


| Basic Information | |
|---|---|
| Family ID | F040480 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 161 |
| Average Sequence Length | 38 residues |
| Representative Sequence | METGDFWHEEQAQILRKYVKDLKVWIHKQEGWWNE |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 55.28 % |
| % of genes from short scaffolds (< 2000 bps) | 81.99 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (34.783 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (29.192 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.689 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (49.689 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.44% β-sheet: 0.00% Coil/Unstructured: 55.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF00565 | SNase | 12.42 |
| PF01764 | Lipase_3 | 3.73 |
| PF13529 | Peptidase_C39_2 | 2.48 |
| PF00959 | Phage_lysozyme | 2.48 |
| PF07068 | Gp23 | 1.24 |
| PF00124 | Photo_RC | 0.62 |
| PF01755 | Glyco_transf_25 | 0.62 |
| PF06841 | Phage_T4_gp19 | 0.62 |
| PF03797 | Autotransporter | 0.62 |
| PF08534 | Redoxin | 0.62 |
| PF03237 | Terminase_6N | 0.62 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.62 |
| PF02867 | Ribonuc_red_lgC | 0.62 |
| PF08406 | CbbQ_C | 0.62 |
| PF00462 | Glutaredoxin | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.62 |
| COG0714 | MoxR-like ATPase | General function prediction only [R] | 0.62 |
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.22 % |
| Unclassified | root | N/A | 34.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001255|B570J13889_100787 | Not Available | 772 | Open in IMG/M |
| 3300001843|RCM34_1018959 | Not Available | 515 | Open in IMG/M |
| 3300001847|RCM41_1009970 | All Organisms → Viruses → Predicted Viral | 1650 | Open in IMG/M |
| 3300001848|RCM47_1074255 | All Organisms → Viruses → Predicted Viral | 1240 | Open in IMG/M |
| 3300001968|GOS2236_1093264 | All Organisms → Viruses → Predicted Viral | 3007 | Open in IMG/M |
| 3300002144|M2t2BS2_10567370 | Not Available | 897 | Open in IMG/M |
| 3300005527|Ga0068876_10023438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3885 | Open in IMG/M |
| 3300005581|Ga0049081_10281401 | Not Available | 577 | Open in IMG/M |
| 3300005805|Ga0079957_1006380 | Not Available | 9436 | Open in IMG/M |
| 3300005805|Ga0079957_1019098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae | 4846 | Open in IMG/M |
| 3300005805|Ga0079957_1039405 | All Organisms → Viruses → Predicted Viral | 3016 | Open in IMG/M |
| 3300007539|Ga0099849_1138836 | Not Available | 946 | Open in IMG/M |
| 3300007541|Ga0099848_1045128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 1792 | Open in IMG/M |
| 3300007541|Ga0099848_1115030 | All Organisms → Viruses → Predicted Viral | 1021 | Open in IMG/M |
| 3300007541|Ga0099848_1218090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 678 | Open in IMG/M |
| 3300007541|Ga0099848_1263127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 600 | Open in IMG/M |
| 3300007542|Ga0099846_1133914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 899 | Open in IMG/M |
| 3300007625|Ga0102870_1119631 | Not Available | 763 | Open in IMG/M |
| 3300007960|Ga0099850_1056224 | All Organisms → Viruses → Predicted Viral | 1671 | Open in IMG/M |
| 3300007960|Ga0099850_1085650 | All Organisms → Viruses → Predicted Viral | 1312 | Open in IMG/M |
| 3300007960|Ga0099850_1204275 | All Organisms → Viruses | 776 | Open in IMG/M |
| 3300007960|Ga0099850_1225051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 730 | Open in IMG/M |
| 3300008055|Ga0108970_10473864 | All Organisms → Viruses | 6603 | Open in IMG/M |
| 3300008107|Ga0114340_1140871 | All Organisms → Viruses → Predicted Viral | 1426 | Open in IMG/M |
| 3300008113|Ga0114346_1078003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2043 | Open in IMG/M |
| 3300008262|Ga0114337_1220235 | Not Available | 754 | Open in IMG/M |
| 3300008448|Ga0114876_1003868 | Not Available | 9941 | Open in IMG/M |
| 3300008448|Ga0114876_1118382 | All Organisms → Viruses → Predicted Viral | 1020 | Open in IMG/M |
| 3300009160|Ga0114981_10045632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → Pseudoalteromonas fuliginea | 2468 | Open in IMG/M |
| 3300009183|Ga0114974_10502326 | Not Available | 680 | Open in IMG/M |
| 3300010299|Ga0129342_1042421 | All Organisms → Viruses → Predicted Viral | 1805 | Open in IMG/M |
| 3300010299|Ga0129342_1088453 | Not Available | 1171 | Open in IMG/M |
| 3300010299|Ga0129342_1099457 | All Organisms → Viruses → Predicted Viral | 1092 | Open in IMG/M |
| 3300010354|Ga0129333_10021786 | All Organisms → Viruses | 6085 | Open in IMG/M |
| 3300010354|Ga0129333_10075124 | Not Available | 3139 | Open in IMG/M |
| 3300010354|Ga0129333_10179486 | All Organisms → Viruses → Predicted Viral | 1933 | Open in IMG/M |
| 3300010354|Ga0129333_10187763 | All Organisms → Viruses → Predicted Viral | 1884 | Open in IMG/M |
| 3300010354|Ga0129333_10293262 | All Organisms → Viruses → Predicted Viral | 1457 | Open in IMG/M |
| 3300010354|Ga0129333_10335272 | Not Available | 1348 | Open in IMG/M |
| 3300010354|Ga0129333_10364827 | All Organisms → Viruses → Predicted Viral | 1283 | Open in IMG/M |
| 3300010354|Ga0129333_10436215 | All Organisms → Viruses → Predicted Viral | 1155 | Open in IMG/M |
| 3300010354|Ga0129333_10482903 | Not Available | 1088 | Open in IMG/M |
| 3300010354|Ga0129333_10537792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 1020 | Open in IMG/M |
| 3300010354|Ga0129333_10889916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 754 | Open in IMG/M |
| 3300010354|Ga0129333_10906607 | Not Available | 745 | Open in IMG/M |
| 3300010354|Ga0129333_10945684 | Not Available | 727 | Open in IMG/M |
| 3300010354|Ga0129333_10991368 | Not Available | 706 | Open in IMG/M |
| 3300010354|Ga0129333_11673100 | Not Available | 518 | Open in IMG/M |
| 3300010370|Ga0129336_10127329 | All Organisms → Viruses → Predicted Viral | 1482 | Open in IMG/M |
| 3300010370|Ga0129336_10176499 | Not Available | 1225 | Open in IMG/M |
| 3300010370|Ga0129336_10267885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 956 | Open in IMG/M |
| 3300010370|Ga0129336_10592719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 592 | Open in IMG/M |
| 3300010370|Ga0129336_10651455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 560 | Open in IMG/M |
| 3300011268|Ga0151620_1006371 | All Organisms → Viruses → Predicted Viral | 4328 | Open in IMG/M |
| 3300012967|Ga0129343_1455795 | Not Available | 829 | Open in IMG/M |
| 3300012968|Ga0129337_1145789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 796 | Open in IMG/M |
| 3300012970|Ga0129338_1501772 | All Organisms → Viruses | 690 | Open in IMG/M |
| 3300013087|Ga0163212_1106167 | Not Available | 901 | Open in IMG/M |
| 3300013087|Ga0163212_1201990 | All Organisms → Viruses | 622 | Open in IMG/M |
| 3300013087|Ga0163212_1260090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 538 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10231673 | All Organisms → Viruses → Predicted Viral | 1029 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10309789 | Not Available | 979 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10705346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 635 | Open in IMG/M |
| 3300017761|Ga0181356_1092850 | Not Available | 991 | Open in IMG/M |
| 3300017777|Ga0181357_1080813 | All Organisms → Viruses → Predicted Viral | 1243 | Open in IMG/M |
| 3300020074|Ga0194113_10284482 | All Organisms → Viruses → Predicted Viral | 1263 | Open in IMG/M |
| 3300020074|Ga0194113_10600250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 776 | Open in IMG/M |
| 3300020074|Ga0194113_10731545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 683 | Open in IMG/M |
| 3300020083|Ga0194111_10338651 | All Organisms → Viruses → Predicted Viral | 1018 | Open in IMG/M |
| 3300020083|Ga0194111_10359850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 977 | Open in IMG/M |
| 3300020084|Ga0194110_10011265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 9857 | Open in IMG/M |
| 3300020084|Ga0194110_10321930 | All Organisms → Viruses → Predicted Viral | 1081 | Open in IMG/M |
| 3300020084|Ga0194110_10565205 | Not Available | 728 | Open in IMG/M |
| 3300020109|Ga0194112_10013922 | All Organisms → Viruses | 9663 | Open in IMG/M |
| 3300020109|Ga0194112_10348055 | All Organisms → Viruses → Predicted Viral | 1096 | Open in IMG/M |
| 3300020109|Ga0194112_10443051 | Not Available | 926 | Open in IMG/M |
| 3300020161|Ga0211726_10097556 | Not Available | 1445 | Open in IMG/M |
| 3300020161|Ga0211726_10397593 | Not Available | 504 | Open in IMG/M |
| 3300020172|Ga0211729_10621773 | Not Available | 1036 | Open in IMG/M |
| 3300020179|Ga0194134_10001207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 35862 | Open in IMG/M |
| 3300020179|Ga0194134_10161588 | All Organisms → Viruses | 1003 | Open in IMG/M |
| 3300020179|Ga0194134_10290063 | Not Available | 650 | Open in IMG/M |
| 3300020183|Ga0194115_10044902 | All Organisms → Viruses → Predicted Viral | 2870 | Open in IMG/M |
| 3300020183|Ga0194115_10068892 | All Organisms → Viruses → Predicted Viral | 2111 | Open in IMG/M |
| 3300020183|Ga0194115_10120747 | All Organisms → Viruses → Predicted Viral | 1419 | Open in IMG/M |
| 3300020183|Ga0194115_10160223 | All Organisms → Viruses → Predicted Viral | 1159 | Open in IMG/M |
| 3300020183|Ga0194115_10437472 | Not Available | 551 | Open in IMG/M |
| 3300020190|Ga0194118_10121233 | All Organisms → Viruses → Predicted Viral | 1574 | Open in IMG/M |
| 3300020190|Ga0194118_10322471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 815 | Open in IMG/M |
| 3300020190|Ga0194118_10438701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 647 | Open in IMG/M |
| 3300020193|Ga0194131_10450991 | Not Available | 575 | Open in IMG/M |
| 3300020197|Ga0194128_10237893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 947 | Open in IMG/M |
| 3300020197|Ga0194128_10380607 | Not Available | 677 | Open in IMG/M |
| 3300020198|Ga0194120_10255649 | Not Available | 913 | Open in IMG/M |
| 3300020200|Ga0194121_10258908 | Not Available | 904 | Open in IMG/M |
| 3300020204|Ga0194116_10001242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 37523 | Open in IMG/M |
| 3300020204|Ga0194116_10068545 | All Organisms → Viruses | 2398 | Open in IMG/M |
| 3300020205|Ga0211731_11056388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 623 | Open in IMG/M |
| 3300020214|Ga0194132_10217896 | All Organisms → Viruses → Predicted Viral | 1065 | Open in IMG/M |
| 3300020214|Ga0194132_10341574 | Not Available | 781 | Open in IMG/M |
| 3300020221|Ga0194127_10271382 | Not Available | 1157 | Open in IMG/M |
| 3300020578|Ga0194129_10619545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 502 | Open in IMG/M |
| 3300020603|Ga0194126_10005855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 17876 | Open in IMG/M |
| 3300021091|Ga0194133_10221552 | All Organisms → Viruses → Predicted Viral | 1235 | Open in IMG/M |
| 3300021092|Ga0194122_10440661 | Not Available | 654 | Open in IMG/M |
| 3300021093|Ga0194123_10162208 | All Organisms → Viruses → Predicted Viral | 1189 | Open in IMG/M |
| 3300021093|Ga0194123_10217098 | Not Available | 965 | Open in IMG/M |
| 3300021376|Ga0194130_10198228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 1188 | Open in IMG/M |
| 3300021376|Ga0194130_10378711 | Not Available | 758 | Open in IMG/M |
| 3300021376|Ga0194130_10606847 | Not Available | 542 | Open in IMG/M |
| 3300021424|Ga0194117_10059684 | All Organisms → Viruses → Predicted Viral | 2162 | Open in IMG/M |
| 3300021424|Ga0194117_10229562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 902 | Open in IMG/M |
| 3300021424|Ga0194117_10475576 | Not Available | 561 | Open in IMG/M |
| 3300021424|Ga0194117_10500501 | Not Available | 542 | Open in IMG/M |
| 3300021959|Ga0222716_10181852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1346 | Open in IMG/M |
| 3300021960|Ga0222715_10167004 | All Organisms → Viruses → Predicted Viral | 1348 | Open in IMG/M |
| 3300021961|Ga0222714_10008091 | Not Available | 9469 | Open in IMG/M |
| 3300021961|Ga0222714_10008156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9408 | Open in IMG/M |
| 3300021961|Ga0222714_10106467 | All Organisms → Viruses → Predicted Viral | 1762 | Open in IMG/M |
| 3300021961|Ga0222714_10243268 | All Organisms → Viruses → Predicted Viral | 1013 | Open in IMG/M |
| 3300021961|Ga0222714_10400825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 724 | Open in IMG/M |
| 3300021962|Ga0222713_10161849 | All Organisms → Viruses → Predicted Viral | 1532 | Open in IMG/M |
| 3300021962|Ga0222713_10782295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 534 | Open in IMG/M |
| 3300021962|Ga0222713_10806717 | Not Available | 523 | Open in IMG/M |
| 3300021963|Ga0222712_10000153 | All Organisms → Viruses | 97015 | Open in IMG/M |
| 3300022198|Ga0196905_1184930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 526 | Open in IMG/M |
| 3300022200|Ga0196901_1136591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 827 | Open in IMG/M |
| 3300022200|Ga0196901_1166463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 725 | Open in IMG/M |
| 3300022221|Ga0224506_10430687 | Not Available | 579 | Open in IMG/M |
| 3300022223|Ga0224501_10279608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 869 | Open in IMG/M |
| 3300024239|Ga0247724_1025960 | All Organisms → Viruses | 851 | Open in IMG/M |
| 3300024343|Ga0244777_10436860 | Not Available | 811 | Open in IMG/M |
| 3300024351|Ga0255141_1036677 | Not Available | 732 | Open in IMG/M |
| 3300027123|Ga0255090_1050843 | Not Available | 620 | Open in IMG/M |
| 3300027155|Ga0255081_1084154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 615 | Open in IMG/M |
| 3300027747|Ga0209189_1121472 | All Organisms → Viruses → Predicted Viral | 1145 | Open in IMG/M |
| 3300027782|Ga0209500_10262523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 748 | Open in IMG/M |
| 3300027797|Ga0209107_10490832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 → Synechococcus phage S-PM2 | 547 | Open in IMG/M |
| 3300027816|Ga0209990_10006487 | Not Available | 7738 | Open in IMG/M |
| 3300029930|Ga0119944_1018744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 957 | Open in IMG/M |
| 3300029930|Ga0119944_1036334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 620 | Open in IMG/M |
| 3300029930|Ga0119944_1041740 | All Organisms → Viruses | 566 | Open in IMG/M |
| 3300031539|Ga0307380_10689049 | Not Available | 863 | Open in IMG/M |
| 3300031707|Ga0315291_11347349 | Not Available | 572 | Open in IMG/M |
| 3300031758|Ga0315907_10246489 | Not Available | 1483 | Open in IMG/M |
| 3300031784|Ga0315899_10228624 | All Organisms → Viruses | 1864 | Open in IMG/M |
| 3300031857|Ga0315909_10819076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 586 | Open in IMG/M |
| 3300032050|Ga0315906_10010692 | All Organisms → Viruses | 10754 | Open in IMG/M |
| 3300032116|Ga0315903_10572701 | Not Available | 874 | Open in IMG/M |
| 3300033233|Ga0334722_10386419 | All Organisms → Viruses → Predicted Viral | 1012 | Open in IMG/M |
| 3300033978|Ga0334977_0586862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 500 | Open in IMG/M |
| 3300033994|Ga0334996_0016460 | All Organisms → Viruses → Predicted Viral | 4827 | Open in IMG/M |
| 3300033994|Ga0334996_0078652 | Not Available | 1969 | Open in IMG/M |
| 3300034101|Ga0335027_0074722 | All Organisms → Viruses → Predicted Viral | 2654 | Open in IMG/M |
| 3300034102|Ga0335029_0118340 | All Organisms → Viruses → Predicted Viral | 1849 | Open in IMG/M |
| 3300034106|Ga0335036_0831061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 531 | Open in IMG/M |
| 3300034112|Ga0335066_0069106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2300 | Open in IMG/M |
| 3300034112|Ga0335066_0650804 | Not Available | 538 | Open in IMG/M |
| 3300034116|Ga0335068_0305398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 791 | Open in IMG/M |
| 3300034272|Ga0335049_0591585 | Not Available | 690 | Open in IMG/M |
| 3300034374|Ga0348335_131198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 722 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 29.19% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 14.29% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.32% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 6.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.11% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.48% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.48% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.86% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.86% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.86% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.86% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.86% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.86% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.24% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.62% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.62% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.62% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.62% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.62% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.62% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001255 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300001843 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b | Environmental | Open in IMG/M |
| 3300001847 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a | Environmental | Open in IMG/M |
| 3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002144 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007625 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012967 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013125 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m | Environmental | Open in IMG/M |
| 3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
| 3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022221 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022223 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300024239 | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027155 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J13889_1007872 | 3300001255 | Freshwater | EHIKAYVKTGDDWHLSQAETLRKYVKDLKVWIHHQEGRE* |
| RCM34_10189591 | 3300001843 | Marine Plankton | NYVKTGDEWHLSQAEILRNYVKDLKVWIHKQEGWWNE* |
| RCM41_10099705 | 3300001847 | Marine Plankton | MKTGDYWHEEQAQLLRKYVKDLKVWIHKEEGWWNE* |
| RCM47_10742552 | 3300001848 | Marine Plankton | MSTSRHYVKTGDEWHLSQAEILRNYVKDLKVWIHKQEGRE* |
| GOS2236_10932643 | 3300001968 | Marine | METGDHWHEEQAQILRKYIKDLKVWIHKEEGWWNE* |
| M2t2BS2_105673701 | 3300002144 | Marine | DEHIRQHLKTGDEWHLSQAEILRTYVKDLKVWIHKKEGRE* |
| Ga0068876_100234386 | 3300005527 | Freshwater Lake | METGDFWHEEQAQILRKYVKDLKIWIHKQEGVWDE* |
| Ga0049081_102814011 | 3300005581 | Freshwater Lentic | RLHLETGNFWHEEQAQILRKYVKDLKIFIHKEEGWND* |
| Ga0079957_100638010 | 3300005805 | Lake | METGDFWHEEQAQILRKYVKDLKIWIHKQEGWWDE* |
| Ga0079957_10190981 | 3300005805 | Lake | IDNHTRLWMETGDYWHEDQANILRNYLRNLKNWIHEEEKK* |
| Ga0079957_10394052 | 3300005805 | Lake | MKTGDVWHEEQAELLRNYVKDLKVWIHKQEEWWDE* |
| Ga0099849_11388361 | 3300007539 | Aqueous | METGDSWHEEQAQILRKYIKDLKVWIHKEEGWWNE* |
| Ga0099848_10451282 | 3300007541 | Aqueous | MLWFETGDEWHLEQQKILRNYVKELKVWIHKQEGCWDE* |
| Ga0099848_11150301 | 3300007541 | Aqueous | EHVSLYLSTGDVWHLEQAAVLRCYVADLKTWIHGQEGKT* |
| Ga0099848_12180902 | 3300007541 | Aqueous | METGDSWHEEQAEILRKYVKDLKVWIHKQEGWWNE* |
| Ga0099848_12631271 | 3300007541 | Aqueous | IDNHTRLFMETGDFWHEEQAQILRKYVKDLKVWIHKQEGWWNE* |
| Ga0099846_11339141 | 3300007542 | Aqueous | NHTRLYFETGDFWHMEQADILRKYVKDLKVWIHKEEGWWDE* |
| Ga0102870_11196312 | 3300007625 | Estuarine | METGDIWHEEQAQILRKYVKDLKVWIHKEEGWWNE* |
| Ga0099850_10562242 | 3300007960 | Aqueous | MKTGDFWHEEQAQMLRKYIKDLKVWIHKEEGWWDE* |
| Ga0099850_10856502 | 3300007960 | Aqueous | METGDFWHMEQADILRKYVKDLKVWIHKEEGWWNE* |
| Ga0099850_12042751 | 3300007960 | Aqueous | IDNHTMLWFETGDEWHLEQQQILRKYVKDLKVWIHKQEGCWDE* |
| Ga0099850_12250511 | 3300007960 | Aqueous | HTRIGMQTGDPWHEEQAEILRKYVKDLKVWIHKEEGWWGE* |
| Ga0108970_104738649 | 3300008055 | Estuary | METGDIWHEEQAQILRKYVKDLKVWIHKQEGWWNE* |
| Ga0114340_11408711 | 3300008107 | Freshwater, Plankton | ETGDFWHEEQAQILRKYVKDLKVWIHKQEGWWNE* |
| Ga0114346_10780033 | 3300008113 | Freshwater, Plankton | MPREWKETGDFWHEEQAQILRKYVKDLKVWIHKQEGWWNE* |
| Ga0114337_12202352 | 3300008262 | Freshwater, Plankton | ETGDFWHEEQAQILRKYVKDLKVWIHKEEGWWNE* |
| Ga0114876_100386812 | 3300008448 | Freshwater Lake | METGDFWHEEQAQILRKYVKDLKVFIHKQEGWWDE* |
| Ga0114876_11183823 | 3300008448 | Freshwater Lake | METGDYWHEEQAQILRKYVKDLKVWIHKEEGVWDE* |
| Ga0114981_100456321 | 3300009160 | Freshwater Lake | HTRLHLETGDFWHEEQAQILRKYVKDLKVFIHKEEGRE* |
| Ga0114974_105023263 | 3300009183 | Freshwater Lake | DNHTRLHLETGDFWHEEQAQILRKYVKDLKVFIHKEEEWNE* |
| Ga0129342_10424214 | 3300010299 | Freshwater To Marine Saline Gradient | METGDLWHEEQAQMLRKYIKDLKVWIHKEEGWWDE* |
| Ga0129342_10884533 | 3300010299 | Freshwater To Marine Saline Gradient | METGDYWHEEQAQILREYVKNLKIWIHKEEGWWDE* |
| Ga0129342_10994571 | 3300010299 | Freshwater To Marine Saline Gradient | ETGDFWHEEQAEILRKYVKDLKVWIHKQEGWWDE* |
| Ga0129333_100217865 | 3300010354 | Freshwater To Marine Saline Gradient | METGDIWHEEQAQILRKYVRDLKVWIHKEEGWWNE* |
| Ga0129333_100751247 | 3300010354 | Freshwater To Marine Saline Gradient | METGDFWHEEQAQILRKYVKDLKVWIHKEEGWWNE* |
| Ga0129333_101794862 | 3300010354 | Freshwater To Marine Saline Gradient | METGDFWHEEQAQILRNYVKDLKVWIHKQEGWWDE* |
| Ga0129333_101877632 | 3300010354 | Freshwater To Marine Saline Gradient | MSTGDYWHEEQAEILRKYVKGLKVWIHKEEGWWDE* |
| Ga0129333_102932625 | 3300010354 | Freshwater To Marine Saline Gradient | METGDFWHEEQAQILRKYVKDLKVWIHKQEGVWNE* |
| Ga0129333_103352721 | 3300010354 | Freshwater To Marine Saline Gradient | NHTRLHMETGDFWHEQQAQILRNYVKDLKVWIHKQEGWWDE* |
| Ga0129333_103648271 | 3300010354 | Freshwater To Marine Saline Gradient | AYVKTGDDWHLSQAEILRKYVKDLKVWIHKQEGKE* |
| Ga0129333_104362151 | 3300010354 | Freshwater To Marine Saline Gradient | TRIWMDTGDYWHEQQAQILRKYVMDLKIWIHKEEGWWDE* |
| Ga0129333_104829032 | 3300010354 | Freshwater To Marine Saline Gradient | MMWFETGDEWHLQQQEILRKYVKDLKVWIHKQEGCWDE* |
| Ga0129333_105377924 | 3300010354 | Freshwater To Marine Saline Gradient | METGDFWHEEQAQILRKYVKDLKVFIHKQEGWWNE* |
| Ga0129333_108899163 | 3300010354 | Freshwater To Marine Saline Gradient | MQTGDFWHEEQAQILRKYVKDLKVWIHKEEGWWNE* |
| Ga0129333_109066071 | 3300010354 | Freshwater To Marine Saline Gradient | LHMETGDFWHEEQAQILRKYVKDLKVWIHKQEGWWDE* |
| Ga0129333_109456841 | 3300010354 | Freshwater To Marine Saline Gradient | ETGDFWHEEQAQILRKYVKDLKIWIHKEEGWWNE* |
| Ga0129333_109913681 | 3300010354 | Freshwater To Marine Saline Gradient | METGDFWHEEQAQILRKYVKDLKVWIHKQEGWWNE* |
| Ga0129333_116731001 | 3300010354 | Freshwater To Marine Saline Gradient | NHTRLKMETGDEWHEEQAQILRKYVKDLKVWIHKEEGWWNE* |
| Ga0129336_101273292 | 3300010370 | Freshwater To Marine Saline Gradient | METGDFWHEQQAQILRKYVKDLKVWIHKEEGWWDE* |
| Ga0129336_101764992 | 3300010370 | Freshwater To Marine Saline Gradient | MLWVETGDEWHLQQQEILRKYVKDLKVWIHKQEGCWNE* |
| Ga0129336_102678851 | 3300010370 | Freshwater To Marine Saline Gradient | EHIKAYVKTGDDWHLSQAEILRKYVKDLKVWIHKKEGWWDE* |
| Ga0129336_105927191 | 3300010370 | Freshwater To Marine Saline Gradient | IDNHTRLHMETGDFWHEEQAQILRKYVKDLKVWIHKQEGWWDE* |
| Ga0129336_106514554 | 3300010370 | Freshwater To Marine Saline Gradient | METGDFWHEEQANILRKYVKDLKVWIHKQEGWWDE* |
| Ga0151620_10063719 | 3300011268 | Freshwater | DNHTRLHMETGDFWHEEQAQILRKYVKDLKIWIHRQEGWWDE* |
| Ga0129343_14557952 | 3300012967 | Aqueous | METGDFWHMEQADILRKYVKDLKVWIHKEEGWWDE* |
| Ga0129337_11457893 | 3300012968 | Aqueous | METGDFWHEQQAQILRKYVKDLKVWIHKQEGWWDE* |
| Ga0129338_15017721 | 3300012970 | Aqueous | KKCLDAVDEHIKAYIKTGDEWHLSQAEILRKYVKDLKVWIHKEEGW* |
| Ga0163212_11061672 | 3300013087 | Freshwater | FYMKTGDTWHEEQAQILRKYVKDLKTWIHKQEGWWNE* |
| Ga0163212_12019901 | 3300013087 | Freshwater | IDHHTRFYMKTGDTWHEEQAQILRKYVKDLKTWIHKQEGW* |
| Ga0163212_12600902 | 3300013087 | Freshwater | MKTGDTWHEEQAQILRKYVKDLKIWIHKQEGWWNE* |
| (restricted) Ga0172369_102316732 | 3300013125 | Freshwater | METGDTWHEEQAQILRKYVKDLKIWIHKEEGWWNE* |
| (restricted) Ga0172366_103097893 | 3300013128 | Sediment | METGDFWHEEQAQILRKYVKDLKIWIHKEEGWWNE* |
| (restricted) Ga0172375_107053464 | 3300013137 | Freshwater | MKTGDPWHEEQAQILRKYVKDLKIWIHKEEGWWNE* |
| Ga0181356_10928501 | 3300017761 | Freshwater Lake | AIDNHTRLHLETGNFWHEEQAQILRTYVKELKVFIHEEERGQ |
| Ga0181357_10808131 | 3300017777 | Freshwater Lake | QILKAIDNHTRLHLETGNFWHEEQAQILRTYVLGLKVFIHKEEGWND |
| Ga0194113_102844822 | 3300020074 | Freshwater Lake | METGDFWHEEQAQILRKYVKDLKIWIHKQEGWWNE |
| Ga0194113_106002502 | 3300020074 | Freshwater Lake | AIDHHTRLYMETGDFWHEEQAQILRKYVKDLKTWIHKQEGW |
| Ga0194113_107315452 | 3300020074 | Freshwater Lake | METGDFWHEEQAQILRKYVKDLKVWIHKQEGWWNE |
| Ga0194111_103386511 | 3300020083 | Freshwater Lake | RLYLETGDPWHEEQAQILRKYIKDLKIWIHKEEGWWNE |
| Ga0194111_103598502 | 3300020083 | Freshwater Lake | METGDFWHEEQAQILRKYVKDLKIWIHKEEGWWNE |
| Ga0194110_100112651 | 3300020084 | Freshwater Lake | IDHHTRFYMKTGDPWHEEQAQILRKYVKDLKIWIHKQEGWWNE |
| Ga0194110_103219301 | 3300020084 | Freshwater Lake | LETGDTWHEEQAQILRKYIKDLKIWIHKEEGWWNE |
| Ga0194110_105652054 | 3300020084 | Freshwater Lake | AIDHHTRFYMKTGDPWHEEQAQILRKYVKDLKVWIHKKEGWWNE |
| Ga0194112_100139221 | 3300020109 | Freshwater Lake | HTRFYMKTGDPWHEEQAQILRKYVKDLKIWIHKQEGWWNE |
| Ga0194112_103480552 | 3300020109 | Freshwater Lake | MKTGDPWHEEQAQILRKYVKDLKIWIHKEEGWWNE |
| Ga0194112_104430511 | 3300020109 | Freshwater Lake | TRFYMKTGDPWHEEQAQILRKYIKDLKIWIHKEEGWWNE |
| Ga0211726_100975564 | 3300020161 | Freshwater | METGDYWHEEQAQMLREYVRDLKVWIHKQEGWWNE |
| Ga0211726_103975932 | 3300020161 | Freshwater | LFMETGDFWHEEQAQILRKYVKDLKVWIHKEEGWWNE |
| Ga0211729_106217732 | 3300020172 | Freshwater | METGDIWHEEQAQMLRKYVKDLKVWIHKEEGWWNE |
| Ga0194134_100012071 | 3300020179 | Freshwater Lake | RFYMKTGDPWHEEQAQILRKYVKDLKIWIHKQEGWWNE |
| Ga0194134_101615881 | 3300020179 | Freshwater Lake | DNHTRLYLETGDIWHEEQAQILRKYIKDLKIWIHKEEGWWNE |
| Ga0194134_102900631 | 3300020179 | Freshwater Lake | LKAIDHHTRFYMKTGDPWHEEQAQILRKYVKDLKVWIHKKEGWWNE |
| Ga0194115_100449026 | 3300020183 | Freshwater Lake | MKTGDTWHEEQAQILRKYVKDLKVWIHKQEGWWNE |
| Ga0194115_100688926 | 3300020183 | Freshwater Lake | MKTGDFWHEEQAQILRKYVKDLKTWIHKEEGWWNE |
| Ga0194115_101207473 | 3300020183 | Freshwater Lake | MKTGDPWHEEQAQILRKYVKDLKVWIHKQEGWWNE |
| Ga0194115_101602232 | 3300020183 | Freshwater Lake | METGDPWHEEQAQILRKYIKDLKIWIHKEEGWWNE |
| Ga0194115_104374721 | 3300020183 | Freshwater Lake | TRLYMETGDFWHEEQAQILRKYVKDLKIWIHKEEGWWNE |
| Ga0194118_101212334 | 3300020190 | Freshwater Lake | METGDFWHEEQAQILRKYIKDLKVWIHKEEGWWNE |
| Ga0194118_103224712 | 3300020190 | Freshwater Lake | AIDHHTRLYMETGDFWHEEQAQILRKYVKDLKTWIHKQEGWWNK |
| Ga0194118_104387012 | 3300020190 | Freshwater Lake | MKTGDTWHEEQAQILRKYVKDLKTWIHKQEGWWNE |
| Ga0194131_104509911 | 3300020193 | Freshwater Lake | HHTRFYMKTGDTWHEEQAQILRKYIKDLKIWIHKEEGWWNE |
| Ga0194128_102378931 | 3300020197 | Freshwater Lake | KAIDHHTRLYLETGDFWHEEQAQILRKYVKDLKVWIHKQEGWWDETTRR |
| Ga0194128_103806072 | 3300020197 | Freshwater Lake | METGDFWHEEQAQILRKYVKDLKTWIHKQEGWWNE |
| Ga0194120_102556492 | 3300020198 | Freshwater Lake | METGDFWHEEQAQILRKYVKDLKTWIHKQEGWWNK |
| Ga0194121_102589082 | 3300020200 | Freshwater Lake | RLYLETGDFWHEEQAQILRKYVKDLKVWIHKEEGW |
| Ga0194116_100012421 | 3300020204 | Freshwater Lake | YMKTGDPWHEEQAQILRKYVKDLKIWIHKQEGWWNE |
| Ga0194116_100685452 | 3300020204 | Freshwater Lake | MKTGDPWHEEQAQILRKYVKDLKIWIHKQEGWWNE |
| Ga0211731_110563882 | 3300020205 | Freshwater | DNHTRLFMETGDFWHEEQAQILRKYVKDLKVWIHKEEGWWKE |
| Ga0194132_102178961 | 3300020214 | Freshwater Lake | VDHHTRLYMETGDFWHEEQAQILRKYIKDLKVWIHKEEGWWNE |
| Ga0194132_103415744 | 3300020214 | Freshwater Lake | LYLETGDTWHEEQAQILRKYVKDLKIWIHKKEGWKL |
| Ga0194127_102713821 | 3300020221 | Freshwater Lake | HTRLYLETGDIWHEEQAQILRKYIKDLKIWIHKEEGWWNE |
| Ga0194129_106195452 | 3300020578 | Freshwater Lake | METGDTWHEEQAQILRKYIKDLKIWIHKQEGWWNE |
| Ga0194126_100058551 | 3300020603 | Freshwater Lake | TRFYMKTGDPWHEEQAQILRKYVKDLKIWIHKQEGWWNE |
| Ga0194133_102215521 | 3300021091 | Freshwater Lake | IHQILKAIDHHTRLWIETGDFWHEEQAQILRKYIKDLKIWIHKEEGW |
| Ga0194122_104406611 | 3300021092 | Freshwater Lake | KILKAIDHHTRFYMKTGDPWHEEQAQILRKYVKDLKVWIHKKEGWWNE |
| Ga0194123_101622084 | 3300021093 | Freshwater Lake | AIDHHTRFYMKTGDPWHEEQAQILRKYVKDLKVWIHKQEGW |
| Ga0194123_102170983 | 3300021093 | Freshwater Lake | AIDHHTRFYMKTGDPWHEEQAQILRKYVKDLKTWIHKQEGWWNE |
| Ga0194130_101982282 | 3300021376 | Freshwater Lake | METGDFWHEEQAQILRKYIKDLKIWIHKQEGWWNE |
| Ga0194130_103787112 | 3300021376 | Freshwater Lake | AIDHHTRLYMETGDFWHEEQAQILRKYVKDLKVWIHKQEGW |
| Ga0194130_106068471 | 3300021376 | Freshwater Lake | AIDHHTRFYMKTGDTWHEEQAQILRKYVKDLKTWIHKQEGW |
| Ga0194117_100596847 | 3300021424 | Freshwater Lake | RFYMKTGDPWHEEQAQILRKYVKDLKIWIHKEEGWWNE |
| Ga0194117_102295621 | 3300021424 | Freshwater Lake | HKILKAIDHHTRFYMKTGDPWHEEQAQILRKYIKDLKIWIHKEEGWWNE |
| Ga0194117_104755761 | 3300021424 | Freshwater Lake | RLYMETGDFWHEEQAQILRKYVKDLKVWIHKQEGWWNE |
| Ga0194117_105005012 | 3300021424 | Freshwater Lake | RLYLETGDTWHEEQAQILRKYIKDLKIWIHKEEGWWNE |
| Ga0222716_101818523 | 3300021959 | Estuarine Water | METGDFWHEEQAQILREYVKNLKIWIHKEEGWFDE |
| Ga0222715_101670041 | 3300021960 | Estuarine Water | RLWMETGDYWHEEQAQILRKYVKDLKVWIHRQEGK |
| Ga0222714_1000809111 | 3300021961 | Estuarine Water | METGDFWHEEQAQILRKYVKDLKVWIHKQEGWWDE |
| Ga0222714_1000815619 | 3300021961 | Estuarine Water | MKTGDYWHEEQAQMLRKYVKDLKVWIHKEEGWWNE |
| Ga0222714_101064671 | 3300021961 | Estuarine Water | IDNHTRLHMETGDFWHEEQAQILRKYVKDLKIWIHKQEGWWDE |
| Ga0222714_102432683 | 3300021961 | Estuarine Water | METGDIWHEEQAQILRKYVKDLKVWIHKQEGWWNE |
| Ga0222714_104008253 | 3300021961 | Estuarine Water | IDNHTRLFMETGDFWHQEQSEILRKYVKDLKVWIHKEEGWWNE |
| Ga0222713_101618494 | 3300021962 | Estuarine Water | METGDFWHEEQAQILRKYVKDLKIWIHKQEGWWDE |
| Ga0222713_107822951 | 3300021962 | Estuarine Water | IDNHTRLFLETGDFWHQEQADILRKYIKDLKVWIHKEEGWWNE |
| Ga0222713_108067173 | 3300021962 | Estuarine Water | IDNHTRLHLETGDFWHEEQAQILRKYVKELKVFIHKEEGR |
| Ga0222712_10000153172 | 3300021963 | Estuarine Water | METGDFWHEEQAQILREYVKNLKIWIHKEEGWWDE |
| Ga0196905_11849302 | 3300022198 | Aqueous | METGDLWHEEQAQMLRKYIKDLKVWIHKEEGWWDE |
| Ga0196901_11365911 | 3300022200 | Aqueous | AIDNHTRLWMETGDFWHEEQAQILRKYVKDLKVFIHKQEGWWDE |
| Ga0196901_11664632 | 3300022200 | Aqueous | METGDSWHEDQAEILRKYVKDLKVWIHKQEGWWNE |
| Ga0224506_104306874 | 3300022221 | Sediment | FLETGDFWHQEQADILRKYIKDLKVWIHKEEGWWNE |
| Ga0224501_102796083 | 3300022223 | Sediment | METGDMWHEEQANILRKYIKDLKVWIHKQEGWWDE |
| Ga0247724_10259601 | 3300024239 | Deep Subsurface Sediment | KNYVKTGDNWHLSQAEILRKYVKDLKIWIHRQEGR |
| Ga0244777_104368602 | 3300024343 | Estuarine | METGDIWHEEQAQILRKYVKDLKVWIHKEEGWWNE |
| Ga0255141_10366771 | 3300024351 | Freshwater | DNHTRLFMETGDYWHEEQAQMLRKYVKDLKVWIHKQEGWWDE |
| Ga0255090_10508431 | 3300027123 | Freshwater | CLDAVDEHTRQHMKTGDEWHLSQAEILRKYVKDLKVWIHKEEGWWNE |
| Ga0255081_10841541 | 3300027155 | Freshwater | LDAVDEHTRQHMKTGDEWHLSQAEILRKYVKDLKVWIHHQEGRE |
| Ga0209189_11214721 | 3300027747 | Freshwater Lake | DNHTDIYIKTGDTWHEEQAKYLRQYVYNLKDWIISQEN |
| Ga0209500_102625231 | 3300027782 | Freshwater Lake | DNHTDIYIKTGDTWHEEQAKYLRQYVYRLKDWIISQEN |
| Ga0209107_104908321 | 3300027797 | Freshwater And Sediment | HIKNYTKTGDEWHLSQAEVLRKYVKDLKIWIHKQEGR |
| Ga0209990_1000648716 | 3300027816 | Freshwater Lake | METGDFWHEEQAQILRKYVKDLKIWIHKQEGVWDE |
| Ga0119944_10187443 | 3300029930 | Aquatic | AVDEHTRQHMQTGDEWHISQAEILRKYVKDLKVWIHKQEGWWNE |
| Ga0119944_10363342 | 3300029930 | Aquatic | LDAVDTHMKLHLETQDDWHLSQAEILRKYVKDLKVWIHKQEGWWDE |
| Ga0119944_10417402 | 3300029930 | Aquatic | HMRQHLKTGDEWHLSKAEILRKYVKDLKVWIHKQEGWWDE |
| Ga0307380_106890492 | 3300031539 | Soil | RLYIETGDVWHEEQAQILRKYIKDVKIWIHKEENWEL |
| Ga0315291_113473493 | 3300031707 | Sediment | TRLHLETGNFWHEEQAQILRTYVKELKVFIHKEERGQ |
| Ga0315907_102464891 | 3300031758 | Freshwater | RLWMETGDFWHEEQAQILRNYVKNLKVWIHKEEGWWDE |
| Ga0315899_102286241 | 3300031784 | Freshwater | AVDEHVKAYIKTGDDWHLSQAEILRKYVKDLKVWIHKEEGR |
| Ga0315909_108190761 | 3300031857 | Freshwater | METGDFWHEEQAQMLRKYIKDLKVWIHKEEGWWDE |
| Ga0315906_1001069213 | 3300032050 | Freshwater | METGDFWHEEQAQILRKYVKDLKVWIHKEEGWWNE |
| Ga0315903_105727012 | 3300032116 | Freshwater | TRLHMETGDFWHEEQAQILRKYVKDLKVWIHKEEGWWNE |
| Ga0334722_103864194 | 3300033233 | Sediment | HTRLHLETGNFWHEEQAQILRTYVKELKVFIHKEERGQ |
| Ga0334977_0586862_107_214 | 3300033978 | Freshwater | METGDFWHEEQSQILRKYVKDLKVWIHKQEGWWDE |
| Ga0334996_0016460_49_156 | 3300033994 | Freshwater | METGDIWHEEQAQILRKYVRDLKVWIHKEEGWWNE |
| Ga0334996_0078652_1856_1963 | 3300033994 | Freshwater | METGNFWHEEQAQMLRKYVKDLKVWIHKEEGWWNE |
| Ga0335027_0074722_2512_2625 | 3300034101 | Freshwater | MRKHIKTGDDWHILQAEILRKYVKDLKVWIHKQEGRE |
| Ga0335029_0118340_934_1041 | 3300034102 | Freshwater | METGDYWHEEQAQILRKYVKDLKVWIHKQEGVWNE |
| Ga0335036_0831061_94_201 | 3300034106 | Freshwater | METGDFWHEEQAQILRKYVKDLKVWIHKQEGVWNE |
| Ga0335066_0069106_8_127 | 3300034112 | Freshwater | MRLHLKTGDDWHLSQAETLRNYVKELKVWIHKQEGWWNE |
| Ga0335066_0650804_1_117 | 3300034112 | Freshwater | RLYFETGDFWHEEQAQILRKYVKDLKVWIHKQEGRWDE |
| Ga0335068_0305398_423_530 | 3300034116 | Freshwater | METGDFWHEQQAQILRKYVKDLKVWIHKQEGWWDE |
| Ga0335049_0591585_287_394 | 3300034272 | Freshwater | METGDYWHEEQAQILRNYVMDLKVWIHKQEGWWDE |
| Ga0348335_131198_401_508 | 3300034374 | Aqueous | METGDFWHHEQAEILRKYVKDLKVWIHKEEGWWNE |
| ⦗Top⦘ |