348471 | 3300021474 | Soil | RIEDGIPLMLASQAVAVPEQEHERLMRCARLGEVTAITTGQADVLAGD |
Ga0210410_107161952 | 3300021479 | Soil | NDIPFMLPKLAVPVPEEEHNRLMKCARRGEVTAITAGEDGLLAGGLG |
Ga0247692_10083611 | 3300024279 | Soil | LPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAGMLADELL |
Ga0207699_108142532 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | PLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAGMLADEML |
Ga0207645_102668322 | 3300025907 | Miscanthus Rhizosphere | MLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAGMLADELL |
Ga0207707_102753832 | 3300025912 | Corn Rhizosphere | RLRRLYRIENEIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAGMLADELL |
Ga0207693_104489321 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | PLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAGLLADDLI |
Ga0207663_116056031 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | YRIENDIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAGLLADDLI |
Ga0207652_105606722 | 3300025921 | Corn Rhizosphere | PLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAGMLADELL |
Ga0207687_115770862 | 3300025927 | Miscanthus Rhizosphere | RRLYRIENDIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAGMLADELL |
Ga0207664_105605991 | 3300025929 | Agricultural Soil | MLPKLAVPVPEEEHNRLMKCARRGEVTAITAGEDGLLAGDLGEPGDLG |
Ga0207690_106145542 | 3300025932 | Corn Rhizosphere | IENDIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAEMLADEML |
Ga0207658_116243922 | 3300025986 | Switchgrass Rhizosphere | LYRIENDIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAGMLADDLL |
Ga0207641_124634251 | 3300026088 | Switchgrass Rhizosphere | KLAVPVPDEEHNRLMKCARRGEVTAITAGEAGMLADELL |
Ga0209214_10370421 | 3300027071 | Forest Soil | LRRLYRIENDIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEDGLLAGDLG |
Ga0208488_10624031 | 3300027110 | Forest Soil | PLMLADQAEPVPDEEHQRLMNRARRAEVTKITADQADILGGG |
Ga0208608_1160301 | 3300027165 | Forest Soil | LMLASQAVAVPEQEHERLMRCARLGEVTAITAGQADVLAGD |
Ga0209248_102633932 | 3300027729 | Bog Forest Soil | PRLRWLYRIEDGIPLMLASQAVPVPEQEHERLVRCARRGEVTAITAGQADMLAGD |
Ga0209166_106737372 | 3300027857 | Surface Soil | YRIDDGIPLMLANQAVAVAEEEHERLLRCARRGEVTAITAGHADILAGD |
Ga0209275_104979902 | 3300027884 | Soil | DGIPLMLAKQAVPVPEEEHQRLMKCARRGEVTRITAGQADILDC |
Ga0307282_101416231 | 3300028784 | Soil | LAVPVPDEEHNRLMKCARRGEVTAITAGEADIGADDLL |
Ga0307312_100739613 | 3300028828 | Soil | MLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEADIGADDLL |
Ga0311340_100715837 | 3300029943 | Palsa | IEDGIPLMLASEAVPVPEQEHERLMTCARRGEVTAITAGQANVLGGG |
Ga0310037_103031761 | 3300030494 | Peatlands Soil | PLMLARQAVPVPDEEHNRLMKCARRGEVTAITAGQADILADD |
Ga0307482_12590531 | 3300030730 | Hardwood Forest Soil | PVMLADQAVPVPDEEHIRLMKCAGRDEVTAITGGEQDILAGYPRL |
Ga0307499_101195842 | 3300031184 | Soil | PVPDEEHNRLMKCARRGEVTAITAGEAGMLADEML |
Ga0307495_100027011 | 3300031199 | Soil | PVPDEEHNRLMKCARRGEVTAITAGEADILADDLL |
Ga0318516_100180162 | 3300031543 | Soil | MLAHQAVPVPEEEHHRLMKCARRGEVTAITAGQADILAGD |
Ga0318571_101186091 | 3300031549 | Soil | MLAHQAVPVPEEEHHRLMKCARRGGVTAITAGQADILAGD |
Ga0318573_103338182 | 3300031564 | Soil | HQAVPVPEEEHQRLVKCARRGEVTRVTAGQTDILGEDGMARPG |
Ga0318515_100045572 | 3300031572 | Soil | VPLMLAHQAVPVPEEEHHRLMKCARRGEVTAITAGQADILAGD |
Ga0318515_105842031 | 3300031572 | Soil | LMLASQAVPVPEEEHNRLMKCARRGEVSAITAGQADILTGD |
Ga0318496_108536892 | 3300031713 | Soil | VPVPDEEHNRLMKCARRGEVTTITAGEADVLAGVLADGLA |
Ga0307474_101779071 | 3300031718 | Hardwood Forest Soil | YRIEDDVPVMLADQAVPVPDEEHIRLMKCAGRDEVTAITGGEQDILAGYPRL |
Ga0318500_102834022 | 3300031724 | Soil | LMLPKLAVPVPDEEHNRLMKCARRGEVTTITAGEELTGELA |
Ga0307468_1018586621 | 3300031740 | Hardwood Forest Soil | PVPDEEHNRLMKCARRGEVTAITAGEAEMLADELL |
Ga0318494_102379032 | 3300031751 | Soil | IENGIPLMLPKLAVPVPDEEHNRLMKCARRGEVTTITAGEELTGELA |
Ga0318554_104192131 | 3300031765 | Soil | TDIPQMLPKLAAPVPDEEHNRLMKCARRGEVTAITAGEAGVLAGEVQP |
Ga0318521_103956242 | 3300031770 | Soil | LASQAVPVPEEEHNRLMKCARRGEVSAITAGQADILTGD |
Ga0318508_10697172 | 3300031780 | Soil | MLAHQAVPVPEEEHHRLMKCARRGEVTAITAGQADILTGD |
Ga0318552_101643051 | 3300031782 | Soil | IQDGIPLMLAHQAVPVPEEEHHRLMKCARRGEVTAITAGQADILAGD |
Ga0318552_101681232 | 3300031782 | Soil | MLADQAVPVPEEEHHRLMKCARRGGVTAITAGQADILAGD |
Ga0318552_102529321 | 3300031782 | Soil | PQMLPKLAAPVPDEEHNRLMKCARRGEVTAITAGEAAVLAGEVQP |
Ga0318552_103079792 | 3300031782 | Soil | LMLAHQAVPVPEEEHQRLMKCARRGEVTAITAGQGDIMAGD |
Ga0318576_102614652 | 3300031796 | Soil | QAVPVPEEEHNRLMKCARRGEVSAITAGQADILTGD |
Ga0318565_101805531 | 3300031799 | Soil | PRLRRLYRIQDGVPLMLASQAVPVPEEEHNRLMKCARRGEVSAITAGQADILTGD |
Ga0318565_103597241 | 3300031799 | Soil | IPQMLPKLAVPVPDEEHNRLMKCARRGEVTTITAGEADVMAGMLADGLA |
Ga0318517_101122622 | 3300031835 | Soil | MLAHQAVPVPEREHQRMVKCARRGEVTRITAGQTDILGDDRN |
Ga0318512_102500271 | 3300031846 | Soil | QMLPKLAVPVPDEEHNRLMKCARRGEATAITAGEVLAGDV |
Ga0306919_101424712 | 3300031879 | Soil | LAHQAVPVPEEEHHRLMKCARRGEVTAITAGQADILAGD |
Ga0306921_105387661 | 3300031912 | Soil | AVPVPEEEHNRLMKCARRGEVSAITAGQADILTGD |
Ga0318569_105136822 | 3300032010 | Soil | NDIPQMLPKLAVPVPDEEHNRLMKCARRGEATAITAGEVLAGDV |
Ga0318558_104238331 | 3300032044 | Soil | PRLRRLYRIENDIPQMLPKLAVPVPDEEHNRLMKCARRGEVTTITAGEELTGELA |
Ga0318506_103092962 | 3300032052 | Soil | HQAVPVPEREHQRMVKCARRGEVTRITAGQTDILGDDRN |
Ga0318504_104195562 | 3300032063 | Soil | YRIDNGIPLMLPKLAVPVPDEEHNRLMKCARRGEVTTITAGEELTGELA |
Ga0318513_105298791 | 3300032065 | Soil | RIENGIPLMLPKLAVPVPDEEHNRLMKCARRGEVTTITAGEELTGELA |
Ga0318524_102785451 | 3300032067 | Soil | VPLMLARQAVPVPEEEHNRLMKCARRGEVTAITAGQADILAGD |
Ga0318553_103392081 | 3300032068 | Soil | IENDIPQMLPKLAAPVPDEEHNRLMKCARRGEVTAITAGEAAVLAGEVQP |
Ga0311301_114001972 | 3300032160 | Peatlands Soil | QAVPVPEEEHHRLMKCARRGEVTAITADQKDILDD |
Ga0307470_112860931 | 3300032174 | Hardwood Forest Soil | PVPDEEHNRLMKCARRGEVTAITAGEAGMLADELL |
Ga0307472_1010484301 | 3300032205 | Hardwood Forest Soil | RRLYRIENDIPFMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAGILAEDLI |
Ga0306920_1028771162 | 3300032261 | Soil | RIENDIPRMLPKLAVPVPDEEHNRLMKCARRGEVTAITAPAPDVLADVLADVLADVMADGPA |
Ga0335085_107796541 | 3300032770 | Soil | PKLAVPVPDEEHNRLMKCARRGEVTAITAGEADIGADDLRLS |
Ga0335080_121321672 | 3300032828 | Soil | RIENDIPLMLPKHAVPVPDEEHNRLMKCARRGEVTTITSGDVLTDDLD |
Ga0335083_105670391 | 3300032954 | Soil | LYRIENDIPQMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEVLADDIEPLALS |
Ga0335073_107741714 | 3300033134 | Soil | RLRRLYRIQDGVPLMLARQAVPVPEEEHNRLMKCARRGEVTAITADQADLLADD |
Ga0370514_078506_672_836 | 3300034199 | Untreated Peat Soil | RRRWLYRIEDGIPLMLASEAVPVPEQEHERLMTCARRGEVTAITAGQANVLGGG |
Ga0373948_0104787_515_670 | 3300034817 | Rhizosphere Soil | YRIENEIPLMLPKLAVPVPDEEHNRLMKCARRGEVTAITAGEAGMLADELL |
⦗Top⦘ |