Basic Information | |
---|---|
Family ID | F041113 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 160 |
Average Sequence Length | 43 residues |
Representative Sequence | QDALFDKGIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRA |
Number of Associated Samples | 136 |
Number of Associated Scaffolds | 160 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.38 % |
% of genes from short scaffolds (< 2000 bps) | 89.38 % |
Associated GOLD sequencing projects | 128 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.23 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.875 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.375 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.21% β-sheet: 0.00% Coil/Unstructured: 64.79% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 160 Family Scaffolds |
---|---|---|
PF02558 | ApbA | 58.12 |
PF08546 | ApbA_C | 26.88 |
PF01321 | Creatinase_N | 10.62 |
PF01546 | Peptidase_M20 | 2.50 |
PF12007 | DUF3501 | 0.62 |
COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
---|---|---|---|
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 26.88 |
COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 10.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10102857 | All Organisms → cellular organisms → Bacteria | 2045 | Open in IMG/M |
3300005166|Ga0066674_10296737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
3300005171|Ga0066677_10406080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
3300005171|Ga0066677_10432638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
3300005174|Ga0066680_10313144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1002 | Open in IMG/M |
3300005174|Ga0066680_10532420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
3300005174|Ga0066680_10788637 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300005177|Ga0066690_10602590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
3300005178|Ga0066688_10298970 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
3300005187|Ga0066675_10005206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6378 | Open in IMG/M |
3300005355|Ga0070671_101957939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
3300005518|Ga0070699_101508493 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300005534|Ga0070735_10214485 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
3300005536|Ga0070697_101451708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
3300005540|Ga0066697_10437892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
3300005540|Ga0066697_10578193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
3300005554|Ga0066661_10352299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 901 | Open in IMG/M |
3300005554|Ga0066661_10511746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
3300005561|Ga0066699_10805977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
3300005598|Ga0066706_10616574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
3300005712|Ga0070764_11034675 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300005764|Ga0066903_106841595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
3300006028|Ga0070717_10764587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 878 | Open in IMG/M |
3300006031|Ga0066651_10318446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 834 | Open in IMG/M |
3300006034|Ga0066656_10969278 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300006046|Ga0066652_101677102 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300006050|Ga0075028_100311674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 880 | Open in IMG/M |
3300006794|Ga0066658_10358412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
3300006794|Ga0066658_10407281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
3300006893|Ga0073928_10055367 | All Organisms → cellular organisms → Bacteria | 3541 | Open in IMG/M |
3300006954|Ga0079219_10790745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
3300007255|Ga0099791_10010262 | All Organisms → cellular organisms → Bacteria | 3908 | Open in IMG/M |
3300009012|Ga0066710_103931884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
3300009038|Ga0099829_10284614 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
3300009088|Ga0099830_10463323 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
3300009088|Ga0099830_11245500 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300009137|Ga0066709_103496745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300009137|Ga0066709_103538386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300009143|Ga0099792_10661847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
3300009520|Ga0116214_1174011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
3300009520|Ga0116214_1250823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
3300009523|Ga0116221_1094622 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
3300009698|Ga0116216_10129393 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
3300009700|Ga0116217_10564543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
3300009792|Ga0126374_11026907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
3300009824|Ga0116219_10089284 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
3300010047|Ga0126382_10247524 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
3300010304|Ga0134088_10060437 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
3300010339|Ga0074046_10918644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300010358|Ga0126370_10757439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
3300010361|Ga0126378_11605780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
3300010362|Ga0126377_11172415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
3300010376|Ga0126381_100684243 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
3300010376|Ga0126381_100877612 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
3300010397|Ga0134124_10617685 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
3300011120|Ga0150983_15498498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
3300011269|Ga0137392_11386655 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300011271|Ga0137393_10415920 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
3300012096|Ga0137389_11244790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
3300012199|Ga0137383_10365523 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
3300012200|Ga0137382_10752610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
3300012203|Ga0137399_10561875 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300012206|Ga0137380_10810787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
3300012211|Ga0137377_10761935 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
3300012211|Ga0137377_11583032 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300012359|Ga0137385_10798139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
3300012362|Ga0137361_10578976 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
3300012363|Ga0137390_10241354 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
3300012363|Ga0137390_10683496 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300012363|Ga0137390_10851004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
3300012683|Ga0137398_10369373 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
3300012925|Ga0137419_11546746 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300012925|Ga0137419_11669129 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300012927|Ga0137416_10029375 | All Organisms → cellular organisms → Bacteria | 3641 | Open in IMG/M |
3300012927|Ga0137416_10345249 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300012929|Ga0137404_11072808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
3300012960|Ga0164301_11265600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
3300012972|Ga0134077_10256649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
3300012976|Ga0134076_10604678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300012989|Ga0164305_11332501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
3300013306|Ga0163162_12836274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300014154|Ga0134075_10339402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
3300015372|Ga0132256_102970582 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300017959|Ga0187779_10847484 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300017966|Ga0187776_11004472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
3300017973|Ga0187780_10130143 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
3300017975|Ga0187782_10935951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
3300017975|Ga0187782_11580808 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300018064|Ga0187773_10781878 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300018431|Ga0066655_10221170 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
3300018431|Ga0066655_10559463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
3300018482|Ga0066669_11296134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
3300019789|Ga0137408_1281161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300020581|Ga0210399_11533185 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300020583|Ga0210401_11594815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300021170|Ga0210400_10073666 | All Organisms → cellular organisms → Bacteria | 2678 | Open in IMG/M |
3300021170|Ga0210400_10556752 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
3300021178|Ga0210408_10126917 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
3300021401|Ga0210393_11126482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
3300021403|Ga0210397_10142574 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
3300021420|Ga0210394_10433491 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
3300021432|Ga0210384_10323470 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
3300021433|Ga0210391_10543536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 912 | Open in IMG/M |
3300021861|Ga0213853_10372954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300022504|Ga0242642_1085180 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300022717|Ga0242661_1135583 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300022724|Ga0242665_10357544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300023019|Ga0224560_107598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
3300024330|Ga0137417_1176420 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
3300025905|Ga0207685_10694120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
3300025910|Ga0207684_10712276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
3300025920|Ga0207649_10659097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
3300025925|Ga0207650_10658227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 883 | Open in IMG/M |
3300026118|Ga0207675_101764192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
3300026309|Ga0209055_1299952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300026318|Ga0209471_1272405 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300026329|Ga0209375_1135873 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300026331|Ga0209267_1085128 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
3300026331|Ga0209267_1201244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
3300026332|Ga0209803_1004303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8353 | Open in IMG/M |
3300026334|Ga0209377_1102307 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
3300026499|Ga0257181_1054491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
3300026532|Ga0209160_1334996 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300026537|Ga0209157_1382197 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300026538|Ga0209056_10485258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
3300026548|Ga0209161_10305430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
3300026550|Ga0209474_10023387 | All Organisms → cellular organisms → Bacteria | 4737 | Open in IMG/M |
3300026551|Ga0209648_10025758 | All Organisms → cellular organisms → Bacteria | 5141 | Open in IMG/M |
3300026551|Ga0209648_10425685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
3300026552|Ga0209577_10006295 | All Organisms → cellular organisms → Bacteria | 10986 | Open in IMG/M |
3300027047|Ga0208730_1036092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
3300027172|Ga0208098_1008869 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
3300027266|Ga0209215_1047166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
3300027655|Ga0209388_1077048 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300027674|Ga0209118_1059016 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
3300027846|Ga0209180_10416562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
3300027875|Ga0209283_10042578 | All Organisms → cellular organisms → Bacteria | 2866 | Open in IMG/M |
3300027915|Ga0209069_10763864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
3300028536|Ga0137415_10081499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3094 | Open in IMG/M |
3300028536|Ga0137415_10901973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
3300031640|Ga0318555_10336442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
3300031708|Ga0310686_103107236 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300031718|Ga0307474_10308226 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
3300031718|Ga0307474_10653244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 830 | Open in IMG/M |
3300031720|Ga0307469_10025194 | All Organisms → cellular organisms → Bacteria | 3331 | Open in IMG/M |
3300031726|Ga0302321_100418010 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
3300031754|Ga0307475_11216131 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300031820|Ga0307473_10135101 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
3300031820|Ga0307473_10507129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
3300031823|Ga0307478_10093228 | All Organisms → cellular organisms → Bacteria | 2320 | Open in IMG/M |
3300031942|Ga0310916_10125633 | All Organisms → cellular organisms → Bacteria | 2092 | Open in IMG/M |
3300031946|Ga0310910_11480602 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300031962|Ga0307479_11815343 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300032076|Ga0306924_10657952 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300032180|Ga0307471_101838383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
3300032205|Ga0307472_100096014 | All Organisms → cellular organisms → Bacteria | 2024 | Open in IMG/M |
3300032205|Ga0307472_101485158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
3300032782|Ga0335082_11413965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
3300032805|Ga0335078_10452973 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
3300032955|Ga0335076_10542937 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 19.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.62% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.88% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.38% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.12% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.75% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.75% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.50% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.50% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.88% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.25% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.25% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.25% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.62% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.62% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.62% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.62% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.62% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.62% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.62% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.62% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.62% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023019 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
3300027172 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes) | Environmental | Open in IMG/M |
3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_101028571 | 3300001593 | Forest Soil | HTISAALQDALFSSGIVVSDSFNNADTLYRAIVAKEIYQADKLVKVEKGV* |
Ga0066674_102967372 | 3300005166 | Soil | AVFDKGIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRV* |
Ga0066677_104060801 | 3300005171 | Soil | SAALQDALFDKGIVIEDSFNNADSLFRALVGKETSQAEKPVKVERRV* |
Ga0066677_104326381 | 3300005171 | Soil | SAALQDALFDKGIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRA* |
Ga0066680_103131442 | 3300005174 | Soil | ALQDALFSNGIIIEDSFNNADTLFRALVGREIYQADKLVTVDRRV* |
Ga0066680_105324202 | 3300005174 | Soil | ALQDALFEEGIVIEDSFNNADSLFRALVGKETSQAQKLVKVQRRA* |
Ga0066680_107886371 | 3300005174 | Soil | ALFDKGIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRV* |
Ga0066690_106025901 | 3300005177 | Soil | ALFDKGIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRA* |
Ga0066688_102989701 | 3300005178 | Soil | LFSSGIIIGDSFNNADTLFRAMVGREIYQADKLVKLERRA* |
Ga0066675_100052067 | 3300005187 | Soil | LSAQDIIIEDSFNNADSLFRALVSKETGQRDKLVKMEKRL* |
Ga0070671_1019579391 | 3300005355 | Switchgrass Rhizosphere | QDALFDKGVFIEDSFNNPDSIYRSLKGEGGQLKEIVKVERRVLREA* |
Ga0070699_1015084931 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ALQDALFSEGVFIDDSFNNADSLFRALVGKEFSQTKKLVKVERRA* |
Ga0070735_102144851 | 3300005534 | Surface Soil | GIMIDDSFNNADSLFRAMVEKEISQTKNLVRVERRV* |
Ga0070697_1014517082 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | SNGIIIEDSFNNADSLFRALVGKEICQAEKLVKVERRAS* |
Ga0066697_104378922 | 3300005540 | Soil | FDKGIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRV* |
Ga0066697_105781931 | 3300005540 | Soil | AALQDALFSNGIIIEDSFNNADSLFRALVGKEICQAEKLVKLERRTS* |
Ga0066661_103522991 | 3300005554 | Soil | FDKGIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRA* |
Ga0066661_105117461 | 3300005554 | Soil | SGILITDSFNNADTLYRAVVRKEIYQAGDLVKMEKRA* |
Ga0066699_108059772 | 3300005561 | Soil | DALFDKGVFIQDSFNNADSLFRALHGEIGQTAKLVKVERRVGSKA* |
Ga0066706_106165741 | 3300005598 | Soil | IEDSFNNADSLFRALVGKEICQAERLVKLERRAS* |
Ga0070764_110346751 | 3300005712 | Soil | SAALQDALFAEGVFIDDSFNNADSLFRALVGKEISQMNKLVKVEKRG* |
Ga0066903_1068415951 | 3300005764 | Tropical Forest Soil | DHGVVIDESFNNADSLFRALVKKEISQADQNVKVERRTQS* |
Ga0070717_107645871 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LFSNGIIIEDSFNNADSLFRALVGKEICQAEKLVKLERRAS* |
Ga0066651_103184461 | 3300006031 | Soil | IVVSDSFNNADTLYRAMVAKDIYQAGDLVKLEKRA* |
Ga0066656_109692782 | 3300006034 | Soil | ALFSRGIIIDESFNNGDSLFRAMVSKTTGQADRIVKLERNV* |
Ga0066652_1016771022 | 3300006046 | Soil | KGIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRA* |
Ga0075028_1003116742 | 3300006050 | Watersheds | SGIMIDDSFNNADSLFRALVEKENSQLSKLVKLETRP* |
Ga0066658_103584122 | 3300006794 | Soil | DALFDKGIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRV* |
Ga0066658_104072812 | 3300006794 | Soil | DALFDKGIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRA* |
Ga0073928_100553671 | 3300006893 | Iron-Sulfur Acid Spring | GIMIDDSFNNADSLFRAMVAKEISQADKLIRVERRV* |
Ga0079219_107907451 | 3300006954 | Agricultural Soil | LFGEGIFIENSFNNPDSLFRALVVKQGSQLGQLVNVERRV* |
Ga0099791_100102625 | 3300007255 | Vadose Zone Soil | ILITDSFNNADTLYRAVVKKEIYQAGDLVKMEKRA* |
Ga0066710_1039318841 | 3300009012 | Grasslands Soil | QDALISNGIIIEDSFNNADRLFRALVGKEICQADKLVKLERRAS |
Ga0099829_102846141 | 3300009038 | Vadose Zone Soil | PIHTISAALQDALFSGGILITDSFNNADTLYRAVVRKEIYQAGDLVKMERRA* |
Ga0099830_104633232 | 3300009088 | Vadose Zone Soil | HTISAALQDALFSEGILVTDSFNNADTLYRAVVKKEIYQAEDLVKFEKRA* |
Ga0099830_112455002 | 3300009088 | Vadose Zone Soil | HTISAALQDALFSEGILVTDSFNNADTLYRAVVKKEIYQAGDLVKMEKRA* |
Ga0066709_1034967451 | 3300009137 | Grasslands Soil | IHTISAALQDALFSNGIIIEDSFNNADTLFRAVVGREIYQADKLVKLDRRV* |
Ga0066709_1035383862 | 3300009137 | Grasslands Soil | IVIEDSFNNADSLFRALVGKETSQAEKLVKVERRA* |
Ga0099792_106618472 | 3300009143 | Vadose Zone Soil | DALFSGGILITDSFNNADTLYRAVVRKEIYQARDLVKMEKRE* |
Ga0116214_11740111 | 3300009520 | Peatlands Soil | ALQDALFANGIIIDDSLNNADSLFRAMVKREIGQAEKLVRMEKKL* |
Ga0116214_12508232 | 3300009520 | Peatlands Soil | FASGIMIDDSFNNADSLFRAMVAKEISQAEKLVKLERRM* |
Ga0116221_10946223 | 3300009523 | Peatlands Soil | ANGIIIDDSFNNADSLFRAMVKREIGQAEKLVRMEKKL* |
Ga0116216_101293931 | 3300009698 | Peatlands Soil | HTISAALQDALFASGIMIDDSFNNADSLFRALVAKEISQVEKLVKVERRI* |
Ga0116217_105645431 | 3300009700 | Peatlands Soil | TISAALQDALFAKGVFIDDSFNNADSLFRALVGKEISQMEKLVKVEKR* |
Ga0126374_110269071 | 3300009792 | Tropical Forest Soil | HTISAALQDALFNKGVFIEDSFNNADSLFRALKGEIGRAADLVKVERRP* |
Ga0116219_100892841 | 3300009824 | Peatlands Soil | TISAALQDALFASGIIIDDSFNNADSLFRAMVAKEISQAESLVKVERRM* |
Ga0126382_102475243 | 3300010047 | Tropical Forest Soil | FIEDSFNNPDSLFRALIARDGSQLEKLVKVERRC* |
Ga0134088_100604373 | 3300010304 | Grasslands Soil | DAVFDKGIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRV* |
Ga0074046_109186442 | 3300010339 | Bog Forest Soil | DALFASGIIIDDSFNNADSLFRAMTAKEISQADNLVKVERRV* |
Ga0126370_107574392 | 3300010358 | Tropical Forest Soil | AALQDALFGQGIIIGDSFNNADALFRMMTAKESGQAENLVKLERRI* |
Ga0126378_116057802 | 3300010361 | Tropical Forest Soil | ALFAQEVIIDDSFNNADRLYRAVVRKEIGQAKELVKVERRR* |
Ga0126377_111724152 | 3300010362 | Tropical Forest Soil | AAALQDALFAERIIIGDSFNNADTLFRAIAGKEIYQADQVVKVERTR* |
Ga0126381_1006842433 | 3300010376 | Tropical Forest Soil | ALQDALFSSGVIIEDSLNNADSLYRAMVAKEIGQAEKLVKVEKRA* |
Ga0126381_1008776121 | 3300010376 | Tropical Forest Soil | IDDSFNNADSLFRALVKKEVSQSEKVVKVERRLSR* |
Ga0134124_106176851 | 3300010397 | Terrestrial Soil | ALFGEGIFIENSFNNPDSLFRALVVKQGSQLGQLVNVERRV* |
Ga0150983_154984981 | 3300011120 | Forest Soil | TISAALQDALFDKGVFIQDSFNNADSLFRALHGETGQAAKLVKVERRLGSKA* |
Ga0137392_113866552 | 3300011269 | Vadose Zone Soil | LFASGIIIEDSFNNGDSLYRAMVRKEICQADKLVKVEKGLGPAGP* |
Ga0137393_104159202 | 3300011271 | Vadose Zone Soil | FANGIIIDDSFNNADSLFRAMVAKEIGQAEKLVKMERRA* |
Ga0137389_112447902 | 3300012096 | Vadose Zone Soil | IHTISAALQDALFSGGILITDSFNNADTLYRAVVRKEIYQAGDLVKMEKRA* |
Ga0137383_103655231 | 3300012199 | Vadose Zone Soil | LFSNGILITDSFNNADTLYRAVVKKEIYQAGDLVEMERRA* |
Ga0137382_107526102 | 3300012200 | Vadose Zone Soil | DALFDKGIVIEDSFNNADSLFRALVGKETSQAEKPVKVERRV* |
Ga0137399_105618752 | 3300012203 | Vadose Zone Soil | SSGIVVSDSFNNADTLYRAIVAKEIYQADKLVKVEKGV* |
Ga0137380_108107872 | 3300012206 | Vadose Zone Soil | PIHTISAALQDALFEECIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRA* |
Ga0137377_107619351 | 3300012211 | Vadose Zone Soil | QDALFSSGILITDSFNNADTLYRAVVKKEIYQAGDLVEMERRA* |
Ga0137377_115830321 | 3300012211 | Vadose Zone Soil | ISAALQDALFDKGIVIEDSFNNADSLFRALVGKETSQAEKPVKVERRV* |
Ga0137385_107981391 | 3300012359 | Vadose Zone Soil | ISAALQDALFDKGIVIEDSFNNADSLFRALVGKETSQAEKPVKAERRV* |
Ga0137361_105789762 | 3300012362 | Vadose Zone Soil | LFDKGIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRA* |
Ga0137390_102413541 | 3300012363 | Vadose Zone Soil | IIIEDSFNNADSLFRALVGKEICQADKLVKLERRAS* |
Ga0137390_106834962 | 3300012363 | Vadose Zone Soil | LQDALFANGIIIEDSFNNADSLFRALVAKETGQLVRMEKRI* |
Ga0137390_108510041 | 3300012363 | Vadose Zone Soil | SAALQDALFSKGIIIEDSFNNADSLFRALVVKEICQAEKLVKLERRAS* |
Ga0137398_103693732 | 3300012683 | Vadose Zone Soil | ALQDALFSGGILITDSFNNADTLYRAVVRKEIYQAGDLVKMEKRE* |
Ga0137419_115467462 | 3300012925 | Vadose Zone Soil | ISAAMQDALFSSGIVVSDSFNNADTLYRAIVAKEIYQAGKLVKVEKRV* |
Ga0137419_116691292 | 3300012925 | Vadose Zone Soil | DALFSSGVVVSDSFNNADTLYRATVAKEIYQADKLVKVEKRV* |
Ga0137416_100293751 | 3300012927 | Vadose Zone Soil | ISAALQDALFSTEILITDSFNNADTLYRAVVKKEIYQAGDLVKMERRA* |
Ga0137416_103452491 | 3300012927 | Vadose Zone Soil | ISAALQDALFSSGIIIYDSFNNADSLYRAIVKKEIGQAGRLVKVEKKA* |
Ga0137404_110728082 | 3300012929 | Vadose Zone Soil | QDALFSNGIIIEDSFNNADSLFRALVGKEICQAEKLVKLERRAS* |
Ga0164301_112656002 | 3300012960 | Soil | APIHTISAALQDVLFSNGIIIENSFNNADSLFRALVGKEICQAVKLVKLERRAA* |
Ga0134077_102566491 | 3300012972 | Grasslands Soil | IVIEDSFNNADSLFRALVGKETSQAEKLVKVERRV* |
Ga0134076_106046781 | 3300012976 | Grasslands Soil | LQDALYSSGILVTDSFNNADTLYRAVVKKEIYQAGDLVKMEKRA* |
Ga0164305_113325011 | 3300012989 | Soil | DALFSNGIIIENSFNNADSLFRALVGKEICQAVKLVKLERRAA* |
Ga0163162_128362741 | 3300013306 | Switchgrass Rhizosphere | IHTISAALQDALFGEGIFIENSFNNPDSLFRALVVKQGSQLGQLVNVERRV* |
Ga0134075_103394021 | 3300014154 | Grasslands Soil | LFSNGIIIEDSFNNADSLFRALVGKEICQAEKIVKLERRAS* |
Ga0132256_1029705822 | 3300015372 | Arabidopsis Rhizosphere | AALQDALFDKGVFIDDSFNNPDSLFRALNGEIGKVADLVKVERRA* |
Ga0187779_108474842 | 3300017959 | Tropical Peatland | ALQDALFANGVIIDDSFNNADSLFRSLVAKEMAQRDKLVRIEKRL |
Ga0187776_110044722 | 3300017966 | Tropical Peatland | AALQDALFEKGVFIEDSFNNANSIFRALQGEAGQLKNLVKVVRRA |
Ga0187780_101301431 | 3300017973 | Tropical Peatland | TISAALQDALFASGVIIDDSFNNADSLFRSLVAKEMAQRDKLVRIEKRL |
Ga0187782_109359511 | 3300017975 | Tropical Peatland | AAALQDALFAHEVIIDDSFNNADRLYRAVVKKEIGQARQLVKLEKRR |
Ga0187782_115808081 | 3300017975 | Tropical Peatland | TLSAALQDALFAERVIIDDSFNNADRLFRALATKEVAQAETLVKVETRS |
Ga0187773_107818781 | 3300018064 | Tropical Peatland | AALQDALFSEGIIIDDSFNNADRLFRAMVVKEIGQAKRLVSVERKV |
Ga0066655_102211701 | 3300018431 | Grasslands Soil | DALFSSGIVVSDSFNNADTLYRAMVAKDIYQAGDLVKMEKRA |
Ga0066655_105594632 | 3300018431 | Grasslands Soil | DALFDKGIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRV |
Ga0066669_112961342 | 3300018482 | Grasslands Soil | IVIEDSFNNADSLFRALVGKETSQAEKLVKVERRV |
Ga0137408_12811611 | 3300019789 | Vadose Zone Soil | LQDALFANDIIIIQDSFNNADSLFRAMAAKESRQLVKVEKRA |
Ga0210399_115331852 | 3300020581 | Soil | IHTISAALQDALFDKGVFIDDSFNNADTLFRALNGETGRTAYVVKVERRA |
Ga0210401_115948151 | 3300020583 | Soil | ISAALQDALFASGIMIDDSFNNADSLFRAMVAKEISQADKLVRVQRRG |
Ga0210400_100736664 | 3300021170 | Soil | IVIDDSFNNANSLFRAMVAKEISQADKLVSVERRL |
Ga0210400_105567522 | 3300021170 | Soil | FAEGVFIDDSFNNADSLYRAIVKKEICQTAKLVKAEKGK |
Ga0210408_101269171 | 3300021178 | Soil | SFNNADTLYRAVVRKEIYQAGDLVTVENRTQPART |
Ga0210393_111264821 | 3300021401 | Soil | HTISAALQDALFARGIMIDDSFNNADSLFRAMVGKEISQAEKLVKVERRV |
Ga0210397_101425743 | 3300021403 | Soil | ALFASGIMIDDSFNNADSLFRAMVGKEISQVEKLVKVERR |
Ga0210394_104334911 | 3300021420 | Soil | AALQDAVFTKGIFIDDSFNNPDSLFRALKGEISRLNDLVRVERRA |
Ga0210384_103234701 | 3300021432 | Soil | DALFPSGIMIDDSFNNPDSLFRAMVAKEIGQLEKLVKVERRA |
Ga0210391_105435361 | 3300021433 | Soil | IHTISAALQDALFASGIMIDASFNNADSLFRAMVKKEIGQVAKLVRVERRV |
Ga0213853_103729541 | 3300021861 | Watersheds | ISAALQDALFLSGIIIEDSFNNADSLFRALGFGKQGTLVKVEKRI |
Ga0242642_10851801 | 3300022504 | Soil | IQDSFNNADSLFRALHGETGQAAKLVKVERRLGSKA |
Ga0242661_11355832 | 3300022717 | Soil | KGVFIQDSFNNAESLFRALHGETGQAAKLVKVERRLGSKA |
Ga0242665_103575442 | 3300022724 | Soil | GIMIDDSFNNADSLFRAMVAKEISQTGKLVKVERR |
Ga0224560_1075981 | 3300023019 | Soil | GIMIDNSFNNADSLFRAMVAKEISQAKKLVKVERRG |
Ga0137417_11764201 | 3300024330 | Vadose Zone Soil | SSGIVVSDSFNNADTLYHTLYRAIVAKEIYQAGKLVQVEKGA |
Ga0207685_106941202 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | QDSFNNADSLFRALHGEIGQAAKLVKVERRVGSKA |
Ga0207684_107122762 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | IVIEDSFNNADSLFRALVGKETSQAEKLVKVERRA |
Ga0207649_106590971 | 3300025920 | Corn Rhizosphere | LFGEGVFIENSFNNPDSLFRALVVKQGSQLGQLVNVERRV |
Ga0207650_106582272 | 3300025925 | Switchgrass Rhizosphere | HTISAALQDALFGEGIFIENSFNNPDSLFRALVVKQGSQLGQLVNVERRV |
Ga0207675_1017641921 | 3300026118 | Switchgrass Rhizosphere | GEGIFIENSFNNPDSLFRALVVKQGSQLGQLVNVERRV |
Ga0209055_12999522 | 3300026309 | Soil | DALFSNGIIIEDSFNNADSLFRALVGKEICQADKLVKLERRAS |
Ga0209471_12724052 | 3300026318 | Soil | SAALQDALFEEGIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRA |
Ga0209375_11358731 | 3300026329 | Soil | GIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRA |
Ga0209267_10851283 | 3300026331 | Soil | QDALFDKGIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRA |
Ga0209267_12012442 | 3300026331 | Soil | QDALFDKGIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRV |
Ga0209803_10043031 | 3300026332 | Soil | DKGIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRA |
Ga0209377_11023072 | 3300026334 | Soil | FDKGIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRV |
Ga0257181_10544911 | 3300026499 | Soil | HTISAALQDALFSRGIVVSDSFSNADTLYRAIVAKEIYQAGKLVKVEKGRNAARI |
Ga0209160_13349962 | 3300026532 | Soil | ISAALQDALFDKGVFIQDSFNNADNLFRALHGEIGQTAKLVKVERRVGSKA |
Ga0209157_13821971 | 3300026537 | Soil | SGIIIQDSFNNGDSLYRAMVSKEICQADRLVKLEKRF |
Ga0209056_104852581 | 3300026538 | Soil | ALQDALFSNGIIIEDSFNNADTLFRALVGREIYQADKLVKLDRRV |
Ga0209161_103054301 | 3300026548 | Soil | LFDKGIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRV |
Ga0209474_100233875 | 3300026550 | Soil | FDKGIVIEDSFNNADSLFRALVGKETSQAEKLVKVERRA |
Ga0209648_100257586 | 3300026551 | Grasslands Soil | DALFSGGILITDSFNNADTLYRAVVRKEIYQAGDLVKMEKRA |
Ga0209648_104256852 | 3300026551 | Grasslands Soil | ALFASGIIIEDSFNNGDSLYRAMVRKEICQADKLVKVEKGLGSAGP |
Ga0209577_1000629512 | 3300026552 | Soil | SAALQDALFSNGIIIEDSFNNADSLFRALVVKEICQAEKLVMLERRAS |
Ga0208730_10360922 | 3300027047 | Forest Soil | AALQDALFASGIMIDDSFNNADSLFRAMVEKEISQTKNLVRVERRV |
Ga0208098_10088692 | 3300027172 | Forest Soil | ALQDALFEKGVFIEDSFNNADSVFRALHGETGQAAKLVKVERRVGSKA |
Ga0209215_10471661 | 3300027266 | Forest Soil | ALFAKGVFIEDSFNNADSLFRALHGETGQAAKLVKVERRVGSKA |
Ga0209388_10770482 | 3300027655 | Vadose Zone Soil | IHTISAALQDALFSSGVVVSDSFNNADTLYRATVAKEIYQADKLVKVEKRV |
Ga0209118_10590162 | 3300027674 | Forest Soil | TISAALQDALFSSGIVVSDSFNNADTLYRAIVAKEIYQAGKLVQVEKRA |
Ga0209180_104165622 | 3300027846 | Vadose Zone Soil | IHTISAALQDALFSEGILVTDSFNNADTLYRAVVKKEIYQAGDLVKMEKRA |
Ga0209283_100425784 | 3300027875 | Vadose Zone Soil | LQDALFSEGILVTDSFNNADTLYRAVVKKEIYQAEDLVKFEKRA |
Ga0209069_107638641 | 3300027915 | Watersheds | TISAALQDALFASGILIEDSFNNADSIFRAMVAKETGQAAQLVKVEKRV |
Ga0137415_100814994 | 3300028536 | Vadose Zone Soil | LQDALFASGIIIEDSFNNGDSLYRAMVRKEVCQADKLVKVEKGLGSAGP |
Ga0137415_109019732 | 3300028536 | Vadose Zone Soil | LHTISAALQDALFSSGIIIYDSFNNADSLYRAIVKKEIGQAGRLVKVEKKA |
Ga0318555_103364421 | 3300031640 | Soil | ISAALQDALFEQGVFIEDSFNNPDSVFRSLRGEIGQVQQRVKVERRAGSKA |
Ga0310686_1031072361 | 3300031708 | Soil | HTISAALQDALFASGIMIDDSFNNADSLFRAMVAKEISQAEKLVTVERR |
Ga0307474_103082261 | 3300031718 | Hardwood Forest Soil | EKGVFIEDSFNNADSVFRALHGETGQAAKLVKVERRVGSKA |
Ga0307474_106532442 | 3300031718 | Hardwood Forest Soil | ASGIIIDDSFNNADSLFRALTAKEISQADKLVKVEKRV |
Ga0307469_100251941 | 3300031720 | Hardwood Forest Soil | QDALFAEGVFIDDSFNNADSLFRALVGKEISQMEKLVKVEKRG |
Ga0302321_1004180101 | 3300031726 | Fen | QDALFDQGIFIDDSFNNADSLFRAMVGKEISQGKNLVKVERRA |
Ga0307475_112161312 | 3300031754 | Hardwood Forest Soil | LQDALFSSGIVINDSFNNADTLYRAVVRKEIYQAGDLVTVEKQA |
Ga0307473_101351011 | 3300031820 | Hardwood Forest Soil | ALQDALFDKGVLIDDSFNNADSLFRALKGEAGRVADLVKVERRS |
Ga0307473_105071291 | 3300031820 | Hardwood Forest Soil | ILIEDSFNNADSIFRAMVAKETGQAVQQVKVEKRV |
Ga0307478_100932281 | 3300031823 | Hardwood Forest Soil | ALFDSGIIIDDSFNNADSLFRAMMANETSQAKKVRVERR |
Ga0310916_101256331 | 3300031942 | Soil | IEDSFNNPDSVFRSLRGEIGQVQQRVKVERRAGSKA |
Ga0310910_114806022 | 3300031946 | Soil | ALFAHEVIIDDSFNNADRLYRAVVKKEIGQAKELVRVEKRR |
Ga0307479_118153431 | 3300031962 | Hardwood Forest Soil | AALQDALFEKGIFIEDSFNNPDSLFRALKGEIGRAADLVKVERRA |
Ga0306924_106579522 | 3300032076 | Soil | AALQDALFAHGVIIDDSFNNADRLYRAVVKREIGQAKELVKVERRR |
Ga0307471_1018383832 | 3300032180 | Hardwood Forest Soil | FSNGIIIEDSFNNADSLFRALVEKEICQAEKLVKLERRAS |
Ga0307472_1000960143 | 3300032205 | Hardwood Forest Soil | QDALFASGIIIDDSFNNADGLFRALTAKEISQADKLVKVEKRV |
Ga0307472_1014851581 | 3300032205 | Hardwood Forest Soil | TISAALQDALFAEGVFIDDSFNNADSLFRALVGKEISQIEKLVKVEKRG |
Ga0335082_114139652 | 3300032782 | Soil | AAPIHTISSALQDALFSEGVFINDSFNNADSLFRALKVREIQQMDKLVKVEKRT |
Ga0335078_104529733 | 3300032805 | Soil | ALFASGVIIDDSYNNADRLFRALIAKEVAQAEQLVKLEKRL |
Ga0335076_105429372 | 3300032955 | Soil | ISAALQDALFSEGVFIDDSFNNADSLFRAVVSKEISQADKLVKVERQG |
⦗Top⦘ |