Metagenome Family F041134

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F041134
Family Type	Metagenome
Number of Sequences	160
Average Sequence Length	42 residues
Representative Sequence	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPVVL
Number of Associated Samples	136
Number of Associated Scaffolds	160

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	5.03 %
% of genes near scaffold ends (potentially truncated)	0.00 %
% of genes from short scaffolds (< 2000 bps)	87.50 %
Associated GOLD sequencing projects	132
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (93.750 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.000 % of family members)
Environment Ontology (ENVO)	Unclassified (29.375 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (39.375 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 18.57% β-sheet: 0.00% Coil/Unstructured: 81.43%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.26
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 160 Family Scaffolds
PF09335	SNARE_assoc	23.75
PF00581	Rhodanese	7.50
PF09084	NMT1	2.50
PF00561	Abhydrolase_1	1.88
PF00903	Glyoxalase	1.25
PF02371	Transposase_20	1.25
PF08327	AHSA1	1.25
PF00355	Rieske	1.25
PF07883	Cupin_2	1.25
PF10142	PhoPQ_related	1.25
PF00175	NAD_binding_1	0.62
PF01546	Peptidase_M20	0.62
PF07681	DoxX	0.62
PF01243	Putative_PNPOx	0.62
PF01339	CheB_methylest	0.62
PF04187	Cofac_haem_bdg	0.62
PF01850	PIN	0.62
PF01978	TrmB	0.62
PF01202	SKI	0.62
PF05988	DUF899	0.62
PF13460	NAD_binding_10	0.62
PF04909	Amidohydro_2	0.62
PF07687	M20_dimer	0.62
PF12681	Glyoxalase_2	0.62
PF13649	Methyltransf_25	0.62
PF01553	Acyltransferase	0.62
PF09994	DUF2235	0.62
PF12697	Abhydrolase_6	0.62
PF00884	Sulfatase	0.62
PF01425	Amidase	0.62

COG ID	Name	Functional Category	% Frequency in 160 Family Scaffolds
COG0398	Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family	Function unknown [S]	23.75
COG0586	Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family	Cell wall/membrane/envelope biogenesis [M]	23.75
COG1238	Uncharacterized membrane protein YqaA, VTT domain	Function unknown [S]	23.75
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	2.50
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	2.50
COG2201	Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains	Signal transduction mechanisms [T]	1.25
COG3547	Transposase	Mobilome: prophages, transposons [X]	1.25
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.62
COG2259	Uncharacterized membrane protein YphA, DoxX/SURF4 family	Function unknown [S]	0.62
COG3016	Putative heme-binding protein PhuW	General function prediction only [R]	0.62
COG4270	Uncharacterized membrane protein	Function unknown [S]	0.62
COG4312	Predicted dithiol-disulfide oxidoreductase, DUF899 family	General function prediction only [R]	0.62

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	93.75 %
Unclassified	root	N/A	6.25 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	93.75 %
Unclassified	root	N/A	6.25 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	93.75 %
Unclassified	root	N/A	6.25 %

Name	Rank	Taxonomy	Distribution
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	20.62 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	11.88 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	8.12 %
Unclassified	root	N/A	6.25 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	2.50 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.62 %

Name	Rank	Taxonomy	Distribution
Nitrospira	class	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira	6.25 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	6.25 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	6.25 %
Unclassified	root	N/A	6.25 %
unclassified Nitrospirae	no rank	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae	5.00 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	2.50 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.62 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.62 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.62 %

Name	Rank	Taxonomy	Distribution
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	6.25 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.25 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	6.25 %
Unclassified	root	N/A	6.25 %
Nitrospirae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	4.38 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	2.50 %
Nitrospirae bacterium RBG_13_43_8	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8	0.62 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.62 %
Ktedonobacteria	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria	0.62 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.62 %

Name	Rank	Taxonomy	Distribution
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	6.25 %
Nitrospiraceae	family	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae	6.25 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.25 %
Unclassified	root	N/A	6.25 %
Nitrospirae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	4.38 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	1.88 %
Ktedonobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales	0.62 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.62 %
Nitrospirae bacterium RBG_13_43_8	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8	0.62 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.62 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	6.25 %
Nitrospira	genus	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	6.25 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.25 %
Unclassified	root	N/A	6.25 %
Nitrospirae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	4.38 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.88 %
unclassified Rhodospirillaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae	0.62 %
Ktedonobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae	0.62 %
Nitrospirae bacterium RBG_13_43_8	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8	0.62 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.62 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	6.25 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.25 %
Unclassified	root	N/A	6.25 %
Nitrospira defluvii	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii	5.00 %
Nitrospirae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	4.38 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.88 %
Rhodospirillaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium	0.62 %
Ktedonobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae	0.62 %
Nitrospirae bacterium RBG_13_43_8	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8	0.62 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.62 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2228664021\|ICCgaii200_c0946176	All Organisms → cellular organisms → Bacteria	1516	Open in IMG/M
3300000580\|AF_2010_repII_A01DRAFT_1002243	All Organisms → cellular organisms → Bacteria	3100	Open in IMG/M
3300003319\|soilL2_10291204	All Organisms → cellular organisms → Bacteria	1535	Open in IMG/M
3300003321\|soilH1_10042185	All Organisms → cellular organisms → Bacteria	7388	Open in IMG/M
3300003324\|soilH2_10207545	All Organisms → cellular organisms → Bacteria	1042	Open in IMG/M
3300003993\|Ga0055468_10084772	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	870	Open in IMG/M
3300004052\|Ga0055490_10168584	All Organisms → cellular organisms → Bacteria	651	Open in IMG/M
3300004070\|Ga0055488_10052046	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii	892	Open in IMG/M
3300004156\|Ga0062589_101009755	All Organisms → cellular organisms → Bacteria	778	Open in IMG/M
3300004633\|Ga0066395_10488819	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii	707	Open in IMG/M
3300005166\|Ga0066674_10003974	All Organisms → cellular organisms → Bacteria	5636	Open in IMG/M
3300005174\|Ga0066680_10042753	All Organisms → cellular organisms → Bacteria	2629	Open in IMG/M
3300005175\|Ga0066673_10433890	All Organisms → cellular organisms → Bacteria	771	Open in IMG/M
3300005180\|Ga0066685_10109395	All Organisms → cellular organisms → Bacteria	1854	Open in IMG/M
3300005186\|Ga0066676_10075605	All Organisms → cellular organisms → Bacteria	1987	Open in IMG/M
3300005293\|Ga0065715_10404606	All Organisms → cellular organisms → Bacteria	872	Open in IMG/M
3300005294\|Ga0065705_10024662	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii	1363	Open in IMG/M
3300005295\|Ga0065707_10245687	All Organisms → cellular organisms → Bacteria	1141	Open in IMG/M
3300005332\|Ga0066388_102324032	All Organisms → cellular organisms → Bacteria	971	Open in IMG/M
3300005364\|Ga0070673_102179872	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii	526	Open in IMG/M
3300005365\|Ga0070688_100166022	All Organisms → cellular organisms → Bacteria	1520	Open in IMG/M
3300005367\|Ga0070667_100442884	All Organisms → cellular organisms → Bacteria	1186	Open in IMG/M
3300005458\|Ga0070681_10368690	All Organisms → cellular organisms → Bacteria	1346	Open in IMG/M
3300005467\|Ga0070706_100266829	All Organisms → cellular organisms → Bacteria	1598	Open in IMG/M
3300005526\|Ga0073909_10165566	All Organisms → cellular organisms → Bacteria	932	Open in IMG/M
3300005526\|Ga0073909_10604710	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	541	Open in IMG/M
3300005529\|Ga0070741_10000081	All Organisms → cellular organisms → Bacteria	348416	Open in IMG/M
3300005546\|Ga0070696_100186429	All Organisms → cellular organisms → Bacteria	1542	Open in IMG/M
3300005559\|Ga0066700_10238341	All Organisms → cellular organisms → Bacteria	1268	Open in IMG/M
3300005564\|Ga0070664_100792676	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii	886	Open in IMG/M
3300005576\|Ga0066708_10837802	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii	576	Open in IMG/M
3300005598\|Ga0066706_10434285	All Organisms → cellular organisms → Bacteria → Nitrospirae	1046	Open in IMG/M
3300005713\|Ga0066905_101097588	All Organisms → cellular organisms → Bacteria	706	Open in IMG/M
3300005840\|Ga0068870_10124710	All Organisms → cellular organisms → Bacteria	1488	Open in IMG/M
3300005888\|Ga0075289_1001992	All Organisms → cellular organisms → Bacteria	2594	Open in IMG/M
3300005937\|Ga0081455_10972434	Not Available	526	Open in IMG/M
3300006049\|Ga0075417_10037720	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	2035	Open in IMG/M
3300006049\|Ga0075417_10202242	All Organisms → cellular organisms → Bacteria	941	Open in IMG/M
3300006755\|Ga0079222_10141583	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1350	Open in IMG/M
3300006755\|Ga0079222_10462478	All Organisms → cellular organisms → Bacteria	912	Open in IMG/M
3300006804\|Ga0079221_11513356	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii	539	Open in IMG/M
3300006844\|Ga0075428_100335306	All Organisms → cellular organisms → Bacteria	1624	Open in IMG/M
3300006844\|Ga0075428_100973805	All Organisms → cellular organisms → Bacteria	898	Open in IMG/M
3300006845\|Ga0075421_100789185	All Organisms → cellular organisms → Bacteria	1095	Open in IMG/M
3300006845\|Ga0075421_102388307	All Organisms → cellular organisms → Bacteria	553	Open in IMG/M
3300006847\|Ga0075431_100058094	All Organisms → cellular organisms → Bacteria → Proteobacteria	3990	Open in IMG/M
3300006852\|Ga0075433_10184073	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	1858	Open in IMG/M
3300006865\|Ga0073934_10086011	All Organisms → cellular organisms → Bacteria → Proteobacteria	2465	Open in IMG/M
3300006880\|Ga0075429_100199569	All Organisms → cellular organisms → Bacteria	1753	Open in IMG/M
3300006880\|Ga0075429_100464739	All Organisms → cellular organisms → Bacteria	1109	Open in IMG/M
3300006904\|Ga0075424_100004023	All Organisms → cellular organisms → Bacteria	13829	Open in IMG/M
3300006914\|Ga0075436_100496230	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii	893	Open in IMG/M
3300007004\|Ga0079218_10045385	All Organisms → cellular organisms → Bacteria → Proteobacteria	2686	Open in IMG/M
3300009100\|Ga0075418_10376233	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1517	Open in IMG/M
3300009147\|Ga0114129_12854726	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	573	Open in IMG/M
3300009147\|Ga0114129_13482230	Not Available	504	Open in IMG/M
3300009792\|Ga0126374_11130504	All Organisms → cellular organisms → Bacteria → Nitrospirae	623	Open in IMG/M
3300010037\|Ga0126304_10452317	All Organisms → cellular organisms → Bacteria	860	Open in IMG/M
3300010040\|Ga0126308_10155279	All Organisms → cellular organisms → Bacteria	1448	Open in IMG/M
3300010043\|Ga0126380_11095620	All Organisms → cellular organisms → Bacteria	678	Open in IMG/M
3300010043\|Ga0126380_11800499	All Organisms → cellular organisms → Bacteria	554	Open in IMG/M
3300010046\|Ga0126384_12033332	All Organisms → cellular organisms → Bacteria	550	Open in IMG/M
3300010047\|Ga0126382_11344371	All Organisms → cellular organisms → Bacteria → Nitrospirae	648	Open in IMG/M
3300010166\|Ga0126306_10203800	All Organisms → cellular organisms → Bacteria	1495	Open in IMG/M
3300010166\|Ga0126306_10634716	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	853	Open in IMG/M
3300010333\|Ga0134080_10513650	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M
3300010359\|Ga0126376_11427000	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	718	Open in IMG/M
3300010359\|Ga0126376_12491648	All Organisms → cellular organisms → Bacteria → Nitrospirae	565	Open in IMG/M
3300010360\|Ga0126372_10682503	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1000	Open in IMG/M
3300010362\|Ga0126377_11432177	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	764	Open in IMG/M
3300010362\|Ga0126377_11526266	All Organisms → cellular organisms → Bacteria → Nitrospirae	742	Open in IMG/M
3300010362\|Ga0126377_13078774	All Organisms → cellular organisms → Bacteria	538	Open in IMG/M
3300010373\|Ga0134128_11751131	All Organisms → cellular organisms → Bacteria → Nitrospirae	684	Open in IMG/M
3300010398\|Ga0126383_13430073	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	518	Open in IMG/M
3300010399\|Ga0134127_12051566	Not Available	650	Open in IMG/M
3300010400\|Ga0134122_11378911	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	717	Open in IMG/M
3300011444\|Ga0137463_1066976	All Organisms → cellular organisms → Bacteria	1344	Open in IMG/M
3300012203\|Ga0137399_10677755	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8	868	Open in IMG/M
3300012355\|Ga0137369_10157172	All Organisms → cellular organisms → Bacteria	1799	Open in IMG/M
3300012357\|Ga0137384_10476544	All Organisms → cellular organisms → Bacteria	1026	Open in IMG/M
3300012483\|Ga0157337_1024236	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	582	Open in IMG/M
3300012489\|Ga0157349_1009761	All Organisms → cellular organisms → Bacteria	756	Open in IMG/M
3300012489\|Ga0157349_1024491	All Organisms → cellular organisms → Bacteria → Nitrospirae	592	Open in IMG/M
3300012493\|Ga0157355_1005574	Not Available	840	Open in IMG/M
3300012501\|Ga0157351_1036609	All Organisms → cellular organisms → Bacteria	595	Open in IMG/M
3300012685\|Ga0137397_10242783	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium	1341	Open in IMG/M
3300012685\|Ga0137397_10807719	Not Available	696	Open in IMG/M
3300012685\|Ga0137397_11123439	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M
3300012922\|Ga0137394_10650010	Not Available	890	Open in IMG/M
3300012930\|Ga0137407_11754269	All Organisms → cellular organisms → Bacteria → Nitrospirae	592	Open in IMG/M
3300012948\|Ga0126375_10960048	Not Available	692	Open in IMG/M
3300012948\|Ga0126375_12090224	All Organisms → cellular organisms → Bacteria → Nitrospirae	503	Open in IMG/M
3300013102\|Ga0157371_10323779	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1119	Open in IMG/M
3300013297\|Ga0157378_10277167	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1615	Open in IMG/M
3300014150\|Ga0134081_10140129	All Organisms → cellular organisms → Bacteria	788	Open in IMG/M
3300014263\|Ga0075324_1034059	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	948	Open in IMG/M
3300014263\|Ga0075324_1172677	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	511	Open in IMG/M
3300014314\|Ga0075316_1151030	All Organisms → cellular organisms → Bacteria → Nitrospirae	587	Open in IMG/M
3300014320\|Ga0075342_1089353	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	792	Open in IMG/M
3300015245\|Ga0137409_10089760	All Organisms → cellular organisms → Bacteria	2861	Open in IMG/M
3300015372\|Ga0132256_100735760	All Organisms → cellular organisms → Bacteria	1102	Open in IMG/M
3300015372\|Ga0132256_102306875	All Organisms → cellular organisms → Bacteria	642	Open in IMG/M
3300015374\|Ga0132255_100674395	All Organisms → cellular organisms → Bacteria → Proteobacteria	1533	Open in IMG/M
3300017792\|Ga0163161_10293742	All Organisms → cellular organisms → Bacteria	1278	Open in IMG/M
3300018000\|Ga0184604_10029413	All Organisms → cellular organisms → Bacteria	1384	Open in IMG/M
3300018028\|Ga0184608_10043763	All Organisms → cellular organisms → Bacteria	1738	Open in IMG/M
3300018052\|Ga0184638_1238944	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	629	Open in IMG/M
3300018064\|Ga0187773_10256062	All Organisms → cellular organisms → Bacteria	958	Open in IMG/M
3300018072\|Ga0184635_10011257	All Organisms → cellular organisms → Bacteria	3129	Open in IMG/M
3300018075\|Ga0184632_10136124	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1082	Open in IMG/M
3300018078\|Ga0184612_10146622	All Organisms → cellular organisms → Bacteria → Nitrospirae	1234	Open in IMG/M
3300018083\|Ga0184628_10460018	All Organisms → cellular organisms → Bacteria	662	Open in IMG/M
3300018422\|Ga0190265_12343226	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	635	Open in IMG/M
3300018422\|Ga0190265_13207706	All Organisms → cellular organisms → Bacteria	546	Open in IMG/M
3300018431\|Ga0066655_10273348	All Organisms → cellular organisms → Bacteria → Nitrospirae	1090	Open in IMG/M
3300018476\|Ga0190274_10784210	All Organisms → cellular organisms → Bacteria → Nitrospirae	1008	Open in IMG/M
3300019356\|Ga0173481_10090689	All Organisms → cellular organisms → Bacteria	1153	Open in IMG/M
3300019377\|Ga0190264_10529223	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	816	Open in IMG/M
3300019889\|Ga0193743_1045169	All Organisms → cellular organisms → Bacteria → Acidobacteria	1958	Open in IMG/M
3300021080\|Ga0210382_10122480	All Organisms → cellular organisms → Bacteria	1099	Open in IMG/M
3300022756\|Ga0222622_11295518	All Organisms → cellular organisms → Bacteria	536	Open in IMG/M
3300024430\|Ga0196962_10270649	All Organisms → cellular organisms → Bacteria → Nitrospirae	555	Open in IMG/M
3300025310\|Ga0209172_10110576	All Organisms → cellular organisms → Bacteria	1559	Open in IMG/M
3300025315\|Ga0207697_10220800	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	836	Open in IMG/M
3300025792\|Ga0210143_1050357	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	738	Open in IMG/M
3300025893\|Ga0207682_10583024	Not Available	528	Open in IMG/M
3300025913\|Ga0207695_10582792	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1000	Open in IMG/M
3300025939\|Ga0207665_10084867	All Organisms → cellular organisms → Bacteria → Proteobacteria	2186	Open in IMG/M
3300025972\|Ga0207668_10823639	All Organisms → cellular organisms → Bacteria	823	Open in IMG/M
3300025972\|Ga0207668_10842187	All Organisms → cellular organisms → Bacteria	814	Open in IMG/M
3300025981\|Ga0207640_10444239	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1067	Open in IMG/M
3300026023\|Ga0207677_10417702	All Organisms → cellular organisms → Bacteria → Acidobacteria	1142	Open in IMG/M
3300026116\|Ga0207674_10952811	All Organisms → cellular organisms → Bacteria	827	Open in IMG/M
3300026314\|Ga0209268_1039215	All Organisms → cellular organisms → Bacteria	1567	Open in IMG/M
3300026324\|Ga0209470_1060892	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1785	Open in IMG/M
3300026327\|Ga0209266_1024527	All Organisms → cellular organisms → Bacteria → Proteobacteria	3282	Open in IMG/M
3300026535\|Ga0256867_10299892	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300027722\|Ga0209819_10237806	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	632	Open in IMG/M
3300027748\|Ga0209689_1126615	All Organisms → cellular organisms → Bacteria → Nitrospirae	1276	Open in IMG/M
3300027765\|Ga0209073_10163426	All Organisms → cellular organisms → Bacteria → Acidobacteria	829	Open in IMG/M
3300027909\|Ga0209382_11893993	Not Available	576	Open in IMG/M
3300028381\|Ga0268264_12285889	All Organisms → cellular organisms → Bacteria	548	Open in IMG/M
3300028885\|Ga0307304_10565062	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	525	Open in IMG/M
3300031226\|Ga0307497_10013233	All Organisms → cellular organisms → Bacteria	2396	Open in IMG/M
3300031231\|Ga0170824_105304305	All Organisms → cellular organisms → Bacteria → Proteobacteria	894	Open in IMG/M
3300031538\|Ga0310888_10251404	All Organisms → cellular organisms → Bacteria	993	Open in IMG/M
3300031538\|Ga0310888_10353181	All Organisms → cellular organisms → Bacteria	853	Open in IMG/M
3300031548\|Ga0307408_100071282	All Organisms → cellular organisms → Bacteria	2569	Open in IMG/M
3300031716\|Ga0310813_10023840	All Organisms → cellular organisms → Bacteria	4221	Open in IMG/M
3300031852\|Ga0307410_11261048	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	645	Open in IMG/M
3300031908\|Ga0310900_10888308	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	726	Open in IMG/M
3300032075\|Ga0310890_10455282	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae	963	Open in IMG/M
3300033412\|Ga0310810_10170657	All Organisms → cellular organisms → Bacteria	2500	Open in IMG/M
3300033412\|Ga0310810_10661508	All Organisms → cellular organisms → Bacteria	983	Open in IMG/M
3300033412\|Ga0310810_10878124	All Organisms → cellular organisms → Bacteria	792	Open in IMG/M
3300033480\|Ga0316620_10691560	All Organisms → cellular organisms → Bacteria	969	Open in IMG/M
3300033480\|Ga0316620_11324697	All Organisms → cellular organisms → Bacteria	708	Open in IMG/M
3300033513\|Ga0316628_103279431	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	588	Open in IMG/M
3300034149\|Ga0364929_0205120	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	653	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	74.38%
Host-Associated	Host-Associated	25.62%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	63.75%
Plants	Host-Associated → Plants	25.62%
Aquatic	Environmental → Aquatic	10.62%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	63.12%
Rhizosphere	Host-Associated → Plants → Rhizosphere	18.12%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.50%
Sediment	Environmental → Aquatic → Sediment	5.62%
Marine	Environmental → Aquatic → Marine	2.50%
Freshwater	Environmental → Aquatic → Freshwater	1.25%
Thermal Springs	Environmental → Aquatic → Thermal Springs	1.25%
Floodplain	Environmental → Terrestrial → Floodplain	0.62%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	51.25%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	13.12%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	5.62%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.62%
Loam	Environmental → Terrestrial → Soil → Loam	5.62%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.62%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.00%
Wetlands	Environmental → Aquatic → Marine → Wetlands	2.50%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.88%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.25%
Sediment	Environmental → Aquatic → Thermal Springs → Sediment	1.25%
Sand	Environmental → Terrestrial → Soil → Sand	0.62%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.62%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	33.75%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	13.12%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	8.12%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	5.62%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	5.62%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	5.62%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.62%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.00%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.12%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	2.50%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.50%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.88%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.88%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.25%
Unclassified	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified	1.25%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.25%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.62%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	0.62%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.62%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	10.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	8.12%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	8.75%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	7.50%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	5.62%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	4.38%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	3.12%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	2.50%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	2.50%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	2.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.50%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	2.50%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.50%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.88%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.88%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	1.88%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.88%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.88%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.88%
Hot Spring Sediment	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment	1.25%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.25%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	1.25%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.25%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.25%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.25%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.25%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.25%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	1.25%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.62%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.62%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.62%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.62%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.62%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.62%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.62%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.62%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.62%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.62%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	0.62%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.62%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.62%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.62%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.62%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.62%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.62%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.62%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.62%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.62%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.62%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.62%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.62%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2228664021	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000580	Forest soil microbial communities from Amazon forest - 2010 replicate II A01	Environmental	Open in IMG/M
3300003319	Sugarcane bulk soil Sample L2	Environmental	Open in IMG/M
3300003321	Sugarcane bulk soil Sample H1	Environmental	Open in IMG/M
3300003324	Sugarcane bulk soil Sample H2	Environmental	Open in IMG/M
3300003993	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2	Environmental	Open in IMG/M
3300004052	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2	Environmental	Open in IMG/M
3300004070	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123	Environmental	Open in IMG/M
3300005174	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129	Environmental	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005180	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134	Environmental	Open in IMG/M
3300005186	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125	Environmental	Open in IMG/M
3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005888	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006865	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG	Environmental	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010040	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300011444	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012483	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610	Host-Associated	Open in IMG/M
3300012489	Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610	Environmental	Open in IMG/M
3300012493	Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610	Environmental	Open in IMG/M
3300012501	Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014150	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014263	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1	Environmental	Open in IMG/M
3300014314	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2	Environmental	Open in IMG/M
3300014320	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1	Environmental	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018000	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018052	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2	Environmental	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300018072	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2	Environmental	Open in IMG/M
3300018075	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1	Environmental	Open in IMG/M
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental	Open in IMG/M
3300018083	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental	Open in IMG/M
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental	Open in IMG/M
3300019889	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2	Environmental	Open in IMG/M
3300021080	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300024430	Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20	Environmental	Open in IMG/M
3300025310	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025792	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)	Environmental	Open in IMG/M
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026314	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)	Environmental	Open in IMG/M
3300026324	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)	Environmental	Open in IMG/M
3300026327	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)	Environmental	Open in IMG/M
3300026535	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)	Environmental	Open in IMG/M
3300027722	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027748	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)	Environmental	Open in IMG/M
3300027765	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028885	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031538	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Host-Associated	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M
3300034149	Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ICCgaii200_09461761	2228664021	Soil	VALLLRTKGITRVRPLEGGIDAWLADDFPFVTESLAKKPIVP
AF_2010_repII_A01DRAFT_10022435	3300000580	Forest Soil	VALLLRAKGITRVRPLEGGIEAWLARNFPFVTESLVKKPVVL*
soilL2_102912041	3300003319	Sugarcane Root And Bulk Soil	ATSARVALRLRAKGITRVRPLEGGLDAWLAHSFPFVTESLAKKPVVL*
soilH1_1004218510	3300003321	Sugarcane Root And Bulk Soil	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPGII*
soilH2_102075452	3300003324	Sugarcane Root And Bulk Soil	VALQLRAKGITRVRPLEGGIDAWLAYDFPFVTESLAKEPVLP*
Ga0055468_100847722	3300003993	Natural And Restored Wetlands	VALLLVAKGITRVRPLEGGIDAWLAHDFPFATEDLVKKSAFL*
Ga0055490_101685841	3300004052	Natural And Restored Wetlands	VALVLRAKGITRVRPLEGGIDAWLAYNFPSVTESLVKKPVVL*
Ga0055488_100520462	3300004070	Natural And Restored Wetlands	VALLLRAKGITRVRPLEGGIDAWLAYNFPSVTESLVKKPVVL*
Ga0062589_1010097551	3300004156	Soil	VALLLRTKGITRVRPLEGGIDAWLADDFPFVTESLAKKPIVP*
Ga0066395_104888191	3300004633	Tropical Forest Soil	VALLLRAKGITRVRPLEGGIDAWLAYDFPFVTESLVKKPVVL*
Ga0066674_100039742	3300005166	Soil	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTETLIKKSVVF*
Ga0066680_100427533	3300005174	Soil	VALLLRAKGITRVRPLEGGIDAWLADNFPSVTESLVNKPVVL*
Ga0066673_104338902	3300005175	Soil	VALQLRAKGITRVRPLEGGIDAWLADNFPFVTESLENKPVVL*
Ga0066685_101093952	3300005180	Soil	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVNKPVVL*
Ga0066676_100756053	3300005186	Soil	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTETLVKKSVVF*
Ga0065715_104046062	3300005293	Miscanthus Rhizosphere	VALLLRAKGITRVRPLEGGIDGWLADNFPFVTESFVEKPVVL*
Ga0065705_100246622	3300005294	Switchgrass Rhizosphere	VALLLRAKGITRVRPLEGGIDAWLAYDFPFVTXSLVKKPVVL*
Ga0065707_102456872	3300005295	Switchgrass Rhizosphere	VALLLRAKGITRVRPLEGGIDAWLASNFPFVTENLVEKSALP*
Ga0066388_1023240322	3300005332	Tropical Forest Soil	VALLLRAKGITRVRPLEGGLDAWLEYNYPFVTENLVKKPAIL*
Ga0070673_1021798721	3300005364	Switchgrass Rhizosphere	VALLLRAKGITGVRPLEGGIDAWLASNFPFVTESLVKKSVVL*
Ga0070688_1001660222	3300005365	Switchgrass Rhizosphere	VALLLRAKGITRVRPLEGGIDAWLASNFPFVTESLVKKSVVL*
Ga0070667_1004428841	3300005367	Switchgrass Rhizosphere	VALRLQAKGITRVRPLEGGIDAWLAHDFPFITESLVKKPVVL*
Ga0070681_103686902	3300005458	Corn Rhizosphere	VALLLRGKGITRVRPLEGGIDAWLAYDFPFVTESLVKKPVVL*
Ga0070706_1002668292	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	VALQLRAKGITRVRPLEGGIDAWLSDNFPFVTENLDRKPVVL*
Ga0073909_101655661	3300005526	Surface Soil	EATSARVALQLRAKGITRVRPLEGGIAAWLAYNFPFVTESLVEKPVVL*
Ga0073909_106047101	3300005526	Surface Soil	LRAKGITRVRPLEGGIAAWLAYNFPFVTESLVEKPVVL*
Ga0070741_10000081343	3300005529	Surface Soil	VALQLRAKGITRVRPLEGGIDAWLSDNFPVVTEAPVDKSVVL*
Ga0070696_1001864292	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTENLDRKPVVL*
Ga0066700_102383414	3300005559	Soil	RAKGITRVRPLEGGIDAWLAHNFPFATENLVKKPVAL*
Ga0070664_1007926761	3300005564	Corn Rhizosphere	VALLLRAKGITRVRPLEGGIDAWLASNFPFVTESL
Ga0066708_108378022	3300005576	Soil	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVETPVVL*
Ga0066706_104342853	3300005598	Soil	VALLLRAKGITRVRPLEGGIDAWLAHNFPFATENLVKKPVAL*
Ga0066905_1010975882	3300005713	Tropical Forest Soil	VALLLRAKGITRVRPLEGGIDAWLAYDFPFVTESLVKKPVIL*
Ga0068870_101247102	3300005840	Miscanthus Rhizosphere	VALRLQAKGITRVRPLEGGIDAWLAHDFPFITESLVNKPVVL*
Ga0075289_10019924	3300005888	Rice Paddy Soil	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPVVL*
Ga0081455_109724341	3300005937	Tabebuia Heterophylla Rhizosphere	RAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPVVL*
Ga0075417_100377202	3300006049	Populus Rhizosphere	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTENLDKQPVVL*
Ga0075417_102022422	3300006049	Populus Rhizosphere	VALLLRAKGITRVRPLEGGIDAWLAFNFPSVTESLVNKPVVL*
Ga0079222_101415832	3300006755	Agricultural Soil	ALRLQAKGITRVRPLEGGIDAWLAHDFPFITESLVKKPVVL*
Ga0079222_104624782	3300006755	Agricultural Soil	VALLLRAKGITRVRPLEGGIDAWLAHNFPFVTESVVEKSVML*
Ga0079221_115133561	3300006804	Agricultural Soil	VALLLRAKGITRVRPLEGGIDAWLAQNFPFVTESLVNKSVVL*
Ga0075428_1003353064	3300006844	Populus Rhizosphere	VALLLRAKGITRVRPLEGGIDAWLAHNFPFVTENLVKKPVVL*
Ga0075428_1009738053	3300006844	Populus Rhizosphere	VALQLRAKGITRVRPLENEIDAWLADNFPFVTESLVEKPVVL*
Ga0075421_1007891851	3300006845	Populus Rhizosphere	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPVEL*
Ga0075421_1023883072	3300006845	Populus Rhizosphere	VALQLRAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPAVL*
Ga0075431_1000580943	3300006847	Populus Rhizosphere	VALQLRAKGITRVRPLENEIDAWLADNFPFVTESLVKKSVVL*
Ga0075433_101840733	3300006852	Populus Rhizosphere	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLENKPVVL*
Ga0073934_100860112	3300006865	Hot Spring Sediment	VALLLRAKGITRVRPLEGGIDAWLAHNFPFSTEELGKRSVIL*
Ga0075429_1001995691	3300006880	Populus Rhizosphere	SARVALLLRAKGITRVRPLEGGIDAWLAYNFPFVTESLVKKPVVL*
Ga0075429_1004647393	3300006880	Populus Rhizosphere	VALQLRAKGITRVRPLENEIDAWLADNFPFVTESLV
Ga0075424_1000040237	3300006904	Populus Rhizosphere	VALLLRAKGITRVRPLEGGIDAWLAHDFPFVPENLGNKPVVL*
Ga0075436_1004962302	3300006914	Populus Rhizosphere	VALLLRAKGITRVRPLEGGIDAWLASNFPFVTESLV
Ga0079218_100453856	3300007004	Agricultural Soil	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVEKPVVL*
Ga0075418_103762331	3300009100	Populus Rhizosphere	LLRAKGITRVRPLEGGIDAWLAHNFPFVTENLVKKPVVL*
Ga0114129_128547261	3300009147	Populus Rhizosphere	LLRAKGITRVRPLEGGIDAWLAHNLPFVTENLDKQPVVL*
Ga0114129_134822301	3300009147	Populus Rhizosphere	KGITRVRPLEGGIDAWLADNFPFVTESLENKPVVL*
Ga0126374_111305041	3300009792	Tropical Forest Soil	TSARVALLLRAKGITRVRPLEGGIDAWLAYDFPFVTESLVKKPVVL*
Ga0126304_104523172	3300010037	Serpentine Soil	VALLLRAKGIIRVRPLEGGIDAWLADSLPFVTNGVVKKPFVL*
Ga0126308_101552791	3300010040	Serpentine Soil	VALLLRAKGITRVRPLEGGIDAWRADNLPFVTDGVVKRPDGL*
Ga0126380_110956202	3300010043	Tropical Forest Soil	VALLLRAKGITRVRPLEGGIDAWLAYDFPFVTESLDKKPVVL*
Ga0126380_118004992	3300010043	Tropical Forest Soil	VALLLRAKGITRVRPLEGGIDAWLAYDFPFVTESLVKKP
Ga0126384_120333321	3300010046	Tropical Forest Soil	VALLLRAKGITRVRPLEGGIDAWLAYDFPFVTKSLVKKPVVL*
Ga0126382_113443711	3300010047	Tropical Forest Soil	SARVALLLRAKGITRVRPLEGGIDAWLAYDFPFVTESLVKKPVVL*
Ga0126306_102038001	3300010166	Serpentine Soil	ATSARVALLLRAKGITRVRPLEGGIDAWRADNLPFVTDGVVKKPFVL*
Ga0126306_106347162	3300010166	Serpentine Soil	VALLLRAKGITRVRPLEGGIDAWRADNLPFVSDGVVKRPDGL*
Ga0134080_105136501	3300010333	Grasslands Soil	VALLLRAKGITRVRPLQGGIDGWLADNFPFVTESLVEKPVV
Ga0126376_114270001	3300010359	Tropical Forest Soil	RVALLLRAKGITRVRPLEGGIDAWLAYDFPFVTESLVKKPVIL*
Ga0126376_124916481	3300010359	Tropical Forest Soil	RVALLLRAKGITRVRPLEGGIDAWLAYDFPFVTESLVKKPVVL*
Ga0126372_106825033	3300010360	Tropical Forest Soil	RAKGITRVRPLEGGIDAWLAYDFPFVTDSLVKKPVVL*
Ga0126377_114321771	3300010362	Tropical Forest Soil	LRAKGITRVRPLEGGIDAWLADNFPFVTESLVQKPVT*
Ga0126377_115262661	3300010362	Tropical Forest Soil	VALLLRAKGITRVRPLEGGIDAWLAYDFPFVTDSLVKKPVVL*
Ga0126377_130787741	3300010362	Tropical Forest Soil	AKGITRVRPLEGGIDAWLAYDFPFVTESLDKKPVVL*
Ga0134128_117511312	3300010373	Terrestrial Soil	VALLLRAKGITRVRPLEGGIDGWLADNFPFVTESYVEKPVVL*
Ga0126383_134300732	3300010398	Tropical Forest Soil	SARVALLLRAKGITRVRPLEGGIDAWLAHDFPFVTESLVKKPVVL*
Ga0134127_120515662	3300010399	Terrestrial Soil	ARVALLLRAKGITRVRPLEGGIDGWLADNFPFVTESFVEKPVVL*
Ga0134122_113789112	3300010400	Terrestrial Soil	VALLLRAKGITRVRPLEGGIDGWLADNFPFVTESFVEKPIVL*
Ga0137463_10669763	3300011444	Soil	MALLLRAKGIAKVRPLEGGIDAWLAYNFPFFTESLVRKPVVL*
Ga0137399_106777552	3300012203	Vadose Zone Soil	VALQLRAKGITRVRPLEGGIDAWLAYNLPFVTESLVEKPVVLGETVSVIVTA
Ga0137369_101571722	3300012355	Vadose Zone Soil	VALLLRAKGITRVRPLEGGIDGWLADNFPFVTESLVEKPVVL*
Ga0137384_104765442	3300012357	Vadose Zone Soil	VALLLRAKGITRVRPLEGGIDAWLADTFPFVTETLIKKIGVF*
Ga0157337_10242362	3300012483	Arabidopsis Rhizosphere	VALLLRAKGITRVRPLEGGIAAWLAYNFPFVTESLVEKPVVL*
Ga0157349_10097611	3300012489	Unplanted Soil	VALQLRAKGITRVRPLEGGIAAWLAYNFPFVTESLVEKPV
Ga0157349_10244912	3300012489	Unplanted Soil	VALLLRAKGITRVRPLEGGIDAWLASDFPFVTESLVEKSVVL*
Ga0157355_10055742	3300012493	Unplanted Soil	QLRAKGITRVRPLEGGIDAWLAYNFPFVTESLVEKPVVL*
Ga0157351_10366091	3300012501	Unplanted Soil	VALQLRAKGITRVRPLEGGIDAWLASDFPFVTESLVEKS
Ga0137397_102427832	3300012685	Vadose Zone Soil	QLRAKGITRVRPLEGGIAAWLAYNFPFVTESLVEKPVVL*
Ga0137397_108077191	3300012685	Vadose Zone Soil	MRVALLLRAKGITRVRPLEGGIDAWLANNFPFVTESLVKKPVVPL
Ga0137397_111234393	3300012685	Vadose Zone Soil	VALQLGAKGITRVRPLEGGIDAWLADNFPFVTESLVEKPVVL*
Ga0137394_106500101	3300012922	Vadose Zone Soil	MRVALLLRAKGITRVRPLEGGIDAWLAYNFPFVTESLVKKPVVL*
Ga0137407_117542691	3300012930	Vadose Zone Soil	TSARVALLLRAKGITRVRPLEGGIDAWLADNFPSVTESLVNKPVVL*
Ga0126375_109600482	3300012948	Tropical Forest Soil	LRAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPVVL*
Ga0126375_120902241	3300012948	Tropical Forest Soil	VALLLRAKGITRVRPLEGGIDAWLAYDFPFVTESLVKKPVVF*
Ga0157371_103237791	3300013102	Corn Rhizosphere	RVALRLQAKGITRVRPLEGGIDAWLAHDFPFITESLVKKPVVL*
Ga0157378_102771672	3300013297	Miscanthus Rhizosphere	VALLLRAKGINRVRPLEGGIDAWLASNFPFVTESLVKKSVVL*
Ga0134081_101401292	3300014150	Grasslands Soil	LLLRAKGITRVRPLEGGIDAWLADNFPSVTESLVNKPVVL*
Ga0075324_10340592	3300014263	Natural And Restored Wetlands	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPVVF*
Ga0075324_11726772	3300014263	Natural And Restored Wetlands	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVNKPVVRDQLQL*
Ga0075316_11510302	3300014314	Natural And Restored Wetlands	LSSSATLALLLRAKGITRVRPLEGGIDAWLAHEFPFDSHDIVKKSVVL*
Ga0075342_10893531	3300014320	Natural And Restored Wetlands	VALLLRAKGIIRVRPLEGGIDAWLAHNFPFVTENLVKNPVAL*
Ga0137409_100897603	3300015245	Vadose Zone Soil	VALQLRAKGITRVRPLEGGIDAWLAFNFPFVTERLVNKPVVL*
Ga0132256_1007357601	3300015372	Arabidopsis Rhizosphere	AKGITRVRPLEGGIDAWLAYNFPFVTESLVEKPVVL*
Ga0132256_1023068752	3300015372	Arabidopsis Rhizosphere	MALLLRAKGITKVRPLEGGIDAGLAYNFPFFTESLVRKPVVL*
Ga0132257_1018154551	3300015373	Arabidopsis Rhizosphere	KGITRVRPLEGGIDAWLASNFPFVTESLVKNPFSERSSPF*
Ga0132255_1006743954	3300015374	Arabidopsis Rhizosphere	VALLLRAKGITRVRPLEGGIDAWLASDFPFVTESLVE
Ga0163161_102937422	3300017792	Switchgrass Rhizosphere	VALLLRAKGITRVRPLEGGIAAWLAYNFPFVTESLVEKPVVL
Ga0184604_100294132	3300018000	Groundwater Sediment	VALLLRAKGIIRVRPLEGGIDGWLADNFPFVTESLVEKPVVL
Ga0184608_100437632	3300018028	Groundwater Sediment	VALLLRAKGITRVRPLEGGIDGWLADNFPFVTESLVEKPVVL
Ga0184638_12389441	3300018052	Groundwater Sediment	VALLLRAEGITRVRPLEGGIDGWLADNFPFVTESLVEKPVVL
Ga0187773_102560622	3300018064	Tropical Peatland	VALLLRAKGITRVRPLEGGIDAWLADNFPFVIESLVKKPVVL
Ga0184635_100112572	3300018072	Groundwater Sediment	MALLLRAKGITRVRPLEGGIAAWLAYNFPFFTESLVRKPVVL
Ga0184632_101361241	3300018075	Groundwater Sediment	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPVVL
Ga0184612_101466222	3300018078	Groundwater Sediment	VALLLRAKGITRVRPLEGGIDGWLADNFPFVTESLVKKPVVL
Ga0184628_104600182	3300018083	Groundwater Sediment	DRPRAKGITRVHPLEGGIDAWLAYNLPFVTESLVKKPVVL
Ga0190265_123432261	3300018422	Soil	VALLLTAKGITRVRPLEGGIDAWLAHNFPFDTQDVIKKSVVL
Ga0190265_132077061	3300018422	Soil	VALLLRAKGITRVRPLEGGIDAWLADNFSFVTESLVKKPVEL
Ga0066655_102733481	3300018431	Grasslands Soil	VALLLRAKGITRVRPLEGGIDAWLADNFPSVTESLVNKPVVL
Ga0190274_107842102	3300018476	Soil	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVEKPVVL
Ga0173481_100906892	3300019356	Soil	VALRLQAKGITRVRPLEGGIDAWLAHDFPFITESLVKKPVVL
Ga0190264_105292232	3300019377	Soil	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPAVL
Ga0193743_10451693	3300019889	Soil	VALLLRAKGITRVRPLEGGIDGWLADNFPFVTEGLVEKPVVL
Ga0210382_101224802	3300021080	Groundwater Sediment	VALLLRAKGIIRVRPLEGGIDAWLADNFPFVTESLLKKPVVL
Ga0222622_112955182	3300022756	Groundwater Sediment	VALLLRAKGITRVRPLEGGIAAWLADNFPFVTESLVEKPVVL
Ga0196962_102706492	3300024430	Soil	VALLLIAKGITRVRPLEGGIEAWLAHEFPFDNVVLVKKSVAF
Ga0209172_101105762	3300025310	Hot Spring Sediment	VALLLRAKGITRVRPLEGGIDAWLAHNFPFSTEELGKRSVIL
Ga0207697_102208002	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	VALLLRAKGITRVRPLEGGIDAWLASNFPFVTESLVKNPFSSERKYFS
Ga0210143_10503572	3300025792	Natural And Restored Wetlands	VALLVRAKGITRVRPLEGGIDAWLAYNFPFVTESLVKKPIIP
Ga0207682_105830242	3300025893	Miscanthus Rhizosphere	LLLRAKGITRVRPLEGGIDAWLADNLPFVAYGLVKKADDL
Ga0207695_105827922	3300025913	Corn Rhizosphere	ARVALRLQAKGITRVRPLEGGIDAWLAHDFPFITESLVKKPVIL
Ga0207665_100848672	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTENLDRKPVVL
Ga0207668_108236392	3300025972	Switchgrass Rhizosphere	RVALLLRAKGITRVRPLEGGIDGWLAYNFPFVTESLVEKPVVL
Ga0207668_108421871	3300025972	Switchgrass Rhizosphere	VALLLRAKGITRVRPLEGGIDGWLAYNFPFVTESLVEKPVAL
Ga0207640_104442391	3300025981	Corn Rhizosphere	LRLQAKGITRVRPLEGGIDAWLAHDFPFITESLVKKPVVL
Ga0207677_104177022	3300026023	Miscanthus Rhizosphere	VALRLRAKGITRVRPLEGGIDAWLASNFPFVTESLVKNPFSSERKYFS
Ga0207674_109528111	3300026116	Corn Rhizosphere	VALRLQAKGITRVRPLEGGIDAWLAHDFPFITESLVKKPVIL
Ga0209268_10392151	3300026314	Soil	KGITRVRPLEGGIDAWLADNFPFVTETLIKKSVVF
Ga0209470_10608922	3300026324	Soil	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTETLVKKSVVF
Ga0209266_10245274	3300026327	Soil	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTETLIKKSVVF
Ga0256867_102998921	3300026535	Soil	VALLLRAKGITRVRPLEGGIDAWLAGNFPFVTESLVKKPVVL
Ga0209819_102378062	3300027722	Freshwater Sediment	LLRAKGITRVRPLEGGIDAWLAYDFPFVTESLVKKPVVL
Ga0209689_11266151	3300027748	Soil	TSARVALLLRAKGITRVRPLEGGIDAWLAHNFPFATENLVKKPVAL
Ga0209073_101634262	3300027765	Agricultural Soil	VALLLRAKGITRVRPLEGGIDAWLAQNFPFVTESLVNKSVVL
Ga0209382_118939932	3300027909	Populus Rhizosphere	VALQLRAKGITRVRPLENEIDAWLADNFPFVTESLVEKPVVL
Ga0268264_122858891	3300028381	Switchgrass Rhizosphere	VALQLRAKGITRVRPLEGGIAAWLAYNFPFVTESLV
Ga0307304_105650621	3300028885	Soil	VALQLRAKGITRVRPLEGGIDAWLADNFPFVTESLENK
Ga0307497_100132331	3300031226	Soil	VALLLRAKGITRVRPLEGGIDAWLAYNFPFVTESLVEKPVVL
Ga0170824_1053043051	3300031231	Forest Soil	VALQLRAKGITKVRLLEGRIDAWLAYNFPFFTESLVRKPVVL
Ga0310888_102514042	3300031538	Soil	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPAIP
Ga0310888_103531812	3300031538	Soil	VALLLRAKGITRVRPLEGGIDAWLAFNFPSVTESLVNKPVVL
Ga0307408_1000712825	3300031548	Rhizosphere	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTEGLVKKSVIP
Ga0310813_100238402	3300031716	Soil	VALLLRAKGITRVRPLEGGIDAWLAYDFPFVTEGLVKQPAVL
Ga0307410_112610481	3300031852	Rhizosphere	VALLLRAKGITRVRPLEGGIDGWLADNFPFVSEGLVKKSVIP
Ga0310900_108883081	3300031908	Soil	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTEGLVKKAVIP
Ga0310890_104552821	3300032075	Soil	MIGNTRVALLLRAKGITGVRPLEGGTDAWLAHNFPSVT
Ga0310810_101706575	3300033412	Soil	VALLLRAKGITRVRPLEGGIDAWLASNFPFVTENLVENPFSSERRFPF
Ga0310810_106615082	3300033412	Soil	VALLLRAKGITRVRPLEGGIDAWLASNFPFVTENLVEKSALP
Ga0310810_108781242	3300033412	Soil	VALLLRAKGITRVRPLEGGIDAWLAQNFPFVTESLVNKSVIL
Ga0316620_106915601	3300033480	Soil	VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVNKPVVRDQLQL
Ga0316620_113246972	3300033480	Soil	VALLLRAKGITRVRPLEGGIDAWLAYNFPFVTESLVNKPVVL
Ga0316628_1032794311	3300033513	Soil	VALLLRAKGITRVRPLEGGIDAWLAYNFPFVTESLVKKSVVL
Ga0364929_0205120_547_651	3300034149	Sediment	MALLLRAKGITRVRPLEGGIDAWLADNFPFVTESL

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F041134

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences