NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F041185

Metagenome / Metatranscriptome Family F041185

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F041185
Family Type Metagenome / Metatranscriptome
Number of Sequences 160
Average Sequence Length 41 residues
Representative Sequence KFAFPAGAVELQPGKEWPVDFGALTNAKRAKCGANASTD
Number of Associated Samples 114
Number of Associated Scaffolds 160

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.62 %
% of genes near scaffold ends (potentially truncated) 98.75 %
% of genes from short scaffolds (< 2000 bps) 86.25 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (56.250 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake
(32.500 % of family members)
Environment Ontology (ENVO) Unclassified
(73.750 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(86.250 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.91%    β-sheet: 0.00%    Coil/Unstructured: 82.09%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 160 Family Scaffolds
PF13186SPASM 5.62
PF03237Terminase_6N 3.75
PF00154RecA 2.50
PF02562PhoH 1.88
PF00583Acetyltransf_1 1.88
PF01592NifU_N 1.88
PF01370Epimerase 1.88
PF00155Aminotran_1_2 1.25
PF12146Hydrolase_4 1.25
PF14279HNH_5 1.25
PF13394Fer4_14 1.25
PF13353Fer4_12 1.25
PF10518TAT_signal 1.25
PF00383dCMP_cyt_deam_1 0.62
PF11019DUF2608 0.62
PF01223Endonuclease_NS 0.62
PF14235DUF4337 0.62
PF00378ECH_1 0.62
PF01471PG_binding_1 0.62
PF08645PNK3P 0.62
PF01521Fe-S_biosyn 0.62
PF00303Thymidylat_synt 0.62
PF00768Peptidase_S11 0.62
PF08241Methyltransf_11 0.62
PF01391Collagen 0.62
PF08804gp32 0.62
PF01476LysM 0.62
PF08443RimK 0.62
PF00745GlutR_dimer 0.62
PF13772AIG2_2 0.62
PF05118Asp_Arg_Hydrox 0.62
PF13203DUF2201_N 0.62
PF13489Methyltransf_23 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 160 Family Scaffolds
COG0468RecA/RadA recombinaseReplication, recombination and repair [L] 2.50
COG0822Fe-S cluster assembly scaffold protein IscU, NifU familyPosttranslational modification, protein turnover, chaperones [O] 1.88
COG1702Phosphate starvation-inducible protein PhoH, predicted ATPaseSignal transduction mechanisms [T] 1.88
COG1875Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domainsGeneral function prediction only [R] 1.88
COG0207Thymidylate synthaseNucleotide transport and metabolism [F] 0.62
COG0241Histidinol phosphatase/D-glycero-mannoheptose bisphosphatephosphatase, HAD superfamilyAmino acid transport and metabolism [E] 0.62
COG0316Fe-S cluster assembly iron-binding protein IscAPosttranslational modification, protein turnover, chaperones [O] 0.62
COG0373Glutamyl-tRNA reductaseCoenzyme transport and metabolism [H] 0.62
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.62
COG1864DNA/RNA endonuclease G, NUC1Nucleotide transport and metabolism [F] 0.62
COG3555Aspartyl/asparaginyl beta-hydroxylase, cupin superfamilyPosttranslational modification, protein turnover, chaperones [O] 0.62
COG4841Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF familyFunction unknown [S] 0.62


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms65.00 %
UnclassifiedrootN/A35.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000203|TB18AUG2009E_c011197All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1109Open in IMG/M
3300000756|JGI12421J11937_10073803All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1011Open in IMG/M
3300001849|RCM26_1251625Not Available776Open in IMG/M
3300001849|RCM26_1298861Not Available560Open in IMG/M
3300001850|RCM37_1248479All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage875Open in IMG/M
3300001851|RCM31_10237692Not Available586Open in IMG/M
3300002098|JGI24219J26650_1027432Not Available716Open in IMG/M
3300002195|metazooDRAFT_1217386All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300003394|JGI25907J50239_1121334All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage507Open in IMG/M
3300003787|Ga0007811_1002795Not Available2217Open in IMG/M
3300003813|Ga0007879_1011546All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage997Open in IMG/M
3300004112|Ga0065166_10060173All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1289Open in IMG/M
3300004684|Ga0065168_1000591All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6127Open in IMG/M
3300004685|Ga0065177_1006310All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2175Open in IMG/M
3300004694|Ga0065170_1022068All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage852Open in IMG/M
3300004788|Ga0007742_10002059All Organisms → cellular organisms → Bacteria2908Open in IMG/M
3300005581|Ga0049081_10088691Not Available1157Open in IMG/M
3300006029|Ga0075466_1103545All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage770Open in IMG/M
3300006037|Ga0075465_10008227All Organisms → Viruses → Predicted Viral1912Open in IMG/M
3300006037|Ga0075465_10048586All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage894Open in IMG/M
3300006037|Ga0075465_10098944All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage646Open in IMG/M
3300006072|Ga0007881_1145852Not Available579Open in IMG/M
3300006100|Ga0007806_1019296All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1445Open in IMG/M
3300006100|Ga0007806_1045623Not Available849Open in IMG/M
3300006104|Ga0007882_10077288All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1288Open in IMG/M
3300006105|Ga0007819_1117348Not Available519Open in IMG/M
3300006112|Ga0007857_1045635Not Available853Open in IMG/M
3300006112|Ga0007857_1079550Not Available604Open in IMG/M
3300006115|Ga0007816_1050948Not Available934Open in IMG/M
3300006128|Ga0007828_1054325All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage831Open in IMG/M
3300006484|Ga0070744_10118560Not Available763Open in IMG/M
3300006805|Ga0075464_10289792All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage984Open in IMG/M
3300006805|Ga0075464_10930806All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
3300006920|Ga0070748_1032364All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2141Open in IMG/M
3300006920|Ga0070748_1123002All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage977Open in IMG/M
3300007554|Ga0102820_1115357Not Available646Open in IMG/M
3300008107|Ga0114340_1000710Not Available62391Open in IMG/M
3300008120|Ga0114355_1109277All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1067Open in IMG/M
3300008267|Ga0114364_1066147All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1234Open in IMG/M
3300009068|Ga0114973_10487207All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage639Open in IMG/M
3300009151|Ga0114962_10153946All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1379Open in IMG/M
3300009151|Ga0114962_10155033All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1373Open in IMG/M
3300009152|Ga0114980_10843299Not Available508Open in IMG/M
3300009155|Ga0114968_10300932Not Available897Open in IMG/M
3300009159|Ga0114978_10104210All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1870Open in IMG/M
3300009159|Ga0114978_10230111All Organisms → Viruses → Predicted Viral1159Open in IMG/M
3300009159|Ga0114978_10394116All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage830Open in IMG/M
3300009159|Ga0114978_10570984All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage656Open in IMG/M
3300009164|Ga0114975_10494353All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae660Open in IMG/M
3300009181|Ga0114969_10096049All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1914Open in IMG/M
3300009182|Ga0114959_10084691All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1761Open in IMG/M
3300009182|Ga0114959_10461149All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage616Open in IMG/M
3300009182|Ga0114959_10466364All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage612Open in IMG/M
3300009183|Ga0114974_10044586All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2997Open in IMG/M
3300009183|Ga0114974_10194750All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1241Open in IMG/M
3300009183|Ga0114974_10324966All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage898Open in IMG/M
3300009183|Ga0114974_10425097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage756Open in IMG/M
3300009183|Ga0114974_10429195Not Available752Open in IMG/M
3300009184|Ga0114976_10397088Not Available722Open in IMG/M
3300009185|Ga0114971_10769960Not Available523Open in IMG/M
3300009218|Ga0103848_1128381Not Available519Open in IMG/M
3300010157|Ga0114964_10116978All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1313Open in IMG/M
3300010157|Ga0114964_10224546Not Available898Open in IMG/M
3300010157|Ga0114964_10548097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
3300010157|Ga0114964_10633813All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage501Open in IMG/M
3300010158|Ga0114960_10328821All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage760Open in IMG/M
3300010334|Ga0136644_10270280All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage993Open in IMG/M
3300010334|Ga0136644_10366295Not Available823Open in IMG/M
3300010334|Ga0136644_10413670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage763Open in IMG/M
3300010334|Ga0136644_10438996All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage735Open in IMG/M
3300010334|Ga0136644_10707211All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes547Open in IMG/M
3300010354|Ga0129333_11698298All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300010885|Ga0133913_11624895All Organisms → Viruses → Predicted Viral1629Open in IMG/M
3300011010|Ga0139557_1039556All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage817Open in IMG/M
3300012012|Ga0153799_1008547All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2344Open in IMG/M
3300012352|Ga0157138_1021772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1030Open in IMG/M
3300012665|Ga0157210_1032901All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage809Open in IMG/M
3300012667|Ga0157208_10003883All Organisms → Viruses → Predicted Viral2575Open in IMG/M
3300013285|Ga0136642_1093791All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage778Open in IMG/M
3300013285|Ga0136642_1110359All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage703Open in IMG/M
3300013286|Ga0136641_1098840Not Available813Open in IMG/M
3300013295|Ga0170791_12229799Not Available900Open in IMG/M
3300013295|Ga0170791_14159605All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage737Open in IMG/M
3300014050|Ga0119952_1059441All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1003Open in IMG/M
3300017766|Ga0181343_1168216Not Available607Open in IMG/M
3300020159|Ga0211734_10919589Not Available741Open in IMG/M
3300020162|Ga0211735_10894988Not Available1732Open in IMG/M
3300020731|Ga0214170_1022601All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1065Open in IMG/M
3300020731|Ga0214170_1039712Not Available721Open in IMG/M
3300020733|Ga0214172_1034617All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage752Open in IMG/M
3300021127|Ga0214193_1030963Not Available624Open in IMG/M
3300021136|Ga0214167_1091539All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Calyptratae → Hippoboscoidea → Glossinidae → Glossina → Glossina567Open in IMG/M
3300021139|Ga0214166_1002656All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6855Open in IMG/M
3300021139|Ga0214166_1023071Not Available1546Open in IMG/M
3300021142|Ga0214192_1169867Not Available542Open in IMG/M
3300021438|Ga0213920_1078027Not Available648Open in IMG/M
3300021519|Ga0194048_10261288Not Available629Open in IMG/M
3300021602|Ga0194060_10579238Not Available521Open in IMG/M
3300021956|Ga0213922_1106661Not Available561Open in IMG/M
3300021962|Ga0222713_10303385Not Available1016Open in IMG/M
3300022591|Ga0236341_1010028All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3403Open in IMG/M
3300022591|Ga0236341_1012005All Organisms → Viruses → Predicted Viral2979Open in IMG/M
3300022747|Ga0228703_1121761Not Available586Open in IMG/M
3300023184|Ga0214919_10118978All Organisms → Viruses → Predicted Viral2187Open in IMG/M
3300024358|Ga0255173_1000970All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5755Open in IMG/M
3300025358|Ga0208504_1009230All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1452Open in IMG/M
3300025369|Ga0208382_1001849All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5411Open in IMG/M
3300025369|Ga0208382_1003947All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3104Open in IMG/M
3300025369|Ga0208382_1027122All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage733Open in IMG/M
3300025372|Ga0207957_1011471All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1203Open in IMG/M
3300025372|Ga0207957_1017924All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage878Open in IMG/M
3300025372|Ga0207957_1033504All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage565Open in IMG/M
3300025390|Ga0208743_1049741Not Available582Open in IMG/M
3300025400|Ga0208387_1001617All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5603Open in IMG/M
3300025402|Ga0208876_1058257All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage583Open in IMG/M
3300025402|Ga0208876_1065184Not Available544Open in IMG/M
3300025413|Ga0208614_1016065All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1274Open in IMG/M
3300025426|Ga0208739_1044486All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage731Open in IMG/M
3300025430|Ga0208622_1000068Not Available46420Open in IMG/M
3300025437|Ga0208742_1067154All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300025595|Ga0208248_1038938Not Available1097Open in IMG/M
3300025598|Ga0208379_1088740All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage750Open in IMG/M
3300025655|Ga0208795_1171119All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage527Open in IMG/M
3300025723|Ga0208741_10015798All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1913Open in IMG/M
3300025723|Ga0208741_10072545All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage776Open in IMG/M
3300025781|Ga0208386_1022254All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage959Open in IMG/M
3300025781|Ga0208386_1034380Not Available719Open in IMG/M
3300025789|Ga0208499_1067691Not Available536Open in IMG/M
3300025896|Ga0208916_10244996All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage779Open in IMG/M
3300025896|Ga0208916_10280343Not Available725Open in IMG/M
3300026573|Ga0255269_1135132All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage664Open in IMG/M
3300027186|Ga0208797_1053750All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage505Open in IMG/M
3300027467|Ga0255154_1058720All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage858Open in IMG/M
3300027631|Ga0208133_1145368All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage547Open in IMG/M
3300027708|Ga0209188_1008397All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6077Open in IMG/M
3300027708|Ga0209188_1187665All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage753Open in IMG/M
3300027708|Ga0209188_1210958All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage693Open in IMG/M
3300027736|Ga0209190_1033605All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2727Open in IMG/M
3300027736|Ga0209190_1120236Not Available1180Open in IMG/M
3300027736|Ga0209190_1157929Not Available975Open in IMG/M
3300027741|Ga0209085_1098333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1291Open in IMG/M
3300027741|Ga0209085_1300320Not Available612Open in IMG/M
3300027747|Ga0209189_1084552All Organisms → Viruses → Predicted Viral1451Open in IMG/M
3300027747|Ga0209189_1275383Not Available663Open in IMG/M
3300027749|Ga0209084_1111211All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED971193Open in IMG/M
3300027749|Ga0209084_1221000All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage751Open in IMG/M
3300027749|Ga0209084_1365921Not Available524Open in IMG/M
3300027754|Ga0209596_1219342Not Available799Open in IMG/M
3300027777|Ga0209829_10122199Not Available1229Open in IMG/M
3300027782|Ga0209500_10426026All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage528Open in IMG/M
3300027798|Ga0209353_10476306Not Available501Open in IMG/M
3300027808|Ga0209354_10318823Not Available616Open in IMG/M
3300027963|Ga0209400_1009735All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6157Open in IMG/M
3300027969|Ga0209191_1364634All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes518Open in IMG/M
3300028393|Ga0304728_1135518All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage907Open in IMG/M
3300028393|Ga0304728_1195297All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage705Open in IMG/M
3300031813|Ga0316217_10240906Not Available723Open in IMG/M
3300032093|Ga0315902_11120705Not Available575Open in IMG/M
3300032676|Ga0316229_1206217All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage763Open in IMG/M
3300032753|Ga0316224_1023369All Organisms → Viruses → Predicted Viral2987Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake32.50%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater22.50%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater6.88%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater5.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake3.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater2.50%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton2.50%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater1.88%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater1.88%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater1.25%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.25%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.25%
LakeEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake0.62%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.62%
LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic0.62%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.62%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.62%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.62%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.62%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater0.62%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.62%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000203Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnionEnvironmentalOpen in IMG/M
3300000756Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011EnvironmentalOpen in IMG/M
3300001849Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2bEnvironmentalOpen in IMG/M
3300001850Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2aEnvironmentalOpen in IMG/M
3300001851Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3bEnvironmentalOpen in IMG/M
3300002098Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenomeEnvironmentalOpen in IMG/M
3300002195Freshwater microbial communities from San Paulo Zoo lake, Brazil - AUG 2013EnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300003787Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09EnvironmentalOpen in IMG/M
3300003813Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004684Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2)EnvironmentalOpen in IMG/M
3300004685Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2)EnvironmentalOpen in IMG/M
3300004694Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2)EnvironmentalOpen in IMG/M
3300004788Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006072Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09EnvironmentalOpen in IMG/M
3300006100Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09EnvironmentalOpen in IMG/M
3300006104Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1EnvironmentalOpen in IMG/M
3300006105Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09EnvironmentalOpen in IMG/M
3300006112Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08EnvironmentalOpen in IMG/M
3300006115Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09EnvironmentalOpen in IMG/M
3300006128Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300009218Microbial communities of water from Amazon river, Brazil - RCM1EnvironmentalOpen in IMG/M
3300010157Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaGEnvironmentalOpen in IMG/M
3300010158Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaGEnvironmentalOpen in IMG/M
3300010334Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011010Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface IceEnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012352Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37EnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300012667Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15EnvironmentalOpen in IMG/M
3300013285Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31YEnvironmentalOpen in IMG/M
3300013286Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23YEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300014050Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007BEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020731Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnionEnvironmentalOpen in IMG/M
3300020733Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnionEnvironmentalOpen in IMG/M
3300021127Freshwater microbial communities from Trout Bog Lake, WI - 05AUG2008 epilimnionEnvironmentalOpen in IMG/M
3300021136Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnionEnvironmentalOpen in IMG/M
3300021139Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnionEnvironmentalOpen in IMG/M
3300021142Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnionEnvironmentalOpen in IMG/M
3300021438Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MGEnvironmentalOpen in IMG/M
3300021519Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5mEnvironmentalOpen in IMG/M
3300021602Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5mEnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022591Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2EnvironmentalOpen in IMG/M
3300022747Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MGEnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300024358Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8dEnvironmentalOpen in IMG/M
3300025358Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes)EnvironmentalOpen in IMG/M
3300025369Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes)EnvironmentalOpen in IMG/M
3300025372Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025390Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 (SPAdes)EnvironmentalOpen in IMG/M
3300025400Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025402Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH03Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025413Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025426Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025430Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025437Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 (SPAdes)EnvironmentalOpen in IMG/M
3300025595Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M (SPAdes)EnvironmentalOpen in IMG/M
3300025598Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025723Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025781Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 (SPAdes)EnvironmentalOpen in IMG/M
3300025789Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027186Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes)EnvironmentalOpen in IMG/M
3300027467Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8hEnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027741Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027747Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027749Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027777Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027969Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028393Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031813Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoAEnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032676Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023EnvironmentalOpen in IMG/M
3300032753Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18013EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
TB18AUG2009E_01119733300000203FreshwaterANAKELQPGQEWPVDFAKLTNSKRQKCGANASAD*
JGI12421J11937_1007380313300000756Freshwater And SedimentASVKYAYPAGAIELQPGQEWPINFGALTNAKRAKCGKAD*
RCM26_125162513300001849Marine PlanktonQASGVVFAFPARARELPVGQEWPVDYGALTKAKRAKCGANASDD*
RCM26_129886113300001849Marine PlanktonIQQNTGIRFGFPQNARELGVGQEWKVDFGRLTAMKKAKCGANATVD*
RCM37_124847913300001850Marine PlanktonRVPVVEIQKQSGIAFKFPQGAVELQPGQEWAVDFGGLTNSKRKVCGANATVD*
RCM31_1023769213300001851Marine PlanktonAGVKFAFPPNAKELNPGGEWPVDFGALTNAKRAKCGKAD*
JGI24219J26650_102743223300002098LenticAFPAGAKELAPGAEWPVDFGALTNAKRQKCGAASSTD*
metazooDRAFT_121738623300002195LakeVKYSYPANAKELAPGTEWAVDFGALTNAKRQKCGRAE*
JGI25907J50239_112133413300003394Freshwater LakeGVTYAFPKNINELQPGAEWKVDYGALTNAKRAKCKNNAD*
Ga0007811_100279543300003787FreshwaterQQAGVKFAMPANATELAPGKEWPVDFGALTNAKRKLCGANADVD*
Ga0007879_101154623300003813FreshwaterGVQFALPPGGVELQPGKEWPVNFGALTNAKRAKCGANADAD*
Ga0065166_1006017343300004112Freshwater LakeQKRAGVTYAFPKNATELQPGQEWKVDFGALTRAKRAKCGANAE*
Ga0065168_100059113300004684FreshwaterGVQFAFPQGAVELAPGKEWSVDFGALTNAKRQKCGANASAD*
Ga0065177_100631043300004685FreshwaterVKYALPAGAIELAPGKEWTVDFGALTNAKRAKCGANATDD*
Ga0065170_102206813300004694FreshwaterIEQQAGVAYALPAGTKELAPGAEWKVDFGALTNSKRQKCGANASTD*
Ga0007742_1000205913300004788Freshwater LakeIMQTAGVNFSFPKGAVELAPGQEWPVDFGMLTNAKRAKCGASASSK*
Ga0049081_1008869113300005581Freshwater LenticEAAGGVKFAFPPGAKELAPGTEWPVDFGALTRAKRVKCGATASE*
Ga0075466_110354513300006029AqueousSISQIEKVAEVNFGFPKNAKELHPGKEWPVDFGALTQAKRNKCGAAAND*
Ga0075465_1000822753300006037AqueousISQIERVAEVNFSFPKNAKELHPGKEWPVDFGALTAAKRNKCGAAED*
Ga0075465_1004858613300006037AqueousISQIERVAEVNFSFPKNAKELHPGKEWPVDFGALTAAKRSKCGAAADD*
Ga0075465_1009894433300006037AqueousRVAEVNFGFPKNAKELHPGKEWSVDFGALTQAKRNKCGTTED*
Ga0007881_114585213300006072FreshwaterMPGNAQELAPGKEWPVDFGALTNAKRKLCGANADVD*
Ga0007806_101929613300006100FreshwaterAGIKFSFPQGAVELQPGKEWPVDFGALTNAKRAKCGANASAD*
Ga0007806_104562313300006100FreshwaterFPPTAKELQPGQEWPVDFGKLTASKRSKCGAGSSAD*
Ga0007882_1007728813300006104FreshwaterPANTTELQPGKEWPVDFGKLTNAKRAKCGANASDD*
Ga0007819_111734813300006105FreshwaterFPAGAVELQPGKEWPVDFGKLTNAKRAKCGAGASDD*
Ga0007857_104563513300006112FreshwaterMPANATELAPGKEWPVDFGALTNAKRKLCGANADVD*
Ga0007857_107955013300006112FreshwaterVQFAFPPGAVELQPGKEWSVDFGKLTQAKRARCGANASDD*
Ga0007816_105094813300006115FreshwaterFPPGVKELAPGAEWPVNFGALTQAKRNKCGANASAD*
Ga0007828_105432513300006128FreshwaterSNAQEVPPGKEWPVDFGKLTQAKRAKCGANASDD*
Ga0070744_1011856013300006484EstuarineYMFPANAKELNPGQEWPVDFGKLTQAKRAKCGKDDD*
Ga0075464_1028979213300006805AqueousIERVAEVNFSFPKNAKELHPGKEWPVDFGALTQAKRNKCGAVASED*
Ga0075464_1093080613300006805AqueousIYAYPKGAVEVQPGKEWPVDFGALTNAKRAKCGKAD*
Ga0070748_103236413300006920AqueousRVAEVNFSFPKNAKELHPGKEWPVDFGALTAAKRSKCGAAADD*
Ga0070748_112300213300006920AqueousERVAEVNFGLPKNAKELQPGKEWPVDFGALTQAKRNKCGAAAND*
Ga0102820_111535733300007554EstuarineSFPAGAKELAPGTEWPVSYGDLTKAKRAKCGGSGD*
Ga0114340_1000710543300008107Freshwater, PlanktonAFPKNATEVQPGKEWPVDYGALTNAKRKKCGANTN*
Ga0114355_110927713300008120Freshwater, PlanktonQKQAGVQYAFPKNATEVQPGKEWPVDYGALTNAKRKKCGANTN*
Ga0114364_106614713300008267Freshwater, PlanktonYAFPKNATEVQPGKEWPVDYGALTNAKRKKCGANTN*
Ga0114973_1048720713300009068Freshwater LakeKFPANATELAPGQEWPVNYGALTNAKRTKCGKAD*
Ga0114962_1015394633300009151Freshwater LakeMQTAGVNFAFPPGAVELAPGQEWPVDFGMLTNAKRAKCGASASP*
Ga0114962_1015503333300009151Freshwater LakeMQTAGVNFAFPPGAVELAPGQEWPVDFGMLTNAKRAKCGANASP*
Ga0114980_1084329923300009152Freshwater LakeIESQAGVRFAYPAGAKEITPGQEWPVDYGALTNAKRAKCGANAQD*
Ga0114968_1030093213300009155Freshwater LakeYHFPAGAVELQPGREWPVDFGALTNAKRAKCGKAN*
Ga0114978_1010421013300009159Freshwater LakePIAQIEQQAAVKFAFPANTKELQPGQEWPVNYGALTNAKRAKCGKAD*
Ga0114978_1023011133300009159Freshwater LakeVHFGFPQGAKELSPGQEWPVDFGALTKAKRAKCGKDDD*
Ga0114978_1039411633300009159Freshwater LakeVDYKFPQGAVELQPGQEWPVNFGALTNAKRARCGKSED*
Ga0114978_1057098413300009159Freshwater LakeYAFPAGAVELQPGQEWKVDFGALTNAKRAKCGKSND*
Ga0114975_1049435313300009164Freshwater LakeKVAGVDYKFPKGAIELAPGQEWPVDYGALTNAKRARCGKNAE*
Ga0114969_1009604933300009181Freshwater LakeFKFPKNANELAPGQEWPVNYGALTNAKRAKCGKAD*
Ga0114959_1008469133300009182Freshwater LakeVKFAFPANIQELPIGGEWPVDFGALTTAKRQKCKSAD*
Ga0114959_1046114913300009182Freshwater LakeAGVNFAFPPNANELNPGQEWPVDFGALTNAKRQKCGKNAE*
Ga0114959_1046636423300009182Freshwater LakeGVQYKFPNNAKELQPGQEWAVNFGDLTKAKRAKCGSGAD*
Ga0114974_10044586103300009183Freshwater LakeFPPNAKELPVGAEWPIDYGALTKAKRAKCGANTQE*
Ga0114974_1019475013300009183Freshwater LakeQAGVEYKFPAGAVELQPGQEWPVDFGALTNAKRAKCGKAE*
Ga0114974_1032496633300009183Freshwater LakeTYAFPKNATELQPGKEWPVDYGALTNAKRAKCGKNAE*
Ga0114974_1042509723300009183Freshwater LakeAVVDFKFPANATELAPGQEWPVNFGALTNAKRAKCGKAAE*
Ga0114974_1042919523300009183Freshwater LakeAGVKFALPPAAKEIAPGTEWSVDFGALTNAKRQKCGRAE*
Ga0114976_1039708813300009184Freshwater LakeNIKFAFPVNAKEIDPGKEWPVDYGKLTNAKRAKCGANASE*
Ga0114971_1076996013300009185Freshwater LakeSFPAGAKELAPGAEWSVDFGALTKAKRAKCGATASDD*
Ga0103848_112838123300009218River WaterTAGVRFGFPATAKELPVGQEWPVDFGALTNAKRAKCGANAKDD*
Ga0114964_1011697843300010157Freshwater LakeKFAFPQGAVELQPGSEWPVNFGALTNAKRAKCGKSDD*
Ga0114964_1022454623300010157Freshwater LakeYAFPKNAKELASGKEWPVDFGALTNAKRAKCGKTED*
Ga0114964_1054809713300010157Freshwater LakeMQEAGVKYAFPAGAIELAPGAEWPVDFGALTKAKKTRCGANAAD*
Ga0114964_1063381323300010157Freshwater LakeFAFPKTAKELAPGQEWPVDFGALTKAKRAKCGANADD*
Ga0114960_1032882123300010158Freshwater LakeGVKFAFPKGAIELAPGQEWPVDFGALTKAKRAKCGANATDD*
Ga0136644_1027028023300010334Freshwater LakeMISTIQSEAGVKFKFPVNAREITPGTEWPVDFGALTKAKRAKCGASAD*
Ga0136644_1036629523300010334Freshwater LakeQIQQEAGVKYALPPGFIEIPPGQEWPVDFGALTNAKRAKCGKAD*
Ga0136644_1041367033300010334Freshwater LakeEAGVRFAFPANAKELQPGQEWPVNFGQLTASKKQKCGANATDD*
Ga0136644_1043899623300010334Freshwater LakeNIMQEAGVKYSFPPNARELAPGAEWPVNFGALTNAKRAKCGANATD*
Ga0136644_1070721123300010334Freshwater LakeTAGVNFAFPKNARELNPGQEWPIDFGALTNAKRAKCGANAQAD*
Ga0129333_1169829813300010354Freshwater To Marine Saline GradientDFEFPANATELAPGQEWPVNYGALTNAKRAKCGKAD*
Ga0133913_1162489513300010885Freshwater LakeQIQTQAGVQYHYPVGAVELQPGQEWPVNFGALTQAKRAKCGANAE*
Ga0139557_103955633300011010FreshwaterTYAFPQGAIELSPGKEWPVDYGALINAKRKKCSGNTKSSE*
Ga0153799_100854733300012012FreshwaterMQFPLVTFPKNATELQPGQEWKVDFGALTRAKRAKCGANAE*
Ga0157138_102177213300012352FreshwaterVQYKFPAGAVELQPGQEWPVNFGALTNAKRAKCGKAD*
Ga0157210_103290133300012665FreshwaterGIAAIQKKAGVTFAFPAGAQELPVGGEWKVDFGALTNAKRAKCKGSGE*
Ga0157208_1000388313300012667FreshwaterGVQYTFPATAQELAPGAEWRVDFGALTNAKRAKCGKSSD*
Ga0136642_109379113300013285FreshwaterQSGVNYAFPKNAAELQPGKEWPVDFGALTNAKRKLCGANASVD*
Ga0136642_111035923300013285FreshwaterTAGVNFAFPKNARELDPGKEWPVDFGKLTNAKRAKCGANASTD*
Ga0136641_109884023300013286FreshwaterEKQSGVNYAFPKNAAELQPGKEWPVDFGALTNAKRKLCGANASVD*
Ga0170791_1222979913300013295FreshwaterFSFPANAQELLVGKEWPVDFGKLTNAKRAKCGANATE*
Ga0170791_1415960513300013295FreshwaterEIEKISGVDFKFPKNAKELAPGQEWPVNYGALTNAKRAKCGKAD*
Ga0119952_105944113300014050FreshwaterYNFPAGAKEIAPGNEWPVDYGALTKAKRAKCGANAE*
Ga0181343_116821613300017766Freshwater LakeGVQYHYPANAKEVQPGQEWPVNFGDLTKAKRAKCGSNAQD
Ga0211734_1091958913300020159FreshwaterQYAFPAGAVEVQPGQEWKVDYGALTNAKRAKCGKSAD
Ga0211735_1089498843300020162FreshwaterAGVQYKFPAGAVEIAPGSEWPVNYGALTNAKRAKCGRAE
Ga0214170_102260113300020731FreshwaterAFPPGAVELAPGKEWPVDFGALTNAKRQKCGANASAD
Ga0214170_103971213300020731FreshwaterPPGAQEVPPGKEWPVDFGKLTQAKRAKCGANADTD
Ga0214172_103461723300020733FreshwaterQQAGVAYALPAGTKELAPGQEWKVDFGALTNSKRQKCGANASTD
Ga0214193_103096313300021127FreshwaterAGVKFAFPPNARELPVGQEWPVDFGALTNAKRAKCGANATDD
Ga0214167_109153923300021136FreshwaterKFAFPANAKELAPGAEWPVDFGALTKAKRAKCGANASDD
Ga0214166_1002656113300021139FreshwaterADAGVQFAFPAGAKELPVGQEWPVDFGKLTAAKKAKCGNNASDD
Ga0214166_102307113300021139FreshwaterEQAGGVKFAFPANAKELAPGAEWPVDFGALTKAKRAKCGANASDD
Ga0214192_116986723300021142FreshwaterGIKFAFPQGAVELQPGKEWPVDFGALTQAKRNKCGANASAD
Ga0213920_107802733300021438FreshwaterNIMQEAGVKYAFPAGAIELAPGQEWPVDFGALTNAKRAKCGRAE
Ga0194048_1026128813300021519Anoxic Zone FreshwaterVHFGFPQGGKELNPGQEWPVDFGKLTQVKRAKCGANAED
Ga0194060_1057923823300021602Anoxic Zone FreshwaterGVKFAFPANARELQPGQEWPVDFGKLTQAKRTKCGANASTD
Ga0213922_110666113300021956FreshwaterTMISTIQSQAGIQFKFPANAQEVTPGTEWPVDYGALTKAKRAKCGANAE
Ga0222713_1030338523300021962Estuarine WaterQIQEYAGVRFAFPANARELAPGQEWPVDYGALTNAKRAKCGKAD
Ga0236341_101002893300022591FreshwaterIQEAAGVKYAFPANGKELAPGAEWPVDFGALTNAKRAKCGANAGTD
Ga0236341_101200513300022591FreshwaterGVQYAFPAGAKELQPGTEWPVNFGAFTPAKRNKCGANASAD
Ga0228703_112176123300022747FreshwaterFAYPAGAKELQPGQEWPVDYGALTNAKRAKCGANATD
Ga0214919_1011897813300023184FreshwaterADIQKQAGVIYAYPQGAVEVQPGKEWPVDFGALTNAKRAKCGKAD
Ga0255173_1000970113300024358FreshwaterIQKQSGITFKYPANAKELQPGQEWPVDFGALTNAKRAKCGKNAE
Ga0208504_100923033300025358FreshwaterFAMPANATELAPGKEWPVDFGALTNAKRKLCGANADVD
Ga0208382_100184963300025369FreshwaterAAGVQFAFPPGAQEVPPGKEWPVDFGKLTQAKRTKCGASASDD
Ga0208382_100394743300025369FreshwaterAMPANATELAPGKEWPVDFGALTNAKRKLCGANADVD
Ga0208382_102712213300025369FreshwaterQQAGVKFAMPANATELAPGKEWPVDFGALTNAKRKLCGANADVD
Ga0207957_101147133300025372FreshwaterVQFAFPANAQEVPPGKEWPVDFGKLTQAKRAKCGANASAD
Ga0207957_101792413300025372FreshwaterIEQAGGVQFAFPPGAVELAPGKEWPVDFGALTNAKRQKCGANASAD
Ga0207957_103350423300025372FreshwaterAGGVQFAFPQGAVELAPGKEWPVDFGALTNAKRQKCGANASAD
Ga0208743_104974123300025390FreshwaterAQVNYALPQGGVELQPGKEWSVDFGKLTQMKRQKCGANASDD
Ga0208387_100161713300025400FreshwaterVQFAFPQGAVELAPGKEWSVDFGALTNAKRQKCGANASAD
Ga0208876_105825723300025402FreshwaterVKFAFPANAKELAPGQEWPVDFGKLTQAKRAKCGAGASDD
Ga0208876_106518423300025402FreshwaterIEADSGIKFAFPQGAVELQPGKEWPVDFGALTNAKRAKCGANASTD
Ga0208614_101606513300025413FreshwaterGVQFAFPQGAVELAPGKEWSVDFGALTNAKRQKCGANASAD
Ga0208739_104448613300025426FreshwaterMPGNAQELAPGKEWPVDFGALTNAKRKLCGANASVD
Ga0208622_100006813300025430FreshwaterQFAFPQGAVELAPGKEWSVDFGALTNAKRQKCGANASAD
Ga0208742_106715413300025437FreshwaterQAGVKFAMPANATELAPGKEWPVDFGALTNAKRKLCGANADVD
Ga0208248_103893833300025595FreshwaterIEQSAGVMFGFPKGAIELPPGREWAVDFGALTNAKRKKCG
Ga0208379_108874013300025598FreshwaterAFPANTVELQPGKEWPVDFGALTKAKRAKCGANASDD
Ga0208795_117111933300025655AqueousLTKFRVSISQIERVAEVNFSFPKNAKELHPGKEWPVDFGALTQAKRNKCGAAAND
Ga0208741_1001579813300025723FreshwaterIMSAAQVKYALPPGGVELQPGKEWPVDFGALTNAKRAKCGATASDD
Ga0208741_1007254513300025723FreshwaterIMQDAGVQFALPPGGVELQPGKEWPVNFGALTNAKRAKCGANADAD
Ga0208386_102225433300025781FreshwaterQAGVQFAFPQGAVELAPGKEWSVDFGALTNAKRAKCGANASAD
Ga0208386_103438013300025781FreshwaterLPQGGVELQPGKEWSVDFGKLTQAKRARCGANASDD
Ga0208499_106769113300025789FreshwaterFPAGAVELQPGKEWPVDFGKLTNAKRAKCGAGASDD
Ga0208916_1024499633300025896AqueousRVAEVNFGFPKNAKELHPGKEWPVDFGALTQAKRNKCGAVASED
Ga0208916_1028034313300025896AqueousFPANAKEITPGTEWPVDFGALTNAKRQKCGSSAKD
Ga0255269_113513213300026573FreshwaterAIQQKAGTNFSFPQGVTELPVGGEWPVDYGALTNAKRAKCKG
Ga0208797_105375023300027186EstuarineAHVKYAYPKNAKEVEPGKEWPVDFGALTRSKRAKCGANAE
Ga0255154_105872043300027467FreshwaterVASIQQEAGVKFAYPKGGRELQPGREWPVDFGALTNAKRAKCK
Ga0208133_114536813300027631EstuarineVAGVKYAYPKNAKEVEPGKEWPVDFGALTRSKRAKCGANAE
Ga0209188_1008397103300027708Freshwater LakeVNFAFPKNARELNPGQEWPVDFGALTNAKRAKCGANANDD
Ga0209188_118766513300027708Freshwater LakeTIQKSAEVYYAFPKNAKELEPGQEWPVDFGKLTQAKRAKCGKSDD
Ga0209188_121095833300027708Freshwater LakeYKFPAGAVELAPGQEWPVNFGALTNAKRAKCGKSED
Ga0209190_103360543300027736Freshwater LakeAPIAQIQEYAGVKFALPPAAKEIAPGTEWSVDFGALTNAKRQKCGRAE
Ga0209190_112023613300027736Freshwater LakeITAGVKFAYPAGARELQPGQEWPVDFGALTNAKRAKCGKNAE
Ga0209190_115792923300027736Freshwater LakeIQQQSGVQYKFPTNATELNPGQEWPVDYGALTNAKRAKCGANAQD
Ga0209085_109833333300027741Freshwater LakeFPKNAKELAPGQEWIVDFGKLTQAKRTKCGANAED
Ga0209085_130032013300027741Freshwater LakeKFPAGAKEIAPGNEWPVDYGALTKAKRAKCGANAE
Ga0209189_108455233300027747Freshwater LakeAGVKFNFPPNAKELAPGTEWPVDYGALTKAKRAKCGANAE
Ga0209189_127538333300027747Freshwater LakeGVNFAFPKNARELNPGQEWPVDFGALTNAKRAKCGANANDD
Ga0209084_111121143300027749Freshwater LakeISQIQTQAGVQFAFPANANELQPGQEWPVNYGALTNAKRAKCGKSED
Ga0209084_122100023300027749Freshwater LakePQGAIELQPGREWAVDFGALTNAKRAKCGANASTD
Ga0209084_136592113300027749Freshwater LakeFPKNARELDPGKEWPVDFGKLTNAKRAKCGANASAD
Ga0209596_121934213300027754Freshwater LakeEYAGVKFALPPAAKEIAPGTEWSVDFGALTNAKRQKCGRAE
Ga0209829_1012219923300027777Freshwater LakeKFSFPAGAQEVLVGKEWPVDFGKLTNAKRAKCGANATD
Ga0209500_1042602613300027782Freshwater LakeEQQAAVKFAFPANTKELQPGQEWPVNYGALTNAKRAKCGKAD
Ga0209353_1047630613300027798Freshwater LakeVDYKFPAGVVEVQPGAEWKVDFGALTNAKRAKCGKNAD
Ga0209354_1031882323300027808Freshwater LakeAGVDYKFPAGVIEVQPGKEWPVDFGALTNAKRAKCGKNAD
Ga0209400_100973513300027963Freshwater LakeKYALPVGAVEIQPGQEWPVDFGALTNAKRAKCGKAD
Ga0209191_136463423300027969Freshwater LakeIAQIQQKAGVTFAFPAGAQELPAGGEWKVDFGALTNAKRAKCGRAE
Ga0304728_113551823300028393Freshwater LakeQYKFPAGAVELQPGQEWPVNFGALTNAKRAKCGANASE
Ga0304728_119529713300028393Freshwater LakeVHFGFPQGGKELAPGQEWPVDFGKLTQAKRAKCGKDDD
Ga0316217_1024090613300031813FreshwaterAGVKYAMPAGAIELQPGKEWAVDFGALTNQKRKLCGTNASVD
Ga0315902_1112070523300032093FreshwaterQAGVQYAFPKNATEVQPGKEWPVDYGALTNAKRKKCGANTN
Ga0316229_120621723300032676FreshwaterFAFPPGAQEVPPGKEWPVDFGKLTQAKRAKCGAGASDD
Ga0316224_102336913300032753FreshwaterKFAFPAGAVELQPGKEWPVDFGALTNAKRAKCGANASTD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.