Basic Information | |
---|---|
Family ID | F041460 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 160 |
Average Sequence Length | 45 residues |
Representative Sequence | VSLALIGNASGQTFARRGISIRGVFDKEVRRKPLAFAADAVSYGI |
Number of Associated Samples | 132 |
Number of Associated Scaffolds | 160 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 35.06 % |
% of genes near scaffold ends (potentially truncated) | 60.62 % |
% of genes from short scaffolds (< 2000 bps) | 69.38 % |
Associated GOLD sequencing projects | 124 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.28 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (84.375 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.500 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.625 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.625 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.95% β-sheet: 0.00% Coil/Unstructured: 52.05% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 160 Family Scaffolds |
---|---|---|
PF04986 | Y2_Tnp | 15.00 |
PF14319 | Zn_Tnp_IS91 | 8.75 |
PF13495 | Phage_int_SAM_4 | 6.25 |
PF07676 | PD40 | 2.50 |
PF00589 | Phage_integrase | 1.88 |
PF01593 | Amino_oxidase | 1.25 |
PF02630 | SCO1-SenC | 1.25 |
PF00691 | OmpA | 1.25 |
PF00069 | Pkinase | 1.25 |
PF00933 | Glyco_hydro_3 | 1.25 |
PF12697 | Abhydrolase_6 | 1.25 |
PF00425 | Chorismate_bind | 0.62 |
PF00891 | Methyltransf_2 | 0.62 |
PF17132 | Glyco_hydro_106 | 0.62 |
PF13519 | VWA_2 | 0.62 |
PF13432 | TPR_16 | 0.62 |
PF03795 | YCII | 0.62 |
PF03449 | GreA_GreB_N | 0.62 |
PF03135 | CagE_TrbE_VirB | 0.62 |
PF00140 | Sigma70_r1_2 | 0.62 |
PF00078 | RVT_1 | 0.62 |
PF00440 | TetR_N | 0.62 |
PF00194 | Carb_anhydrase | 0.62 |
PF16363 | GDP_Man_Dehyd | 0.62 |
PF13620 | CarboxypepD_reg | 0.62 |
PF00486 | Trans_reg_C | 0.62 |
PF00560 | LRR_1 | 0.62 |
PF13174 | TPR_6 | 0.62 |
PF02583 | Trns_repr_metal | 0.62 |
PF13429 | TPR_15 | 0.62 |
PF12728 | HTH_17 | 0.62 |
PF00872 | Transposase_mut | 0.62 |
PF00355 | Rieske | 0.62 |
PF01381 | HTH_3 | 0.62 |
PF14720 | NiFe_hyd_SSU_C | 0.62 |
PF00246 | Peptidase_M14 | 0.62 |
PF02518 | HATPase_c | 0.62 |
PF03979 | Sigma70_r1_1 | 0.62 |
PF12704 | MacB_PCD | 0.62 |
PF00753 | Lactamase_B | 0.62 |
PF02353 | CMAS | 0.62 |
PF00815 | Histidinol_dh | 0.62 |
PF13231 | PMT_2 | 0.62 |
PF02899 | Phage_int_SAM_1 | 0.62 |
PF10604 | Polyketide_cyc2 | 0.62 |
PF00326 | Peptidase_S9 | 0.62 |
PF16864 | Dimerisation2 | 0.62 |
PF03466 | LysR_substrate | 0.62 |
PF00561 | Abhydrolase_1 | 0.62 |
COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 5.00 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.25 |
COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 1.25 |
COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 1.25 |
COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 1.25 |
COG0141 | Histidinol dehydrogenase | Amino acid transport and metabolism [E] | 0.62 |
COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.62 |
COG1937 | DNA-binding transcriptional regulator, FrmR family | Transcription [K] | 0.62 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.62 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.62 |
COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.62 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.62 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.62 |
COG3338 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.62 |
COG3451 | Type IV secretory pathway, VirB4 component | Intracellular trafficking, secretion, and vesicular transport [U] | 0.62 |
COG4886 | Leucine-rich repeat (LRR) protein | Transcription [K] | 0.62 |
COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.62 |
COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.38 % |
Unclassified | root | N/A | 15.62 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559005|cont_contig114597 | Not Available | 512 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101409275 | Not Available | 590 | Open in IMG/M |
3300002562|JGI25382J37095_10156605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
3300002908|JGI25382J43887_10041116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2513 | Open in IMG/M |
3300002912|JGI25386J43895_10125205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
3300005176|Ga0066679_10100822 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
3300005178|Ga0066688_10483368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 799 | Open in IMG/M |
3300005179|Ga0066684_10927167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300005436|Ga0070713_101100336 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300005437|Ga0070710_10050669 | All Organisms → cellular organisms → Bacteria | 2328 | Open in IMG/M |
3300005437|Ga0070710_10323761 | Not Available | 1013 | Open in IMG/M |
3300005439|Ga0070711_100276291 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
3300005538|Ga0070731_10880659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300005764|Ga0066903_103873478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium mageritense | 804 | Open in IMG/M |
3300006050|Ga0075028_100924256 | Not Available | 539 | Open in IMG/M |
3300006059|Ga0075017_100357452 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300006102|Ga0075015_100558892 | Not Available | 666 | Open in IMG/M |
3300006163|Ga0070715_10427355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
3300006163|Ga0070715_11015832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300006354|Ga0075021_10217107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1170 | Open in IMG/M |
3300006573|Ga0074055_11034083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300006796|Ga0066665_10034411 | All Organisms → cellular organisms → Bacteria | 3360 | Open in IMG/M |
3300006796|Ga0066665_10062241 | All Organisms → cellular organisms → Bacteria | 2616 | Open in IMG/M |
3300006797|Ga0066659_10048709 | All Organisms → cellular organisms → Bacteria | 2660 | Open in IMG/M |
3300006914|Ga0075436_100826257 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300007255|Ga0099791_10465155 | Not Available | 612 | Open in IMG/M |
3300007265|Ga0099794_10500589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
3300009012|Ga0066710_104048269 | Not Available | 548 | Open in IMG/M |
3300009029|Ga0066793_10034506 | All Organisms → cellular organisms → Bacteria | 2824 | Open in IMG/M |
3300009029|Ga0066793_10262535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
3300009038|Ga0099829_10068516 | All Organisms → cellular organisms → Bacteria | 2684 | Open in IMG/M |
3300009038|Ga0099829_10724195 | Not Available | 826 | Open in IMG/M |
3300009090|Ga0099827_10188489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1710 | Open in IMG/M |
3300009524|Ga0116225_1285735 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300009628|Ga0116125_1163724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
3300009643|Ga0116110_1004437 | All Organisms → cellular organisms → Bacteria | 6541 | Open in IMG/M |
3300009646|Ga0116132_1072575 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
3300009792|Ga0126374_10173736 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
3300010343|Ga0074044_10080111 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
3300010358|Ga0126370_10021668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3708 | Open in IMG/M |
3300010360|Ga0126372_10044350 | All Organisms → cellular organisms → Bacteria | 2946 | Open in IMG/M |
3300010360|Ga0126372_10055768 | Not Available | 2711 | Open in IMG/M |
3300010362|Ga0126377_10128975 | All Organisms → cellular organisms → Bacteria | 2347 | Open in IMG/M |
3300010366|Ga0126379_11869186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
3300011050|Ga0138571_139120 | Not Available | 538 | Open in IMG/M |
3300011120|Ga0150983_12972759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300011270|Ga0137391_10769434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
3300011271|Ga0137393_10752483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 834 | Open in IMG/M |
3300012096|Ga0137389_10496413 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
3300012096|Ga0137389_10944454 | Not Available | 740 | Open in IMG/M |
3300012198|Ga0137364_10032437 | All Organisms → cellular organisms → Bacteria | 3346 | Open in IMG/M |
3300012200|Ga0137382_11259755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300012206|Ga0137380_10962003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
3300012207|Ga0137381_10328782 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
3300012209|Ga0137379_10121643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2510 | Open in IMG/M |
3300012209|Ga0137379_10987934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. UNC305MFCol5.2 | 747 | Open in IMG/M |
3300012285|Ga0137370_10259357 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
3300012349|Ga0137387_11143327 | Not Available | 552 | Open in IMG/M |
3300012357|Ga0137384_10456257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1052 | Open in IMG/M |
3300012359|Ga0137385_11326571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300012361|Ga0137360_10329595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1274 | Open in IMG/M |
3300012362|Ga0137361_10051702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3392 | Open in IMG/M |
3300012362|Ga0137361_10342159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1372 | Open in IMG/M |
3300012582|Ga0137358_10301023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1089 | Open in IMG/M |
3300012683|Ga0137398_10109005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1752 | Open in IMG/M |
3300012922|Ga0137394_11313168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
3300012923|Ga0137359_10525359 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
3300012925|Ga0137419_11889533 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300012929|Ga0137404_10111588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2222 | Open in IMG/M |
3300014165|Ga0181523_10618146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300014495|Ga0182015_10368009 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300015053|Ga0137405_1296064 | All Organisms → cellular organisms → Bacteria | 2622 | Open in IMG/M |
3300015054|Ga0137420_1116928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4811 | Open in IMG/M |
3300015193|Ga0167668_1003015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3650 | Open in IMG/M |
3300015264|Ga0137403_10007712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 12116 | Open in IMG/M |
3300016341|Ga0182035_10712318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
3300016357|Ga0182032_11122753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
3300016357|Ga0182032_11515908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300016371|Ga0182034_10115082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1958 | Open in IMG/M |
3300017822|Ga0187802_10002310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5367 | Open in IMG/M |
3300017822|Ga0187802_10194611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
3300017933|Ga0187801_10013539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2699 | Open in IMG/M |
3300017938|Ga0187854_10444050 | Not Available | 542 | Open in IMG/M |
3300017940|Ga0187853_10037539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2543 | Open in IMG/M |
3300017961|Ga0187778_10052110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2503 | Open in IMG/M |
3300017961|Ga0187778_10180007 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
3300017975|Ga0187782_10483406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L60 | 946 | Open in IMG/M |
3300018028|Ga0184608_10367699 | Not Available | 629 | Open in IMG/M |
3300018086|Ga0187769_10068330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2502 | Open in IMG/M |
3300018090|Ga0187770_10073780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2504 | Open in IMG/M |
3300019888|Ga0193751_1023878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2968 | Open in IMG/M |
3300019888|Ga0193751_1044294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1962 | Open in IMG/M |
3300020012|Ga0193732_1013883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1393 | Open in IMG/M |
3300020018|Ga0193721_1101335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
3300020170|Ga0179594_10039217 | Not Available | 1554 | Open in IMG/M |
3300020583|Ga0210401_10117372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2496 | Open in IMG/M |
3300020583|Ga0210401_10126004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2401 | Open in IMG/M |
3300021168|Ga0210406_10484252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 980 | Open in IMG/M |
3300021180|Ga0210396_10254496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1561 | Open in IMG/M |
3300021362|Ga0213882_10083909 | Not Available | 1282 | Open in IMG/M |
3300021560|Ga0126371_10002616 | All Organisms → cellular organisms → Bacteria | 15525 | Open in IMG/M |
3300023058|Ga0193714_1066166 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 507 | Open in IMG/M |
3300024290|Ga0247667_1008364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2131 | Open in IMG/M |
3300025619|Ga0207926_1130366 | Not Available | 584 | Open in IMG/M |
3300025906|Ga0207699_10320103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
3300025910|Ga0207684_10097490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2510 | Open in IMG/M |
3300025929|Ga0207664_11762863 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300025939|Ga0207665_10598313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
3300025939|Ga0207665_11038883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
3300026296|Ga0209235_1051832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1968 | Open in IMG/M |
3300026298|Ga0209236_1082409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1488 | Open in IMG/M |
3300026301|Ga0209238_1259149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300026313|Ga0209761_1044552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2534 | Open in IMG/M |
3300026330|Ga0209473_1135285 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300026342|Ga0209057_1034484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2604 | Open in IMG/M |
3300026499|Ga0257181_1003292 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
3300026528|Ga0209378_1034894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2603 | Open in IMG/M |
3300026532|Ga0209160_1043543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2675 | Open in IMG/M |
3300026538|Ga0209056_10133848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1937 | Open in IMG/M |
3300026548|Ga0209161_10175691 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
3300027376|Ga0209004_1071346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300027565|Ga0209219_1072009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
3300027587|Ga0209220_1021057 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
3300027884|Ga0209275_10486371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
3300027895|Ga0209624_10868724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 590 | Open in IMG/M |
3300027911|Ga0209698_10134651 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
3300028015|Ga0265353_1007390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 955 | Open in IMG/M |
3300028536|Ga0137415_10002898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16994 | Open in IMG/M |
3300028536|Ga0137415_10016228 | All Organisms → cellular organisms → Bacteria | 7383 | Open in IMG/M |
3300029913|Ga0311362_11147048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
3300029953|Ga0311343_11416266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300031446|Ga0170820_13229904 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300031573|Ga0310915_10781004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
3300031708|Ga0310686_117682949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4697 | Open in IMG/M |
3300031720|Ga0307469_10503997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
3300031720|Ga0307469_10932552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
3300031820|Ga0307473_10281750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
3300031833|Ga0310917_10345035 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300031910|Ga0306923_11806876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
3300031912|Ga0306921_10499619 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
3300031912|Ga0306921_11334406 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300031947|Ga0310909_10777117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
3300031962|Ga0307479_11743825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
3300032160|Ga0311301_11400026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
3300032180|Ga0307471_100584745 | Not Available | 1274 | Open in IMG/M |
3300032180|Ga0307471_102333339 | Not Available | 675 | Open in IMG/M |
3300032180|Ga0307471_102644587 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300032205|Ga0307472_100003213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7065 | Open in IMG/M |
3300032205|Ga0307472_100369182 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
3300032205|Ga0307472_100594352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
3300032261|Ga0306920_100337479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2243 | Open in IMG/M |
3300032261|Ga0306920_100985588 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
3300032261|Ga0306920_103914870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. CAP-1 | 542 | Open in IMG/M |
3300032261|Ga0306920_104111947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.88% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.25% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.25% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.38% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.38% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.12% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.12% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.75% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.88% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.88% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.88% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.25% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.25% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.25% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.25% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.62% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.62% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.62% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.62% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.62% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.62% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.62% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.62% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.62% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.62% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.62% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.62% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300011050 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 56 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
3300025619 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
cont_0565.00006130 | 2166559005 | Simulated | LIGNASGQTFALEGISIRGVFDKEVRRKPLAFAADAVGYGI |
JGIcombinedJ26739_1014092751 | 3300002245 | Forest Soil | TPGESLALIGNASGQTFGEEEVSIRGVFDKETRTKPLAFAADAVRYGIWTAVGC* |
JGI25382J37095_101566052 | 3300002562 | Grasslands Soil | GSSLALIGNASGADCRGGGISARGVFDKETRRKPLAFAADAVRYGISTAAWI* |
JGI25382J43887_100411163 | 3300002908 | Grasslands Soil | WSLALIGNASGADCRGGGISARGVFDKETRRKPLAFAADAVRYGISTAAWI* |
JGI25386J43895_101252051 | 3300002912 | Grasslands Soil | GNASGADCRGGGISARGVFDKETRRKPLAFAADAVRYGISTAAWI* |
Ga0066679_101008222 | 3300005176 | Soil | LIGNASAAVFGWKKKLTRGVFDKETRRKPLVFAADAVRYGI* |
Ga0066688_104833682 | 3300005178 | Soil | MNSISPGWSLALIGNASGADCRGGGISARGVFDKETRRKPLAFAADAVRYGIS |
Ga0066684_109271671 | 3300005179 | Soil | IPTILDEWSLALIGNASGTVLGRRRISIRGVFDKETRRKPLVFAADAGSYGI* |
Ga0070713_1011003363 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LPLALIGNASRQTFARRGISIRGVFDKEVRRKLLAFAADAWSYGI* |
Ga0070710_100506693 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | PLALIGNASGQTFARERISIRGVFDKEVRRKPLAFAADA* |
Ga0070710_103237611 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSGLPLALIGNASGQTFAWRGISIRGVFDKEVRRKPLAFAAD |
Ga0070711_1002762912 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LSLALIGNASGKQSLEGKKYIRGVFDKETRRKPLAFAADALSYGI* |
Ga0070731_108806592 | 3300005538 | Surface Soil | SVSGTISGLPLGLLGNASGKTLAGRGISTRAVFDREVRRKPLAFAGGR* |
Ga0066707_100704813 | 3300005556 | Soil | FDVRRGAAEATIRGEWSLALIGNASGTVLGRRRISIRGVFDKETRRKPLVFAADAGSYGI |
Ga0066903_1038734782 | 3300005764 | Tropical Forest Soil | LIGNASDGTLRVGKMLIRGVFDNEARRKPLALAADAVRYGI* |
Ga0075028_1009242563 | 3300006050 | Watersheds | LIGNASGPDLRGGGISIRGVFDKEVRRKPLAFAADAW |
Ga0075017_1003574522 | 3300006059 | Watersheds | LIGNASEQAFVAAGFSNRGVFDEQVRRKPLGFAADPVSDGI* |
Ga0075015_1005588923 | 3300006102 | Watersheds | LIGNASEQIFGGGAEILIRGVFDKEVRRKPLAFAADAGYAAGYGI* |
Ga0070715_104273552 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | EWSLALIGNASGKHSPGRQEYIRGVFDKETRRKPLAFAADALSYGI* |
Ga0070715_110158321 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | WSLALIGNASGKHSPGRQEYIRGVFDKETRRKPVAFAADALSYGV* |
Ga0075021_102171071 | 3300006354 | Watersheds | LPLALIGNASGQTFARRGISIRGVFDKEVRRKPLAFAADAVRYGI* |
Ga0074055_110340831 | 3300006573 | Soil | SLALIGNASERKLRVWGKMSCRGVFDKETRRKPLAFAADAVRYGI* |
Ga0066665_100344113 | 3300006796 | Soil | LRQNEIAPGLSLALIGNASGIVLGRSRISIRGVFDKEIRRKPLVFAADAVSYGI* |
Ga0066665_100622413 | 3300006796 | Soil | SLALIGNASGTVLGRRRISIRGVFDKETRRKPLVFAADAGSYGI* |
Ga0066659_100487091 | 3300006797 | Soil | SMSDVVSLALIGNASGADCRGGGISARGVFDKETRRKPLAFAADAVRYGISTAAWI* |
Ga0075426_115749141 | 3300006903 | Populus Rhizosphere | MSVLSLALIGNASAQKIGAKTVSASRGIFDKETRRKPLAFAA |
Ga0075436_1008262572 | 3300006914 | Populus Rhizosphere | LSLALIGNASGKHFPGRQEYIRGVFDKETRRKPLAFAADA |
Ga0099791_104651551 | 3300007255 | Vadose Zone Soil | LIGNASGQTFAWRGISIRGVFDKEVRRKPLAFAADAWSYGI* |
Ga0099794_105005891 | 3300007265 | Vadose Zone Soil | IGNASGADCRGGGISARGVFDKETRRKPLAFAADAVRYGISTAAWI* |
Ga0066710_1040482691 | 3300009012 | Grasslands Soil | LALIGDASGQTFARRGISIRGVFDKEVRRKPLVFAADAWNYGI |
Ga0066793_100345063 | 3300009029 | Prmafrost Soil | LIGDASGQTVGGGAEFSIRGVFDKETRRKPLAFAADAGDAADYGI* |
Ga0066793_102625352 | 3300009029 | Prmafrost Soil | LIGNASEQIFGGGAEILIRGVFDKEVRRKSLAFAADAVYAAGYGI* |
Ga0099829_100685161 | 3300009038 | Vadose Zone Soil | LIGNASEQTLGVEGISMRGVFDKETRRKPLAFAADAVRYGI* |
Ga0099829_107241952 | 3300009038 | Vadose Zone Soil | LIGNASGRLLGRRGISIRGVFDKETRRKPLAFAADAV |
Ga0099828_112591551 | 3300009089 | Vadose Zone Soil | SLALIGNASGQKAGAKPGTWNRGIFDKETRRRPLAFAADATYGD* |
Ga0099827_101884892 | 3300009090 | Vadose Zone Soil | MRLLTLSADVVSGLPLALIGSASGQAFARRGISIRGVFDKEVRRKPLAFAADAWSYGI* |
Ga0116225_12857352 | 3300009524 | Peatlands Soil | MLSLALIGNASGQAFGERGISTRGVFDKETRRKPLAFAA |
Ga0116125_11637241 | 3300009628 | Peatland | LIGNASGQIFARRGISIRGVFDKEVRRKPLAFAADAWSYGI* |
Ga0116110_10044375 | 3300009643 | Peatland | LIGNASGQTFARERVSIRGVFDKEVRRKTLVFAADAWSYGI* |
Ga0116132_10725752 | 3300009646 | Peatland | IGNASGQIFARRGISIRGVFDKEVRRKPLAFAADAWSYGI* |
Ga0126374_101737361 | 3300009792 | Tropical Forest Soil | PALPAVQSEWSLALIGNASSRTLRVGKMLIRGVFDKETRRKPLAFAAEAVRYGI* |
Ga0074044_100801111 | 3300010343 | Bog Forest Soil | GWSLALIGNASGRLLRRSGISIRGVFDKETRRKPLAFAADAVRYGI* |
Ga0126370_100216682 | 3300010358 | Tropical Forest Soil | LAVALGEWSLALIGNASSRTLRVGKMLIRGVFDKETRRKPLAFAAEAVRYGI* |
Ga0126372_100443501 | 3300010360 | Tropical Forest Soil | LIGNASGRILWVRKTLILRGVFDKETRRKPLAFAADAVRYGI* |
Ga0126372_100557683 | 3300010360 | Tropical Forest Soil | LIGNGSGKEPGGSKKYTRDVFDKKTRRKPLAFAADALRYGV* |
Ga0126377_101289753 | 3300010362 | Tropical Forest Soil | MISEWPLALIGNASGQTFALRWISIRGVFDKEVRRKPLAFAADAWGYGI* |
Ga0126379_118691861 | 3300010366 | Tropical Forest Soil | LIGNASGRTIRVGKILIRGVFDKETRRKLLAFAADAVRYVI* |
Ga0138571_1391201 | 3300011050 | Peatlands Soil | LIGNASGQAFGERGISTRGVFDKETRRKPLAFAADAVRYGISTA |
Ga0150983_129727591 | 3300011120 | Forest Soil | LIGNASGTVLGRSRISIRGVFDEETRRKPLVFAADAG |
Ga0137391_107694341 | 3300011270 | Vadose Zone Soil | LIGNASEQTLGVEGISMRGVFDEETRRKPLTFAADAVRYGI* |
Ga0137393_107524831 | 3300011271 | Vadose Zone Soil | LIGNASGQTFARRGISIRGVFDKEVRRKPLAFAEDAWSYGI* |
Ga0137389_104964131 | 3300012096 | Vadose Zone Soil | SAPIAPELSLALIGNASGTVLGRSRISIRGVFDEETRRKPLVFAADAVSYGI* |
Ga0137389_109444542 | 3300012096 | Vadose Zone Soil | LIGNASGQTFGAEGILIRGVFDKETRRKPLAFAAEAV |
Ga0137364_100324374 | 3300012198 | Vadose Zone Soil | WSLALIGNASDRTHRRKVMRTRGVFDKETRRKPLAFAAGAVRYGI* |
Ga0137382_112597551 | 3300012200 | Vadose Zone Soil | GNASGADCRGGGISARGVFDKETRRKPLAFAADAVRYGI* |
Ga0137380_109620031 | 3300012206 | Vadose Zone Soil | MPDSSLALIGNASGQLFGRRGISIRGVFDKETRRKPLAFAADAVRYGISTAAWI* |
Ga0137381_103287822 | 3300012207 | Vadose Zone Soil | LSLALIGNASDGHFGSEAKSPRGVFDKEARRKPVVFAADAVSYGI* |
Ga0137379_101216434 | 3300012209 | Vadose Zone Soil | SLALIGNASEQTLGVEGISMRGVFDKETRRKPLAFAADAVRYGI* |
Ga0137379_109879341 | 3300012209 | Vadose Zone Soil | LIGNASEQTLGVEGISMRGVFDKETRRKPLAFAADAV |
Ga0137370_102593571 | 3300012285 | Vadose Zone Soil | LALIGNASGADCRGGGISARGVFDKETRRKPLAFAAGAVRYGI* |
Ga0137387_111433272 | 3300012349 | Vadose Zone Soil | LIGNASEQTFARRGISIRGVFDKEVRREPLAFAADAWSYGI* |
Ga0137384_104562571 | 3300012357 | Vadose Zone Soil | MSVIPGLSLALIGNASEQTLGVEGISMRGVFDKETRRKPLAFAADAV |
Ga0137385_113265711 | 3300012359 | Vadose Zone Soil | TKEPEQVRGWSLALIGNASGTVLGRRRISIRGVFDKETRRKPLVFAADAVRYGI* |
Ga0137360_103295952 | 3300012361 | Vadose Zone Soil | LIGNASAAVFGWKKKLTRGVFDKETRRKPLVFAADEVRYGI* |
Ga0137361_100517023 | 3300012362 | Vadose Zone Soil | VCDSAILFITSESSLALIGNASGQTLGAEGISIRGVFDKETRRKPLAFAADAVRYGI* |
Ga0137361_103421591 | 3300012362 | Vadose Zone Soil | KLNFAGATSGWSLALIGNASEQTLGVEGISMRGVFDKETRRKPLAFAADAVRYGI* |
Ga0137358_103010232 | 3300012582 | Vadose Zone Soil | LIGNASAAVFGWKKKLTRGVFDKETRRKPLVFAADAVRHGI* |
Ga0137398_101090052 | 3300012683 | Vadose Zone Soil | LIGNASGKELWKTRAYTRGVFDKETRRKPLAFAADALSYGI* |
Ga0137394_113131681 | 3300012922 | Vadose Zone Soil | LIGNASEQTLGVEGISMRGVFDKEARRKPLAFAADAVCYGI* |
Ga0137359_105253592 | 3300012923 | Vadose Zone Soil | GWSLALIGNASEQIFGAEWISIRGVFDEETRRKPLAFAADAVRYGI* |
Ga0137419_118895332 | 3300012925 | Vadose Zone Soil | LIGNASGQTLAREGVSIRGVFDKEVRRKPLAFAADAW |
Ga0137404_101115881 | 3300012929 | Vadose Zone Soil | SGQTFAWRGISIRGVFDKEVRRKPLAFAADAWSYGI* |
Ga0181523_106181461 | 3300014165 | Bog | SLALIGNASDGHFGLKAVSRRGVFDKETRRKPLAFAADAVRYGI* |
Ga0182015_103680091 | 3300014495 | Palsa | LGVLSLALIGNASGQTFVGEGVSIRGVFDEETRRKPLAFAADAVRYGI* |
Ga0137405_12960645 | 3300015053 | Vadose Zone Soil | LIGNAAEQTFGAAGISILGVFDEEVRRKPLALAADAGYAAGYGI* |
Ga0137420_11169282 | 3300015054 | Vadose Zone Soil | LIGNASGQTLAREGVSIRGVFDKEVRRKPLAFAADAWSYGI* |
Ga0167668_10030153 | 3300015193 | Glacier Forefield Soil | MDPTIPDEWSLALIGNASGTVLERRRMSIRGVFDKETRRKPLVFAADAGSYGI* |
Ga0137403_100077122 | 3300015264 | Vadose Zone Soil | MILEVWSLALIGNASGQTFWAEGISNRGVFDEETRRKPLAFAADAGRYGI* |
Ga0182035_107123181 | 3300016341 | Soil | RSFRLDRSKDGWSLALIGNASGRALRVGKMLIRGVFDKETRRKPLALAADAVRYGI |
Ga0182032_111227531 | 3300016357 | Soil | LDEKSLALIGNASGRTVLVGRKKSIRGVFDKETRRKPLVFAADAVNCGI |
Ga0182032_115159082 | 3300016357 | Soil | LIGNASGRALRVGKMLIRGVFDKETRRKPLAFAADAGDAAGYGI |
Ga0182034_101150821 | 3300016371 | Soil | NASGRTVLGGRQKTIRGVFDNETRRKPLVFAADAVNYGI |
Ga0187802_100023105 | 3300017822 | Freshwater Sediment | LIGNASEQTLGVEGISMRGVFDKETRRKPLAFAADAVRYGI |
Ga0187802_101946112 | 3300017822 | Freshwater Sediment | IGNASDKTLRRKIMSTRGVFDKETRRKPLAFAADAVRYGI |
Ga0187801_100135391 | 3300017933 | Freshwater Sediment | SLALIGNASEQTLGVEGISMRGVFDKETRRKPLAFAADAVRYGI |
Ga0187854_104440502 | 3300017938 | Peatland | LIGNASGQTFARERVSIRGVFDKEVRRKTLVFAADAWSYGI |
Ga0187853_100375392 | 3300017940 | Peatland | LIGNASGQIFARRGISIRGVFDKEVRRKPLAFAADAWSYGI |
Ga0187778_100521103 | 3300017961 | Tropical Peatland | SLALIGNASGRAVWGWKKSTRGVFDKETRRKPLAFAADAVRYGI |
Ga0187778_101800073 | 3300017961 | Tropical Peatland | MNPEWSLALIGNASGRAVWGWKKSTRGVFDKETRRKPLAFAADAV |
Ga0187782_104834061 | 3300017975 | Tropical Peatland | LIGNASDGTLRVGKMLIRGVFDKEARRKPLALAADAVRYGI |
Ga0184608_103676991 | 3300018028 | Groundwater Sediment | LIGNASGQTFAWRGISILGVFDKEVRRKPLAFAADA |
Ga0187769_100683303 | 3300018086 | Tropical Peatland | SLALIGNASGMTLLVGKSLIRGVFDKETRRKPLAFAADAVRYGI |
Ga0187770_100737803 | 3300018090 | Tropical Peatland | LSLALIGNASGMTLLVGKSLIRGVFDKETRRKPLAFAADAVRYGI |
Ga0193751_10238781 | 3300019888 | Soil | LIGNASGRLQGRSGISNRGVFDKETRRKPLAFAAD |
Ga0193751_10442941 | 3300019888 | Soil | LIGNASGRLQGRSGISNRGVFDKETRRKPLAFAADAVRY |
Ga0193732_10138833 | 3300020012 | Soil | CWSLALIGNASGQIFGAEGISIRGVFDKETRRKPLAFAADAVRYGI |
Ga0193721_11013353 | 3300020018 | Soil | LIGNASGHSFRGGAESRSGAFSIKEVRRKPLAFAADAVIYGI |
Ga0179594_100392172 | 3300020170 | Vadose Zone Soil | RGEWSLALIGNASGADCRGGGISARGVFDKETRRKPLAFAADAVRYGISTAAWI |
Ga0179594_101363022 | 3300020170 | Vadose Zone Soil | VSGSSLALIGNASGGNLPGNRTSIRGIFDKEARRKPLVFAADAGL |
Ga0210401_101173721 | 3300020583 | Soil | SLALIGNASDRTHRRKIMRTRGVFDKETRRKPLAFAADAVRYGI |
Ga0210401_101260044 | 3300020583 | Soil | MDGWSLALIGNASGQTVGVERVSNRGVFDKETRRKPLAFA |
Ga0210406_104842521 | 3300021168 | Soil | QTGCAILDEWSLALIGNASGQTFGAEEVSIRGVFDKETRRKPLAFAADAVRYGI |
Ga0210396_102544962 | 3300021180 | Soil | LIGNASAGNFAFGKKSLRGVFDKETRRKPLAFAADAVRYGI |
Ga0213882_100839091 | 3300021362 | Exposed Rock | LIGNASAGHFGVGKMLVRGVFDKETRRKPLAFAADAVSYGI |
Ga0126371_100026161 | 3300021560 | Tropical Forest Soil | LIGNASGRHFAFGKKSIRGVFDKETRRKPLAFVADAVR |
Ga0193714_10661662 | 3300023058 | Soil | IGNASGQTFARRWISNRGVFDKEVRRKPLAFAADAWSYGI |
Ga0247667_10083643 | 3300024290 | Soil | TLPGGWSLALIGNASGKHSPGRQEYIRGVFDKETRRKPVAFAADALSYGV |
Ga0207926_11303661 | 3300025619 | Arctic Peat Soil | LIGDASGQTVGGGAEFSIRGVFDKETRRKPLAFAADAG |
Ga0207699_103201032 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | SFHSVPWQSSELSLALIGNASGQTFVWRGILNRGVFDKEVRRKPLAFAADAWSYGI |
Ga0207684_100974901 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | FGSVSESSLALIGNASGTVFGRSRRSIRGVFDKETRRKPLVFAADAVSYGI |
Ga0207664_117628632 | 3300025929 | Agricultural Soil | MPGWPLALIGNASGQTFARERISIRGVFDKEVRRKPLAFAADA |
Ga0207665_105983132 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LIGNASGQTFARERISIRGVFDKEVRRKPLAFAADAWSYGI |
Ga0207665_110388831 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | FRVPAGWSLALIGNASGKHFPGRQEYIRGVFDKETRRKPLAFAADALSYGV |
Ga0209235_10203161 | 3300026296 | Grasslands Soil | MDEWSLALIGNASGRLWGRAESRSEAFSNEETRRKPLAFAA |
Ga0209235_10518321 | 3300026296 | Grasslands Soil | LALIGNASGADCRGGGISARGVFDKETRRKPLAFAADAVRYGISTAAWI |
Ga0209236_10824091 | 3300026298 | Grasslands Soil | LRQNEIAPGLSLALIGNASGIVLGRSRISIRGVFDKEIRRKPLVFAADAVSYGI |
Ga0209236_12915871 | 3300026298 | Grasslands Soil | MDEWSLALIGNASGRLWGRAESRSEAFSNEETRRKPLAFAAD |
Ga0209238_12591491 | 3300026301 | Grasslands Soil | WSLALIGSASGRFWARAGSRIRGVFDEETRRKPLVFAADAVRYGI |
Ga0209761_10445521 | 3300026313 | Grasslands Soil | VLSLALIGNASGADCRGGGISARGVFDKETRRKPLAFAADAVRYGISTAAWI |
Ga0209473_11352851 | 3300026330 | Soil | IPTILDEWSLALIGNASGTVLGRRRISIRGVFDKETRRKPLVFAADAGSYGI |
Ga0209057_10344843 | 3300026342 | Soil | PRIPTILDEWSLALIGNASGTVLGRRRISIRGVFDKETRRKPLVFAADAGSYGI |
Ga0257181_10032922 | 3300026499 | Soil | MAFTDGASAPIAPELSLALIGNASGTVLGRSRISIRGVFDEETRRKPLVFAADAVSYGI |
Ga0209378_10348941 | 3300026528 | Soil | MLNKLSRCKNCLLGGWSLALIGNASGSLLGRSGISIRGVFDKETRRKPLVFAADAVQYGI |
Ga0209160_10435431 | 3300026532 | Soil | MRSLPGLSLALIGNASGSLLGRSGISIRGVFDKETRRKPLVFAADAVQYGI |
Ga0209056_101338481 | 3300026538 | Soil | SGWSLALIGNASGTVLGASGITIRGVFDEETRRKPLVFVADAVSYGI |
Ga0209161_101756911 | 3300026548 | Soil | ASGTVLGRRRISIRGVFDKETRRKPLVFAADAGSYGI |
Ga0209004_10713462 | 3300027376 | Forest Soil | LIGNASGKHSPGRQEYIRGVFDKETRRRPLAFAADALSYGV |
Ga0209219_10720092 | 3300027565 | Forest Soil | NASGTVLGRSRISIGGVFDKETRRKPLVFAADAVSYGI |
Ga0209220_10210572 | 3300027587 | Forest Soil | VSLALIGNASGQTFARRGISIRGVFDKEVRRKPLAFAADAVSYGI |
Ga0209275_104863712 | 3300027884 | Soil | MTSEWPLASIGSAAVQTFARRVISIRGVFDKEVRRNALAFAADAWSYGI |
Ga0209624_108687242 | 3300027895 | Forest Soil | SLALIGNASGQTFGEEEVSIRGVFDKETRTKPLAFAADAVRYGIWTAVGC |
Ga0209698_101346511 | 3300027911 | Watersheds | LIGNAWAGHFAVEEKSIRGVFDEETRRKPLAFAADAVRYGI |
Ga0265353_10073901 | 3300028015 | Soil | LIGNASGQTVGVERVSNRGVFDKETRRKPLAFAADA |
Ga0137415_1000289819 | 3300028536 | Vadose Zone Soil | LVPNELPLALIGNASGQTLAREGVSIRGVFDKEVRRKPLAFAADAWSYGI |
Ga0137415_100162286 | 3300028536 | Vadose Zone Soil | LIGNASGQTLAREGVSIRGVFDKEVRRKPLAFAADAWSYGI |
Ga0311362_111470481 | 3300029913 | Bog | LIGNASGQAFGERGISTRGVFDKETRRKPLAFAADAVRYG |
Ga0311343_114162662 | 3300029953 | Bog | LIGNASGQAFGERGISTRGVFDKETRRKPLAFAADAVRYGI |
Ga0170820_132299042 | 3300031446 | Forest Soil | MVVTSGLPLALIGNASGQNFCVEGISLRGVFDKQVRRKPLAFAADARSYGI |
Ga0310915_107810041 | 3300031573 | Soil | LVAHGILRESSLALIGNVSGRALRVGKMLIRGVFDKETRRKPLALAADAVRYGI |
Ga0310686_1176829496 | 3300031708 | Soil | LIGNASGQAFGERGISTRGVFDKETRRKPLAFAADAVR |
Ga0307469_105039971 | 3300031720 | Hardwood Forest Soil | VSGLPLGLIGNASGQTFAWRGISIRGVFDKEVRRKPLAFAADAWSYGI |
Ga0307469_109325521 | 3300031720 | Hardwood Forest Soil | ASLLGGLSLALIGNASGKHFPGRQEYIRGVFDKETRRKPLAFAADALSYGV |
Ga0307473_102817501 | 3300031820 | Hardwood Forest Soil | VVGNSYLGITSGLPLALIGNASGQTFALERISIRGVFDKEVRRKPLAFAADA |
Ga0310917_103450351 | 3300031833 | Soil | ALVAHGILRESSLALIGNVSGRALRVGKMLIRGVFDKETRRKPLALAADAVRYGI |
Ga0306923_118068762 | 3300031910 | Soil | MDEKSLALIGNASGRTVLVGRKKSIRGVFDKETRRKPLVFAADAVNCGI |
Ga0306921_104996192 | 3300031912 | Soil | IGNASGRALRVGKMLIRGVFDKETRRKPLALAADAVRYGI |
Ga0306921_113344062 | 3300031912 | Soil | LIGNVSGRALRVGKMLIRGVFDKETRRKPLALAADAVRYGI |
Ga0310909_107771172 | 3300031947 | Soil | KDGWSLALIGNASGRALRVGKMLIRGVFDKETRRKPLALAADAVRYGI |
Ga0307479_117438251 | 3300031962 | Hardwood Forest Soil | RELSLALIGNASGRLLGRSGISTRGVFDEETRRKPLAFAADAVRYGI |
Ga0311301_114000262 | 3300032160 | Peatlands Soil | ALIGNASDKTLRRKIMRTRGVFDKETRRKPLAFAADAVRYGI |
Ga0307471_1005847452 | 3300032180 | Hardwood Forest Soil | LIGNASGQTFAWRGISIRGVFDKEVRRKPLAFVADAWSYGI |
Ga0307471_1023333391 | 3300032180 | Hardwood Forest Soil | MACVEVRVPTSEWPLALIGNAAGQTFAWRGISIRGVFDKEVRRKPLAFAADA |
Ga0307471_1026445871 | 3300032180 | Hardwood Forest Soil | LIGNASGQTFAWRGISIRGVFDKEVRRKPLAFAADAWSY |
Ga0307472_1000032136 | 3300032205 | Hardwood Forest Soil | MDDSRTLPGGWSLALIGNASGKHSPGRQEYIRGVFDKETRRKPVAFAADALSYGV |
Ga0307472_1003691821 | 3300032205 | Hardwood Forest Soil | YCGKNRLACQAIVSGWSLALIGNASERTFGLRGKTVPRGVFDKETRRKPLAFAADAVRYG |
Ga0307472_1005943522 | 3300032205 | Hardwood Forest Soil | SGTVFGRSRISIRGDFDEETRRKPLVFAVDAGSYGI |
Ga0306920_1003374793 | 3300032261 | Soil | LIGNASGRALRVGKMLIRGVFDKETRRKPLALAADAVRYGI |
Ga0306920_1009855883 | 3300032261 | Soil | LIGNVSGRALRVGKMLIRGVFDKETRRKPLALAADAV |
Ga0306920_1039148701 | 3300032261 | Soil | LIGNASAHTFGRGDSIGGVFDKEVRRKPLAFAADAWS |
Ga0306920_1041119472 | 3300032261 | Soil | RVVVGLSLALIGNASGWTLRVGEMLIRGVFDKEISRKPLAFAAEAVRYGI |
⦗Top⦘ |