NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F040830

Metagenome Family F040830

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F040830
Family Type Metagenome
Number of Sequences 161
Average Sequence Length 46 residues
Representative Sequence VHFGIFVEEMRQGASQAGAFRDIFELADRAEAWGVDCVWLGE
Number of Associated Samples 137
Number of Associated Scaffolds 161

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 59.01 %
% of genes near scaffold ends (potentially truncated) 98.14 %
% of genes from short scaffolds (< 2000 bps) 93.17 %
Associated GOLD sequencing projects 133
AlphaFold2 3D model prediction Yes
3D model pTM-score0.61

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.366 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(14.907 % of family members)
Environment Ontology (ENVO) Unclassified
(33.540 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(44.720 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.57%    β-sheet: 0.00%    Coil/Unstructured: 61.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.61
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 161 Family Scaffolds
PF00676E1_dh 18.63
PF00496SBP_bac_5 10.56
PF13533Biotin_lipoyl_2 8.07
PF01522Polysacc_deac_1 6.21
PF00296Bac_luciferase 6.21
PF08352oligo_HPY 3.11
PF04226Transgly_assoc 2.48
PF03328HpcH_HpaI 2.48
PF09347DUF1989 2.48
PF00106adh_short 1.86
PF02780Transketolase_C 1.24
PF00248Aldo_ket_red 1.24
PF07687M20_dimer 1.24
PF00529CusB_dom_1 1.24
PF01266DAO 1.24
PF13408Zn_ribbon_recom 0.62
PF13458Peripla_BP_6 0.62
PF13561adh_short_C2 0.62
PF08028Acyl-CoA_dh_2 0.62
PF05721PhyH 0.62
PF13360PQQ_2 0.62
PF03992ABM 0.62
PF01594AI-2E_transport 0.62
PF01894UPF0047 0.62
PF01547SBP_bac_1 0.62
PF00753Lactamase_B 0.62
PF031712OG-FeII_Oxy 0.62
PF07690MFS_1 0.62
PF04366Ysc84 0.62
PF12867DinB_2 0.62
PF02515CoA_transf_3 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 161 Family Scaffolds
COG05672-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymesEnergy production and conversion [C] 18.63
COG1071TPP-dependent pyruvate or acetoin dehydrogenase subunit alphaEnergy production and conversion [C] 18.63
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 6.21
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 6.21
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 2.48
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 2.48
COG2301Citrate lyase beta subunitCarbohydrate transport and metabolism [G] 2.48
COG38362-keto-3-deoxy-L-rhamnonate aldolase RhmACarbohydrate transport and metabolism [G] 2.48
COG0432Thiamin phosphate synthase YjbQ, UPF0047 familyCoenzyme transport and metabolism [H] 0.62
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.62
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.62
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.62
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 0.62
COG5285Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) familySecondary metabolites biosynthesis, transport and catabolism [Q] 0.62


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.37 %
UnclassifiedrootN/A18.63 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664022|INPgaii200_c1040882All Organisms → cellular organisms → Bacteria659Open in IMG/M
2228664022|INPgaii200_c1150781All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300000550|F24TB_10476470All Organisms → cellular organisms → Bacteria1685Open in IMG/M
3300000559|F14TC_100204429All Organisms → cellular organisms → Bacteria2510Open in IMG/M
3300001431|F14TB_100870221All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300001431|F14TB_103066917All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300001661|JGI12053J15887_10254814All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300004009|Ga0055437_10093754All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300004479|Ga0062595_101026622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria712Open in IMG/M
3300005289|Ga0065704_10217983All Organisms → cellular organisms → Bacteria1084Open in IMG/M
3300005294|Ga0065705_11024223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. YR681541Open in IMG/M
3300005332|Ga0066388_100352638All Organisms → cellular organisms → Bacteria2118Open in IMG/M
3300005332|Ga0066388_107780931All Organisms → cellular organisms → Bacteria → Proteobacteria537Open in IMG/M
3300005347|Ga0070668_100941387All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300005440|Ga0070705_100023620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3305Open in IMG/M
3300005446|Ga0066686_10850515All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300005450|Ga0066682_10155217All Organisms → cellular organisms → Bacteria1458Open in IMG/M
3300005459|Ga0068867_101759138All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300005467|Ga0070706_101534084All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300005468|Ga0070707_100398450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1336Open in IMG/M
3300005518|Ga0070699_100352389All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1326Open in IMG/M
3300005518|Ga0070699_101527871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria612Open in IMG/M
3300005546|Ga0070696_100578754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria903Open in IMG/M
3300005549|Ga0070704_101948849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria545Open in IMG/M
3300005569|Ga0066705_10647747All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium642Open in IMG/M
3300005575|Ga0066702_10917473All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium523Open in IMG/M
3300005615|Ga0070702_101432450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia566Open in IMG/M
3300005719|Ga0068861_100328305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1334Open in IMG/M
3300005764|Ga0066903_106035579All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300005842|Ga0068858_102477710All Organisms → cellular organisms → Bacteria → Proteobacteria512Open in IMG/M
3300005843|Ga0068860_101707618All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300006031|Ga0066651_10505713All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300006031|Ga0066651_10784579Not Available516Open in IMG/M
3300006172|Ga0075018_10455220All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300006797|Ga0066659_10726767All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300006804|Ga0079221_11075844All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria612Open in IMG/M
3300006845|Ga0075421_102078358All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300006845|Ga0075421_102096137All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300006852|Ga0075433_10590198All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300006854|Ga0075425_101124940All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria894Open in IMG/M
3300006854|Ga0075425_101277844All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300006854|Ga0075425_102404252All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300006871|Ga0075434_101776904All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300006871|Ga0075434_101970932All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300006880|Ga0075429_100939411All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300006903|Ga0075426_10115749All Organisms → cellular organisms → Bacteria1925Open in IMG/M
3300006904|Ga0075424_101998712All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300007004|Ga0079218_13705420All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300007076|Ga0075435_101455895All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300009012|Ga0066710_104402082All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300009088|Ga0099830_10400161All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1110Open in IMG/M
3300009089|Ga0099828_10143056All Organisms → cellular organisms → Bacteria2107Open in IMG/M
3300009089|Ga0099828_11752655All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium546Open in IMG/M
3300009100|Ga0075418_12524272All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300009147|Ga0114129_10045174All Organisms → cellular organisms → Bacteria6193Open in IMG/M
3300009147|Ga0114129_11102390Not Available994Open in IMG/M
3300009148|Ga0105243_12428156All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium563Open in IMG/M
3300009156|Ga0111538_12373471All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300009792|Ga0126374_11593802All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium539Open in IMG/M
3300010047|Ga0126382_10658716Not Available871Open in IMG/M
3300010047|Ga0126382_11501750Not Available620Open in IMG/M
3300010047|Ga0126382_12523471All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium502Open in IMG/M
3300010321|Ga0134067_10150102All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300010335|Ga0134063_10506272All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium605Open in IMG/M
3300010337|Ga0134062_10055551All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1622Open in IMG/M
3300010358|Ga0126370_11728220All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300010362|Ga0126377_10305991All Organisms → cellular organisms → Bacteria1569Open in IMG/M
3300010362|Ga0126377_12229892All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300010362|Ga0126377_12466388Not Available596Open in IMG/M
3300010366|Ga0126379_11430693Not Available797Open in IMG/M
3300010376|Ga0126381_102008934All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300010398|Ga0126383_10187771Not Available1971Open in IMG/M
3300010398|Ga0126383_10351184All Organisms → cellular organisms → Bacteria1495Open in IMG/M
3300010398|Ga0126383_12553650All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300010399|Ga0134127_11030822Not Available884Open in IMG/M
3300010400|Ga0134122_10583883Not Available1029Open in IMG/M
3300010401|Ga0134121_10338320All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_68_151343Open in IMG/M
3300011269|Ga0137392_11331128Not Available577Open in IMG/M
3300011271|Ga0137393_10245871All Organisms → cellular organisms → Bacteria1518Open in IMG/M
3300012202|Ga0137363_10202014All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1595Open in IMG/M
3300012202|Ga0137363_10280837All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1362Open in IMG/M
3300012203|Ga0137399_10506056All Organisms → cellular organisms → Bacteria → Terrabacteria group1013Open in IMG/M
3300012205|Ga0137362_10226653All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1612Open in IMG/M
3300012207|Ga0137381_10365919All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1257Open in IMG/M
3300012211|Ga0137377_11258566All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300012353|Ga0137367_10580034All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300012358|Ga0137368_10860504All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300012360|Ga0137375_11284912All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300012363|Ga0137390_10516041All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300012363|Ga0137390_10599654All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1069Open in IMG/M
3300012363|Ga0137390_10922566All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium827Open in IMG/M
3300012485|Ga0157325_1042072All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300012685|Ga0137397_10548567All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300012896|Ga0157303_10072159All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium769Open in IMG/M
3300012922|Ga0137394_10359226Not Available1243Open in IMG/M
3300012923|Ga0137359_10905624All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300012929|Ga0137404_11565213All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300012930|Ga0137407_10102337Not Available2458Open in IMG/M
3300012931|Ga0153915_13135326All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300012971|Ga0126369_13231791All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium534Open in IMG/M
3300013297|Ga0157378_10917506All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300014321|Ga0075353_1190825All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300015373|Ga0132257_101484350Not Available865Open in IMG/M
3300015374|Ga0132255_104028746All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300016404|Ga0182037_11413257All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300017973|Ga0187780_10792463All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria685Open in IMG/M
3300018027|Ga0184605_10017657All Organisms → cellular organisms → Bacteria → Proteobacteria2824Open in IMG/M
3300018028|Ga0184608_10107947All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1169Open in IMG/M
3300018060|Ga0187765_10756788Not Available644Open in IMG/M
3300018064|Ga0187773_10464414Not Available747Open in IMG/M
3300018429|Ga0190272_10625942Not Available950Open in IMG/M
3300018431|Ga0066655_10701458All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300018482|Ga0066669_11405825All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium632Open in IMG/M
3300019886|Ga0193727_1151844Not Available628Open in IMG/M
3300019888|Ga0193751_1238860Not Available571Open in IMG/M
3300020015|Ga0193734_1061970Not Available672Open in IMG/M
3300020583|Ga0210401_11192420All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria620Open in IMG/M
3300021086|Ga0179596_10007811All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria3360Open in IMG/M
3300021090|Ga0210377_10073103All Organisms → cellular organisms → Bacteria2331Open in IMG/M
3300021344|Ga0193719_10163449Not Available958Open in IMG/M
3300021344|Ga0193719_10297089All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300025885|Ga0207653_10029083All Organisms → cellular organisms → Bacteria1780Open in IMG/M
3300025899|Ga0207642_10365526All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300025917|Ga0207660_10387815Not Available1123Open in IMG/M
3300025923|Ga0207681_10530369All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300025923|Ga0207681_11381542All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_68_15591Open in IMG/M
3300025926|Ga0207659_11304412All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium623Open in IMG/M
3300026089|Ga0207648_11707153All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium591Open in IMG/M
3300026313|Ga0209761_1269811Not Available624Open in IMG/M
3300026315|Ga0209686_1112970All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300026327|Ga0209266_1089755All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1372Open in IMG/M
3300027364|Ga0209967_1077849All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300027577|Ga0209874_1044640All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1167Open in IMG/M
3300027577|Ga0209874_1149823All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300027787|Ga0209074_10430605All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria559Open in IMG/M
3300027862|Ga0209701_10314707All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium895Open in IMG/M
3300027907|Ga0207428_11034053All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium576Open in IMG/M
3300027909|Ga0209382_10946302Not Available903Open in IMG/M
3300027957|Ga0209857_1070900All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium597Open in IMG/M
3300028047|Ga0209526_10137415All Organisms → cellular organisms → Bacteria1714Open in IMG/M
3300028381|Ga0268264_11597588Not Available663Open in IMG/M
3300028597|Ga0247820_11291285Not Available529Open in IMG/M
3300028809|Ga0247824_10171121All Organisms → cellular organisms → Bacteria1177Open in IMG/M
3300028889|Ga0247827_10497321Not Available762Open in IMG/M
3300031198|Ga0307500_10127317All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300031226|Ga0307497_10425131Not Available640Open in IMG/M
3300031720|Ga0307469_10671572All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium936Open in IMG/M
3300031724|Ga0318500_10738951All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300031740|Ga0307468_101558632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860615Open in IMG/M
3300031908|Ga0310900_10882703All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300032013|Ga0310906_10034337All Organisms → cellular organisms → Bacteria2349Open in IMG/M
3300032174|Ga0307470_10256952All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300032174|Ga0307470_11047278All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300032180|Ga0307471_100736701All Organisms → cellular organisms → Bacteria1151Open in IMG/M
3300032205|Ga0307472_102582340Not Available517Open in IMG/M
3300033158|Ga0335077_11529439Not Available638Open in IMG/M
3300033233|Ga0334722_10347576All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1076Open in IMG/M
3300033412|Ga0310810_10165219All Organisms → cellular organisms → Bacteria2552Open in IMG/M
3300033813|Ga0364928_0170316Not Available540Open in IMG/M
3300034178|Ga0364934_0168543All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300034818|Ga0373950_0165388All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium513Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil14.91%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere11.18%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.21%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.59%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.11%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.11%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.48%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.86%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.86%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.86%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.86%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.86%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.86%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.24%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.24%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.24%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.24%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.62%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.62%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.62%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.62%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.62%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.62%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.62%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.62%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.62%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.62%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012485Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610Host-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014321Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300027364Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027957Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033813Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPgaii200_104088222228664022SoilMHFGIFVEEMRYGASQVSAFRDAFDLAQRAEDWGLDCVWLGEIH
INPgaii200_115078112228664022SoilMHFGLFVEEMRRGASPISAFDDAFELADMADTWGMDCVWLG
F24TB_1047647023300000550SoilMHFGIFVEEMRYGASQVSAFRDAFELAHRAEDWGLDCVWLGEPRRWW*
F14TC_10020442913300000559SoilVHVGLFVEELRQGATQTSAFRDIFETVERAEAWGIDCVWLGEIHFT
F14TB_10087022113300001431SoilVHVGLFVEELRQGATQTSAFRDIFETVERAEAWGIDCVWLGEIHFTPSRSIISA
F14TB_10306691713300001431SoilMHFGLFVEEMRRGASPISAFDDAFELADMADTWGMDCVWLGEIHFT
JGI12053J15887_1025481413300001661Forest SoilMHFGLFVEEMRRGASPISAFDDAFELADMADAWGMDCVWLGEIHFTPARSVISASLLVAS
Ga0055437_1009375413300004009Natural And Restored WetlandsVHFGIFIEELRQGASQATAFRDAFELADRAEAWGADCVWLG
Ga0062595_10102662213300004479SoilVHFGIFVEEMRQGASQPSAFRDVFELADRAEAWGVDCLWLGEIHFTPVRSVIS
Ga0065704_1021798323300005289Switchgrass RhizosphereMHFGLFVEEMRRGASPISAFDDAFELADMADTWGMDCVWLGEIHFTPARSVISASL
Ga0065705_1102422313300005294Switchgrass RhizosphereVHFGIFVEELRHGATQAAAFRDIFETADHAEAWGIDCAWLGEIHFTPSRSIIS
Ga0066388_10035263823300005332Tropical Forest SoilMHFGVFAEEMRHGASPASAFRDVFELAERAEASGIDCVWL
Ga0066388_10778093113300005332Tropical Forest SoilVHIGLFIEEMRQGASQDQTACFRDIFEVADRAEAWGIDCVWLGEIHFTP
Ga0070668_10094138723300005347Switchgrass RhizosphereMHFGIFVEEMRYGASQVSAFRDAFDLAQRAEDWGLDCVWLG
Ga0070705_10002362043300005440Corn, Switchgrass And Miscanthus RhizosphereVHFGIFVEEMRQGSGQSQTSAFRDIFEVADHADAWGADCVWLGEIHF
Ga0066686_1085051513300005446SoilMHCGLFIEEMRQGADQATAFRDVFELADRAEAWGADCVWLGEIHF
Ga0066682_1015521733300005450SoilMHFGLFVEEMRRGATAVSAFDDAFGLADLAEAWGMDCVWLGEI
Ga0068867_10175913823300005459Miscanthus RhizosphereVHFGIFVEEMRQGASQPSAFRDVFELADRAEAWGVDCLWLGEIHFTPVRSVISASLQVAS
Ga0070706_10153408413300005467Corn, Switchgrass And Miscanthus RhizosphereMHFGLFVEEMRRGASPVSAFDDAFELADMAEAWGMDCVWLGEIHF
Ga0070707_10039845023300005468Corn, Switchgrass And Miscanthus RhizosphereMHFGIFVEELRYGASQAEAFRDIFETADRAEAGGVDCVWLGEIHFT
Ga0070699_10035238913300005518Corn, Switchgrass And Miscanthus RhizosphereVHFGVFVEELRHGATQAGAFRDIFETAAQAEAGGIDCVWLGEIHF
Ga0070699_10152787113300005518Corn, Switchgrass And Miscanthus RhizosphereVHFGIFVEEMRQGASQPSAFRDVFELADRAEAWGVDCLWLG
Ga0070696_10057875413300005546Corn, Switchgrass And Miscanthus RhizosphereVHFGIFVEEMRQGTSQPGAFRDVFELADRAEAWGIDCVWLGEIHF
Ga0070704_10194884923300005549Corn, Switchgrass And Miscanthus RhizosphereVHFGIFVEEKRHGVTQHDAFRDIFELADRAEAWGVDCVWLGEIHFTP
Ga0066705_1064774723300005569SoilVHFGLFVEEMRQGASQTSAFRDVFELAERADALGIDCVW
Ga0066702_1091747313300005575SoilMQAVHVGLFVEEMRQGATQTSAFRDIFDTAERADALGIDC
Ga0070702_10143245013300005615Corn, Switchgrass And Miscanthus RhizosphereMHFGLFVEEMRRGATPISAFDDAFELADIAETWGMDCVWLGEIHFTPSRSVISASLLV
Ga0068861_10032830513300005719Switchgrass RhizosphereVHFGIFVEEMRQGSSQSQTSAFRDIFEVADHADAWGADCVWLGEIHFTPT
Ga0066903_10603557913300005764Tropical Forest SoilVPGPGKAPAWYNLPMHFGLFVEEMRRGATAVSAFDDAFDLADIAEAWGMDCVWLGEIHFTPARSVISASLLVASSI
Ga0068858_10247771023300005842Switchgrass RhizosphereVHFGIFVEEMRQGASQPSAFRDVFELADRAEAWGVDCLWLGEIHFTPV
Ga0068860_10170761813300005843Switchgrass RhizosphereVHFGIFVEEMRQGATQPSAFRDVFELADRAEAWGVDCLWLGEIHFTPVRSVISA
Ga0066651_1050571323300006031SoilVHFGIFVEEMRQGASQAGAFRDVFELADRAEAWGAGCVWLGEIHFTPVRSVISASLQVAS
Ga0066651_1078457923300006031SoilVHFGIFVEEKRHGVTQAEAFRDIFELADRADAWGV
Ga0075018_1045522023300006172WatershedsMGAVHFGVFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHFTPSRSVISA
Ga0066659_1072676713300006797SoilMHFGLFVEEMRRGASPVSAFDDAFELADMAEAWGMDCVWLGEIHFTPARSVISA
Ga0079221_1107584413300006804Agricultural SoilLHFGIFVEELRHGATQAGAFRDIIETAAQAETGGVDCVWL
Ga0075421_10207835813300006845Populus RhizosphereVHFGIFVEEMRQGANQATAFRDVFELADRAEAWGADCVWLGEIHFTP
Ga0075421_10209613713300006845Populus RhizosphereVHIGLFVEEMRQGATQPEAFRDIFALADRAEAWGIDCLWLGEIHFTPVRS
Ga0075433_1059019823300006852Populus RhizosphereMHFGLFVEEMRRGATAVSAFDDAFELADIAEAWGMDCVWLGEIH
Ga0075425_10112494023300006854Populus RhizosphereVHFGIFVEEMRQGSSQDQAAAFRDIFETAEHADAWGADCVWLGEIHFTPTRSVIS
Ga0075425_10127784423300006854Populus RhizosphereMHFGIFVEEMRYGASQVSAFRDAFDLAQRAEDWGLDCVW
Ga0075425_10240425223300006854Populus RhizosphereMHFGLFVEEMRRGATPISAFDDAFELADIAETWGMDCVWLGEIHF
Ga0075434_10177690413300006871Populus RhizosphereVHFGIFVEEMRQGANQATAFRDVFELADRAEAWGADCVWLGEIHFTPT
Ga0075434_10197093213300006871Populus RhizosphereMHFGLFVEEMRRGATPVSAFDDAFELADIAETWGMDCVWLGEIHFT
Ga0075429_10093941123300006880Populus RhizosphereMHFGLFVEEMRRGATPISAFDDAFELADMAETWGMDCV
Ga0075426_1011574913300006903Populus RhizosphereMHFGLFVEEMRRGATPVSAFDDAFELADMAETWGMDCVWLGEIHF
Ga0075424_10199871213300006904Populus RhizosphereMHFGIFVEEMRQGLSQTAAFREAFDVAERAEELGVDC
Ga0079218_1370542023300007004Agricultural SoilMHVGIFVEELRQGEDQATSFREAFALAERADALGIECVWLGEI
Ga0075435_10145589523300007076Populus RhizosphereMHFGLFVEEMRRGATPISAFDDAFELADIAETWGMDCVWLGEIHFTPS
Ga0066710_10440208213300009012Grasslands SoilMHVGIFVEEMRHGVDQVGAFRDAFAIAERADAWGADGVWRGGTHFAPTRSVISAREAGSGFGAPC
Ga0099830_1040016113300009088Vadose Zone SoilVHFGIFVEEIRHGANQIASFRDVFEQADRAEAWGIDCVWLGEIH
Ga0099828_1014305623300009089Vadose Zone SoilVHFGIFVEELGHGATQAGAFRDIFETADRAEAWGIDCVWLGE
Ga0099828_1175265513300009089Vadose Zone SoilMHFGIFVEELRYGASQAAAFRDIFETADRAEAWGID
Ga0075418_1252427213300009100Populus RhizosphereMHFGLFVEEMRRGATPISAFDDAFELADMAETWGMDCVW
Ga0114129_1004517413300009147Populus RhizosphereVHFGIFVEELRHGATQAGAFRDIFETADHAEAWGID
Ga0114129_1110239013300009147Populus RhizosphereVHVGIFIEEMRQGSSQNQAAAFRDIFEVADHADAWGADCVWLGEIHFTP
Ga0105243_1242815623300009148Miscanthus RhizosphereVHFGIFVEEMRQGSSQSQTSAFRDIFEVADHADAWGADCVWLGEI
Ga0111538_1237347113300009156Populus RhizosphereMHFGLFVEEMRRGATPVSAFDDAFELADIAETWGMDCVWLGEIHFTPSRSVISASL
Ga0126374_1159380213300009792Tropical Forest SoilVHVGIFIEELRQGASQAEAFRDIFELADRCEAWGVPCVWLGEIHFTPTR
Ga0126382_1065871613300010047Tropical Forest SoilMALGEATVHFGLFIEEIRQGASQASSFRDIFELAGRAEALGIDCVWLGEIH
Ga0126382_1150175023300010047Tropical Forest SoilMFVEEKRHDATQRSAFRDVFELADRAEAWGIDCVWLG
Ga0126382_1252347123300010047Tropical Forest SoilVHVGIFIEELRQGASQAQAFRDIFELADRCEAWGVPCVWLGEIHFTPTRSVISA
Ga0134067_1015010223300010321Grasslands SoilMHFGIFVEEMRRGASQGQAFQETFELADTAEACKA*
Ga0134063_1050627223300010335Grasslands SoilMRQGATQTSAFRDIFATAERADALGIDCVWLGEIHFTPT
Ga0134062_1005555113300010337Grasslands SoilMQAVHVGLFVEEMRQGATQTSAFRDIFDTAERADALGID
Ga0126370_1172822023300010358Tropical Forest SoilVHFGIFVEELRQGATQASAFRDIFELTERAEAWGIDCVWLGEI
Ga0126377_1030599133300010362Tropical Forest SoilVHVGLFVEELRQGATQTSAFRDIFESAERAEAWGIDCVWLGEIHFTPSRSIISASLQ
Ga0126377_1222989213300010362Tropical Forest SoilVHVGLFVEELRQGATQTSAFRDIFETADRAEAWGIDCVWLGEIHFTPSRSIISASLQ
Ga0126377_1246638813300010362Tropical Forest SoilVHIGLFIEEMRQGSNQDQPTAFRDIFEVADRAEAWGIDCVWL
Ga0126379_1143069323300010366Tropical Forest SoilVPEEAAVHFGIFVEEKRHGVTQHDAFRDIFELADR
Ga0126381_10200893413300010376Tropical Forest SoilMHFGLFVEEMRRGATAISAFDDAFELADNAEAWGMDCVWLGEIHFTPSRSVI
Ga0126383_1018777113300010398Tropical Forest SoilVHFGVFIEELRHGATQASAFRDIFEVADRAEAWGLNCAWL
Ga0126383_1035118423300010398Tropical Forest SoilVHVGIFIEELRQGASQAEAFRDIFELADRCEAWGVPCV*
Ga0126383_1255365013300010398Tropical Forest SoilMHFGIFVEEMRYGASQVSAFRDAFELAERAEDWGLDC
Ga0134127_1103082213300010399Terrestrial SoilVHFGIFVEEMRQGASQPSAFRDVFELADRAEAWGVDCLW
Ga0134122_1058388323300010400Terrestrial SoilVHFGIFVEEMRQGASQPTAFRDVFELADRAEAWGVDCLWLGEIHFTP
Ga0134121_1033832013300010401Terrestrial SoilVHFGIFVEEMRQGSSQSQTSAFRDIFEIADHADAWGADCVWLGEIHFTPTRSV
Ga0137392_1133112823300011269Vadose Zone SoilVSIEAVHFGIFVEEIRYGASQVESFRDIFEQADRAEAWGIDCVWLGEIHFTPSRSVIS
Ga0137393_1024587113300011271Vadose Zone SoilLTPARWAVTIGVVHFGVFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHFTPSRSVISA
Ga0137363_1020201443300012202Vadose Zone SoilVHFGIFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHF
Ga0137363_1028083733300012202Vadose Zone SoilVHFGVFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHF
Ga0137399_1050605613300012203Vadose Zone SoilVHVGIFVEEMRQGASQRAAFRDVFELADRADACGIDCVWLGEIHFTPT
Ga0137362_1022665313300012205Vadose Zone SoilVHFGIFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHFTPSRSVISAS
Ga0137381_1036591943300012207Vadose Zone SoilVHFGIFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHFTP
Ga0137377_1125856623300012211Vadose Zone SoilMHFGLFVEEMRRGATTVSAFDDAFELADIAEAWGMDCVWLGEIHF
Ga0137367_1058003423300012353Vadose Zone SoilMHFGIFVEEMRYWANQVSAFRDAFELAQHAEDWGLDCVWL
Ga0137368_1086050423300012358Vadose Zone SoilMHFGIFVEEMRYGTNQISAFQNAFELAQHAEDWGLDC
Ga0137375_1128491213300012360Vadose Zone SoilMHVGIFVEEMRRGVDQATAFRDVFALAERAEARGIDCVWLGEIHFTP
Ga0137390_1051604123300012363Vadose Zone SoilMADAMHFGIFVEEMRQGADQAAAFRDVFETAERAEAWGVDCVWLGE
Ga0137390_1059965423300012363Vadose Zone SoilVHFGVFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHFTPSRSVISASL
Ga0137390_1092256613300012363Vadose Zone SoilVHFGVFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHFTPSRSVISASLQVA
Ga0157325_104207213300012485Arabidopsis RhizosphereMHFKIFVKEMRYGASQVSAFRDAFDLAQRTEDWGLDCVW
Ga0137397_1054856723300012685Vadose Zone SoilVHFGLFVEEMRQGASQTSAFRDVFELAERADALGIDCVWLGEIHF
Ga0157303_1007215913300012896SoilVHFGVFVEELRHGATQAGAFRDIFETAAQAEAGGIDCVWLGEIHFTPS
Ga0137394_1035922613300012922Vadose Zone SoilMHFGLFVEEMRRGATAVSAFDDAFGLADLAEAWGMDCVWLGEIHFTPARS
Ga0137359_1090562423300012923Vadose Zone SoilMHFGLFVEEMRRGATTVSAFDDAFELADIAEAWGMDCVWLG
Ga0137404_1156521313300012929Vadose Zone SoilMHFGLFVEEMRRGATAVSAFDDAFGLAELAEAWGMDCVWLGEIHFTPARSVISASLL
Ga0137407_1010233713300012930Vadose Zone SoilMHFGLFVEEMRRGANAVSAFDDAFELADMAEAWGMDCVWLGEIHFTPARSVIS
Ga0153915_1313532623300012931Freshwater WetlandsMHVGIFVEELRHGATQVSAFRDIFELSDRAEAWGV
Ga0126369_1323179113300012971Tropical Forest SoilVHVGLFVEEMRQGADQVSAFRDIFDTAQRADALGI
Ga0157378_1091750613300013297Miscanthus RhizosphereMHFGLFVEEMRRGATAVSAFDDAFELADIAEAWGM
Ga0075353_119082523300014321Natural And Restored WetlandsVHFGIFVEEMRQGSSQDQASAFRDIFEVADHADAWGADCVWLGEIHFT
Ga0132257_10148435013300015373Arabidopsis RhizosphereMHIGLFVEEMRQGATQPAAFRDIFELADRAEAWAIDCVWLGEI
Ga0132255_10402874623300015374Arabidopsis RhizosphereMHFGLFVEEMRRGATPVSAFDDAFELADIAEAWGMDCVWLGEIHFT
Ga0182037_1141325713300016404SoilMHFGLFVEEMRRGATAISAFDDAFELADSAEAWGMDCVWLG
Ga0187780_1079246313300017973Tropical PeatlandVHFGIFVEELRQGANQAEAFRDVFETADRAEAWGVDCV
Ga0184605_1001765713300018027Groundwater SedimentVHFGIFVEEMRQGASQASAFRDVFELADRAEAWGIDCVWLGA
Ga0184608_1010794713300018028Groundwater SedimentVHFGIFVEELRHGATQAGAFRDIFETADHAEAWGIDCAWLGEIHFT
Ga0187765_1075678813300018060Tropical PeatlandMALEEATMHFGLFIEEIRQGASQVASFRDIFELAGRAETLGVDCVWLGE
Ga0187773_1046441413300018064Tropical PeatlandMHFGLFVEEIRQGATQAAAFRDIFELAERAEALGIDCV
Ga0190272_1062594223300018429SoilVHFGIFVEELRHGATQAGAFRDIFETADHAEAWGIDCAWLGEIHFTP
Ga0066655_1070145823300018431Grasslands SoilMHFGIFVEEMRYGSNQVSAFRDAFELAQRAEDWGLDCVW
Ga0066669_1140582523300018482Grasslands SoilVHFGLFVEEMRQGASQTSAFRDVFELAERADTLGI
Ga0193727_115184423300019886SoilVHFGIFVEELRHGATQAAAFRDIFETADHAEAWGIDCAWLGEIHFTPSRSIISASLQVAS
Ga0193751_123886023300019888SoilVHFGVFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHFTPSRSVISASLQ
Ga0193734_106197023300020015SoilVHFGVFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHFTPSRSVI
Ga0210401_1119242013300020583SoilVHFGIFVEELRQGATQAAAFRDVFETADRAEAWGIDCVWLGEIYFTPSRSVISA
Ga0179596_1000781113300021086Vadose Zone SoilVHFGVFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIHFTPSRSVISASLQVAS
Ga0210377_1007310353300021090Groundwater SedimentVHFGIFVEEMRQGSSQTSAFRDIFELAERAEAWGVDCVWLGEIHF
Ga0193719_1016344913300021344SoilVHFGIFVEELRHGATQAAAFRDIFETADHAEAWGID
Ga0193719_1029708913300021344SoilMHFGLFVEEMRRGATPVSAFDDAFELADIAEAWGMDCVWLGEIHFTPARSVISASLLM
Ga0207653_1002908333300025885Corn, Switchgrass And Miscanthus RhizosphereMHFGLFVEEMRRGATAVSAFDDAFELADIAEAWGMDCVWLGEIHFTPARSVISASLLMA
Ga0207642_1036552623300025899Miscanthus RhizosphereMHFGLFVEEMRRGATAVSAFDDAFELADIAEAWGMD
Ga0207660_1038781533300025917Corn RhizosphereVHFGIFVEEMRQGASQPSAFRDVFELADRAEAWGVDCLWLGEIHFTPVRSVISASL
Ga0207681_1053036913300025923Switchgrass RhizosphereMHFGLFVEEMRRGATAVSAFDDAFELADIAEAWGMDCVWLGEIHFTPARSVI
Ga0207681_1138154223300025923Switchgrass RhizosphereVHFGIFVEEMRQGSSQSQTSAFRDIFEVADHADAW
Ga0207659_1130441223300025926Miscanthus RhizosphereVHFGVFVEELRHGATQAGAFRDIFETAAQAEAGGIDCVWLGEIHFTPSRSII
Ga0207648_1170715313300026089Miscanthus RhizosphereVHFGIFVEEMRQGASQPSAFRDVFELADRAEAWGVDCLWLGEIHFTPVRSVISA
Ga0209761_126981113300026313Grasslands SoilMHCGLFIEEMRQGADQATAFRDVFELADRAEAWGADCVWLGEIHFTPVRSVIS
Ga0209686_111297013300026315SoilVHFGLFVEEMRQGASQTSAFRDVFELAERADTLGIDCVWLGE
Ga0209266_108975523300026327SoilMQAVHVGLFVEEMRQGATQTSAFRDVFDTAERADALGIDCVW
Ga0209967_107784913300027364Arabidopsis Thaliana RhizosphereVHVGLFVEELRQGATQSSAFRDIFETADRAEAWGIDCVWLGE
Ga0209874_104464023300027577Groundwater SandMHFGIFVEEMRYGANQVSAFRDAFEVAQHAEAWGVDCVWLGEIHFAPTRS
Ga0209874_114982323300027577Groundwater SandMHFGIFIEEMRHGASQTRAFRDVFETADRAEAWGVDCVW
Ga0209074_1043060523300027787Agricultural SoilVHFGIFVEELRHGATQAGAFRDIFETAAQAETGGVDCVWLGEIHFTP
Ga0209701_1031470713300027862Vadose Zone SoilVHFGIFVEEIRHGANQIASFRDVFEQADRAEAWGIDCVWLGEI
Ga0207428_1103405313300027907Populus RhizosphereVHVGIFIEELRQGASQAEAFRDIFELADRCEAWGVPC
Ga0209382_1094630213300027909Populus RhizosphereVHIGLFVEEMRQGATQPEAFRDIFALADRAEAWGIDCLWLGEIHFTPVRSVISA
Ga0209857_107090013300027957Groundwater SandMHFGIFVEEMRYGASQVSAFRDAFELAQQAEAWGLDC
Ga0209526_1013741513300028047Forest SoilVHFGVFVEELRHGATQAGAFRDIFETADRAEAGGVDCVWLGEIRFTPSRSVISAS
Ga0268264_1159758813300028381Switchgrass RhizosphereVHFGIFVEEKRHGVTQHDAFRDIFELADRAEAWGVDCVW
Ga0247820_1129128523300028597SoilVHIGLFVEELRQGATQPEAFRDIFALADRAEAWGIDCLWLGEIHFTPVRSVISASLQVASAI
Ga0247824_1017112113300028809SoilVHIGLFVEEMRQGATQPEAFRDIFALADRAEAWGIDCLWLGEIHFTPVR
Ga0247827_1049732113300028889SoilMHIGLFVEEMRQGATQPAAFRDIFELADRAEAWGIDCVWLGEI
Ga0307500_1012731723300031198SoilMHFGLFVEEMRRGATAVSAFDDAFELADIAEAWGMDCVWLGEIHFTPARSVISA
Ga0307497_1042513123300031226SoilMHIGLFVEEMRQGATQPAAFRDIFELADRAEAWGIDCVW
Ga0307469_1067157233300031720Hardwood Forest SoilVHFGIFVEEIRYGANQIASFRDVFEQADRAEAWGIDCVWLGEIHFTPSRSVI
Ga0318500_1073895123300031724SoilMHFGLFVEEMRRGATPISAFDDAFELADTAEAWGMDCVW
Ga0307468_10155863223300031740Hardwood Forest SoilVHFGIFVEEMRQGASQPSAFRDVFELADRAEAWGV
Ga0310900_1088270313300031908SoilMHFGLFVEEMRRGATPVSAFDDAFELADIAEAWGMDCVWLGEIHFTPARSVIS
Ga0310906_1003433713300032013SoilMHVGIFVEEMRQGANQPAAFRDVFELADRAEAWGIDCVWLGEI
Ga0307470_1025695223300032174Hardwood Forest SoilVHIGLFVEEMRQGATQPEAFRDIFELADRAEAWGIDCLWLGEIHFTP
Ga0307470_1104727813300032174Hardwood Forest SoilMHFGLFVEEMRRGATAVSAFDDAFELADIAEAWGMDCVWLGEIHF
Ga0307471_10073670113300032180Hardwood Forest SoilMRPVHIGLFVEEMRQGANQASAFRDIFETAQRADALGLDCVW
Ga0307472_10258234023300032205Hardwood Forest SoilVHFGIFVEELRHGATQAGAFRDIFETADRAEAGGVDC
Ga0335077_1152943913300033158SoilVHFGLFIEEIRQGASQASSFRDIFELAGRAEVLGIDCV
Ga0334722_1034757623300033233SedimentVHFGIFVEELRHGATQARAFRDIFETADHAEAWGIDCVWLGEIHFTPSRSIISASLQVAS
Ga0310810_1016521913300033412SoilMHVGIFCEEMRQGSDQPTAFQDVFELADRAEAWGIECV
Ga0364928_0170316_415_5403300033813SedimentVHFGIFVEEMRQGASQAGAFRDIFELADRAEAWGVDCVWLGE
Ga0364934_0168543_690_8303300034178SedimentMDAMHFGLFVEEMRHGATQASAFRDVFEVADRAEAWGIDCVWLGEIH
Ga0373950_0165388_354_5123300034818Rhizosphere SoilVHFGVFVEELRHGATQAGAFRDIFETAAQAEAGGIDCVWLGEIHFTPSRSIIS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.