


| Basic Information | |
|---|---|
| Family ID | F040351 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 162 |
| Average Sequence Length | 47 residues |
| Representative Sequence | CEAGLGGNTPEDEMRVFPDFLKKIRKRMAPWGVSIPMFDHPRLGKV |
| Number of Associated Samples | 139 |
| Number of Associated Scaffolds | 162 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.62 % |
| % of genes near scaffold ends (potentially truncated) | 98.77 % |
| % of genes from short scaffolds (< 2000 bps) | 88.89 % |
| Associated GOLD sequencing projects | 128 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.765 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.580 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.543 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.741 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.73% β-sheet: 5.41% Coil/Unstructured: 64.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 162 Family Scaffolds |
|---|---|---|
| PF02738 | MoCoBD_1 | 24.69 |
| PF01315 | Ald_Xan_dh_C | 24.07 |
| PF00941 | FAD_binding_5 | 13.58 |
| PF03450 | CO_deh_flav_C | 6.79 |
| PF13478 | XdhC_C | 2.47 |
| PF05685 | Uma2 | 1.85 |
| PF00501 | AMP-binding | 1.23 |
| PF04607 | RelA_SpoT | 1.23 |
| PF00005 | ABC_tran | 1.23 |
| PF01799 | Fer2_2 | 1.23 |
| PF01882 | DUF58 | 0.62 |
| PF02604 | PhdYeFM_antitox | 0.62 |
| PF00497 | SBP_bac_3 | 0.62 |
| PF06325 | PrmA | 0.62 |
| PF12399 | BCA_ABC_TP_C | 0.62 |
| PF01740 | STAS | 0.62 |
| PF00111 | Fer2 | 0.62 |
| PF06348 | DUF1059 | 0.62 |
| PF13607 | Succ_CoA_lig | 0.62 |
| PF07589 | PEP-CTERM | 0.62 |
| PF04116 | FA_hydroxylase | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 162 Family Scaffolds |
|---|---|---|---|
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 1.85 |
| COG1721 | Uncharacterized conserved protein, DUF58 family, contains vWF domain | Function unknown [S] | 0.62 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.62 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.62 |
| COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.77 % |
| Unclassified | root | N/A | 1.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100211683 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 553 | Open in IMG/M |
| 3300000955|JGI1027J12803_108169195 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 525 | Open in IMG/M |
| 3300002560|JGI25383J37093_10008271 | All Organisms → cellular organisms → Bacteria | 3375 | Open in IMG/M |
| 3300002908|JGI25382J43887_10476409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300004114|Ga0062593_101102360 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 824 | Open in IMG/M |
| 3300005093|Ga0062594_102968019 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005166|Ga0066674_10274287 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300005172|Ga0066683_10251820 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1095 | Open in IMG/M |
| 3300005183|Ga0068993_10397641 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 508 | Open in IMG/M |
| 3300005341|Ga0070691_10509817 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005347|Ga0070668_101037004 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300005353|Ga0070669_101843985 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300005355|Ga0070671_100941744 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300005438|Ga0070701_10267226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1039 | Open in IMG/M |
| 3300005447|Ga0066689_10358572 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 910 | Open in IMG/M |
| 3300005450|Ga0066682_10441617 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 828 | Open in IMG/M |
| 3300005467|Ga0070706_100996977 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300005468|Ga0070707_100376826 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300005471|Ga0070698_100651440 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300005471|Ga0070698_101049308 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300005518|Ga0070699_100294708 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
| 3300005536|Ga0070697_100013271 | All Organisms → cellular organisms → Bacteria | 6462 | Open in IMG/M |
| 3300005540|Ga0066697_10180362 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1253 | Open in IMG/M |
| 3300005547|Ga0070693_101583591 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005555|Ga0066692_10288508 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300005556|Ga0066707_10480706 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 806 | Open in IMG/M |
| 3300005617|Ga0068859_101341535 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300005618|Ga0068864_101166829 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300005718|Ga0068866_10424745 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300005719|Ga0068861_100348917 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300005764|Ga0066903_100088074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4104 | Open in IMG/M |
| 3300005764|Ga0066903_104162639 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300005876|Ga0075300_1046904 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300006031|Ga0066651_10018355 | All Organisms → cellular organisms → Bacteria | 2973 | Open in IMG/M |
| 3300006034|Ga0066656_11033935 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300006163|Ga0070715_11023005 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300006354|Ga0075021_10161603 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300006755|Ga0079222_10014642 | All Organisms → cellular organisms → Bacteria | 2972 | Open in IMG/M |
| 3300006844|Ga0075428_100255311 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
| 3300006845|Ga0075421_100919783 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 997 | Open in IMG/M |
| 3300006847|Ga0075431_100165083 | All Organisms → cellular organisms → Bacteria | 2276 | Open in IMG/M |
| 3300006852|Ga0075433_10997268 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300006903|Ga0075426_10075923 | All Organisms → cellular organisms → Bacteria | 2400 | Open in IMG/M |
| 3300006969|Ga0075419_11096704 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 583 | Open in IMG/M |
| 3300007258|Ga0099793_10000492 | All Organisms → cellular organisms → Bacteria | 10760 | Open in IMG/M |
| 3300009012|Ga0066710_103078348 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 646 | Open in IMG/M |
| 3300009012|Ga0066710_104293634 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 532 | Open in IMG/M |
| 3300009090|Ga0099827_10537498 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300009090|Ga0099827_10705771 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300009092|Ga0105250_10563644 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 524 | Open in IMG/M |
| 3300009100|Ga0075418_10419923 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300009100|Ga0075418_10928852 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300009148|Ga0105243_12483404 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300010043|Ga0126380_10672579 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 828 | Open in IMG/M |
| 3300010046|Ga0126384_10062846 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2608 | Open in IMG/M |
| 3300010046|Ga0126384_10075681 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2406 | Open in IMG/M |
| 3300010046|Ga0126384_10179019 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1660 | Open in IMG/M |
| 3300010046|Ga0126384_11442640 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300010046|Ga0126384_11709819 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 595 | Open in IMG/M |
| 3300010093|Ga0127490_1027606 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300010111|Ga0127491_1032868 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300010134|Ga0127484_1133832 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300010141|Ga0127499_1083627 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300010301|Ga0134070_10244142 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 670 | Open in IMG/M |
| 3300010303|Ga0134082_10219899 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300010322|Ga0134084_10437254 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 518 | Open in IMG/M |
| 3300010360|Ga0126372_12255842 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 594 | Open in IMG/M |
| 3300010361|Ga0126378_10476100 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300010362|Ga0126377_11884692 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 674 | Open in IMG/M |
| 3300010376|Ga0126381_100906930 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1269 | Open in IMG/M |
| 3300010376|Ga0126381_104518928 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 537 | Open in IMG/M |
| 3300010391|Ga0136847_12339998 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300010399|Ga0134127_10478176 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1252 | Open in IMG/M |
| 3300010905|Ga0138112_1106228 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300011270|Ga0137391_10174656 | All Organisms → cellular organisms → Bacteria | 1872 | Open in IMG/M |
| 3300012199|Ga0137383_10129940 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300012211|Ga0137377_10071420 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3252 | Open in IMG/M |
| 3300012349|Ga0137387_11123758 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 559 | Open in IMG/M |
| 3300012359|Ga0137385_10092162 | All Organisms → cellular organisms → Bacteria | 2687 | Open in IMG/M |
| 3300012363|Ga0137390_11398999 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300012403|Ga0134049_1077805 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300012532|Ga0137373_10486998 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300012582|Ga0137358_10661889 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 699 | Open in IMG/M |
| 3300012685|Ga0137397_10165295 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300012903|Ga0157289_10203343 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300012922|Ga0137394_10278924 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300012922|Ga0137394_10885319 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 746 | Open in IMG/M |
| 3300012925|Ga0137419_11309921 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300012925|Ga0137419_11761202 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 529 | Open in IMG/M |
| 3300012927|Ga0137416_10413056 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1146 | Open in IMG/M |
| 3300012927|Ga0137416_11602563 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300012930|Ga0137407_10532841 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1099 | Open in IMG/M |
| 3300012930|Ga0137407_12201743 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 527 | Open in IMG/M |
| 3300012931|Ga0153915_10401783 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300014154|Ga0134075_10233082 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 795 | Open in IMG/M |
| 3300014262|Ga0075301_1174156 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 514 | Open in IMG/M |
| 3300014969|Ga0157376_12070501 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 607 | Open in IMG/M |
| 3300015201|Ga0173478_10467366 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 623 | Open in IMG/M |
| 3300015241|Ga0137418_11221575 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 528 | Open in IMG/M |
| 3300015357|Ga0134072_10322440 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 583 | Open in IMG/M |
| 3300015374|Ga0132255_100986103 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300015374|Ga0132255_105016221 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 560 | Open in IMG/M |
| 3300015374|Ga0132255_105244191 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 549 | Open in IMG/M |
| 3300016422|Ga0182039_12279507 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 500 | Open in IMG/M |
| 3300017654|Ga0134069_1384209 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 507 | Open in IMG/M |
| 3300017959|Ga0187779_10619447 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 726 | Open in IMG/M |
| 3300018056|Ga0184623_10486894 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300018075|Ga0184632_10269204 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300018468|Ga0066662_10989444 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300018482|Ga0066669_11801820 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 566 | Open in IMG/M |
| 3300022756|Ga0222622_10821833 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300025903|Ga0207680_11281047 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 521 | Open in IMG/M |
| 3300025910|Ga0207684_10344067 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1284 | Open in IMG/M |
| 3300025912|Ga0207707_10839479 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300025922|Ga0207646_10989032 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 744 | Open in IMG/M |
| 3300025938|Ga0207704_11565070 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 566 | Open in IMG/M |
| 3300025972|Ga0207668_10766743 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300026011|Ga0208532_1007691 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300026095|Ga0207676_11729436 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300026118|Ga0207675_100488218 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300026118|Ga0207675_102204008 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 566 | Open in IMG/M |
| 3300026296|Ga0209235_1131970 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1030 | Open in IMG/M |
| 3300026296|Ga0209235_1220769 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300026297|Ga0209237_1167556 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 805 | Open in IMG/M |
| 3300026298|Ga0209236_1082454 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300026326|Ga0209801_1020099 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3287 | Open in IMG/M |
| 3300026329|Ga0209375_1117150 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300026355|Ga0257149_1008631 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300026496|Ga0257157_1017674 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300027651|Ga0209217_1176127 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300027787|Ga0209074_10505111 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300027846|Ga0209180_10241829 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1039 | Open in IMG/M |
| 3300027874|Ga0209465_10241927 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 902 | Open in IMG/M |
| 3300027894|Ga0209068_10123331 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300028381|Ga0268264_10027613 | All Organisms → cellular organisms → Bacteria | 4640 | Open in IMG/M |
| 3300028381|Ga0268264_10825891 | Not Available | 927 | Open in IMG/M |
| 3300028592|Ga0247822_11870805 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300028597|Ga0247820_10125350 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1582 | Open in IMG/M |
| 3300028608|Ga0247819_10400492 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 792 | Open in IMG/M |
| 3300028812|Ga0247825_10784522 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300031199|Ga0307495_10251485 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031564|Ga0318573_10544315 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 625 | Open in IMG/M |
| 3300031680|Ga0318574_10013388 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3810 | Open in IMG/M |
| 3300031680|Ga0318574_10029568 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2757 | Open in IMG/M |
| 3300031713|Ga0318496_10013078 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3977 | Open in IMG/M |
| 3300031720|Ga0307469_12221514 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300031740|Ga0307468_100975379 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 743 | Open in IMG/M |
| 3300031740|Ga0307468_102140619 | Not Available | 540 | Open in IMG/M |
| 3300031754|Ga0307475_11034640 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300031819|Ga0318568_10709517 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 625 | Open in IMG/M |
| 3300031820|Ga0307473_10368356 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300031944|Ga0310884_10768470 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 587 | Open in IMG/M |
| 3300031959|Ga0318530_10334467 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300032001|Ga0306922_10418342 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300032075|Ga0310890_10328485 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300032089|Ga0318525_10014304 | All Organisms → cellular organisms → Bacteria | 3659 | Open in IMG/M |
| 3300032174|Ga0307470_10407723 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 963 | Open in IMG/M |
| 3300032180|Ga0307471_100516805 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300032180|Ga0307471_101605849 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 806 | Open in IMG/M |
| 3300032180|Ga0307471_101839456 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300032205|Ga0307472_101762313 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 614 | Open in IMG/M |
| 3300033550|Ga0247829_10677934 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 858 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.02% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.41% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.85% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.23% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.23% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.23% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.23% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.62% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.62% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.62% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.62% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.62% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.62% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.62% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010093 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010111 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010905 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026011 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1002116831 | 3300000364 | Soil | DADRISCEAGLGGSTPEDEMRVFPEFLGKIRKRMAPWGVNIPFFDHPRLGRV* |
| JGI1027J12803_1081691952 | 3300000955 | Soil | GTCQRVFPEFLRKIRKRMAPWGVNIPFFDHSRLGHV* |
| JGI25383J37093_100082714 | 3300002560 | Grasslands Soil | GSATPAEIDADRISCEAGLGGNTPEDEMTVFPEFLKKIRKRMAPWGVNLPMFDHPRLGKV |
| JGI25382J43887_104764092 | 3300002908 | Grasslands Soil | AEIDADRISCEAGLGGNTPEDEMTVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV* |
| Ga0062593_1011023601 | 3300004114 | Soil | ADEIACAAGLGASTPEDEMRVFPQFLAKMRARMGPWGVTIPTFDHPKLGKV* |
| Ga0062594_1029680191 | 3300005093 | Soil | AEIDADRISCEAGLGGSTPEDEMRVFPEFLGKIRKRMAPWGVNIPFFDHPRLGRV* |
| Ga0066674_102742872 | 3300005166 | Soil | GNTPEDEMRVFPEFLAKIRKRMAPWGVNLPMFEHPRLGTV* |
| Ga0066683_102518202 | 3300005172 | Soil | GLGGNTPEDEMTVFPEFLKKIRRRMAPWGVSIPMFDHPRLGKV* |
| Ga0068993_103976411 | 3300005183 | Natural And Restored Wetlands | VSCEAGLGGSTPEDEMRVFPDFLRKIRARMAPWGVTIPLFDHPRLGRV* |
| Ga0070691_105098171 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | ATPLEIDADRVACEAGLGGTTPEDEMRIVPQFIAKIRARMAPWGVTLPMFDHPKLGKV* |
| Ga0070668_1010370041 | 3300005347 | Switchgrass Rhizosphere | EIDADRISCEAGLGGSTPEDEMRVFPEFLGKIRKRMAPWGVNIPFFDHPRLGRV* |
| Ga0070669_1018439851 | 3300005353 | Switchgrass Rhizosphere | ADRISCEAGLGGSTPEDEMAVFPEFLTKIRKRMAPYGVTLPLFDHPRLGKV* |
| Ga0070671_1009417441 | 3300005355 | Switchgrass Rhizosphere | TPAEIDADRISCEAGLGGNTPEDEMQIFPGFLAKIRKRMAPWGVKIPMFDHPRLGTV* |
| Ga0070701_102672261 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | GLGGSTPEDEMAVFPEFLTKIRKRMAPYGVTLPLFDHPRLGKV* |
| Ga0066689_103585722 | 3300005447 | Soil | GGSTPEDEMAIFPEFLKKIRKRMTPYGVQLKLFDHPRLGKV* |
| Ga0066682_104416172 | 3300005450 | Soil | GSTPEDEMRIFPEFLRKIRQRMAPWGVDIPLFDHPHLGRV* |
| Ga0070706_1009969772 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | CEAGLGGTTPEDEMRIVPQFIKKIRARMAPWGVDLPLFDHPKLGKV* |
| Ga0070707_1003768261 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AEIDADRISCEAGLGGNTPEDEMEVFPEFLKKIRKRMAPWGVNLPMFDHPRLGTV* |
| Ga0070698_1006514402 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | AGLGGTTPEDEMRIVPQFIKKIRARMAPWGVNLPMFDHPKLGKV* |
| Ga0070698_1010493081 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TTPEDEMRVVPQFIAKIRARMAPWGVELPMFDHPKLGRV* |
| Ga0070699_1002947081 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GGTTPEDEMQIVPQFVRKIRARMVPWGVKLPMFSHPKLGQI* |
| Ga0070697_1000132711 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EIDADRISCEAGLGGNTPEDEMTVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV* |
| Ga0066697_101803621 | 3300005540 | Soil | ISCEAGLGGNTPEDEMMVFPEFLKKIRKRMAPWGVNLPMFDHPRLGKV* |
| Ga0070693_1015835912 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | GLGGTTPEDEMRVVPQFIAKIRARMAPWGVALPMFDHPKLGRV* |
| Ga0066692_102885081 | 3300005555 | Soil | EIDADRISCEAGLGGNTPEDEMRVFPDFLKKIRTRMAPWGVSIPVFDHPRLGKV* |
| Ga0066707_104807062 | 3300005556 | Soil | DEMRIFPEFLRKIRQRMAPWGVDIPLFDHPHLGRV* |
| Ga0068859_1013415352 | 3300005617 | Switchgrass Rhizosphere | LGGTTPEDEMRVVPQFIAKIRARMAPWGVELPMFDHPKLGRV* |
| Ga0068864_1011668292 | 3300005618 | Switchgrass Rhizosphere | EDEMRVVPQFIAKIRARMAPWGVALPMFDHPKLGRV* |
| Ga0068866_104247451 | 3300005718 | Miscanthus Rhizosphere | EIDADRVACEAGLGGTTPEDEMRIVPQFIKKIRARMAPWGVNLPMFDHPKLGKV* |
| Ga0068861_1003489171 | 3300005719 | Switchgrass Rhizosphere | ADRISCEAGLGGNTPEDEMQVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV* |
| Ga0066903_1000880741 | 3300005764 | Tropical Forest Soil | SATPAEIDADRISCEAGLGGNTPEDEMRVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV* |
| Ga0066903_1041626391 | 3300005764 | Tropical Forest Soil | SATPAEIDADRISCEAGLGGNTPEDEMRVFPEFLRKIRKRMAPWGVNIPLFDHPRLGKV* |
| Ga0075300_10469041 | 3300005876 | Rice Paddy Soil | CEAGLGGTTPEDEMRIVPGFIAKIRARMAPWGVKLPMFDHPKLGKV* |
| Ga0066651_100183553 | 3300006031 | Soil | AEIDADRISCEAGLGGNTPEDEMRVFPEFLAKIRKRMAPWGVNLPMFEHPRLGTV* |
| Ga0066656_110339351 | 3300006034 | Soil | ISCEAGLGGSTPEDEMQVFPAFVQKIRARMQPWGVTIPMFAHPRLGKI* |
| Ga0070715_110230051 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | EAGLGGTTPEDEMRIVPQFIKKIRARMAPWGVNLPLFDHPKLGKV* |
| Ga0075021_101616031 | 3300006354 | Watersheds | TTPEDEMRIVPQFIKKIRARMAPWGVNLPLFDHPKLGKV* |
| Ga0079222_100146421 | 3300006755 | Agricultural Soil | TPLEIDADRVACEAGLGGTTPEDEMRIVPQFIKKIRARMAPWGVELPMFDHPKLGKV* |
| Ga0075428_1002553113 | 3300006844 | Populus Rhizosphere | EAGLGGNTPEDEVAVFPEFLRKIRTRMAPWGVNLPMFDHPRLGKV* |
| Ga0075421_1009197832 | 3300006845 | Populus Rhizosphere | CEAGLGGSTPEDEMRVFPDFLAKIRKRMAPWGVTLPYFEHPRLGRM* |
| Ga0075431_1001650831 | 3300006847 | Populus Rhizosphere | EDEVAVFPEFLRKIRTRMAPWGVNLPMFDHPRLGKV* |
| Ga0075433_109972682 | 3300006852 | Populus Rhizosphere | GSATPAEIDADRISCEAGLGGNTPEDEMRVFPDFLRKIRKRMAPWGVNIPMFEHPRLGKV |
| Ga0075426_100759231 | 3300006903 | Populus Rhizosphere | PLEIDADRVACEAGLGGTTPEDEMRIVPQFIKKIRARMAPWGVELPMFDHPKLGKV* |
| Ga0075419_110967042 | 3300006969 | Populus Rhizosphere | AGLGGSTPEDETRVFPTFLAKIRRRMSPWGVTLPMFDHPRLGKV* |
| Ga0099793_100004921 | 3300007258 | Vadose Zone Soil | EIDADRISCEAGLGGNTPEDEMAVFPEFLRKIRKRMAPWGVDIPMFDHPRMGKV* |
| Ga0066710_1030783482 | 3300009012 | Grasslands Soil | GLGGNTPEDEMRVFPEFLAKIRKRMAPWGVNLPMFEHPRLGTV |
| Ga0066710_1042936342 | 3300009012 | Grasslands Soil | MLRGVDPPRADRIACEAGLGGSTPEDETRVFPQFLAKIRARMAPWGVAIPTFEHPRLGKI |
| Ga0099827_105374982 | 3300009090 | Vadose Zone Soil | EIEADRIACEAGLGGSTPDDEMAVFPEFLAKIRARMAPWGVRMPDFEHPKLGRV* |
| Ga0099827_107057712 | 3300009090 | Vadose Zone Soil | ACEAGLGGTTPEDEMQIVPQFVRKIRARMIPWGVKLPMFSHPKLGQI* |
| Ga0105250_105636441 | 3300009092 | Switchgrass Rhizosphere | GLGGSTPEDEMQIFPAFLAKIRKRMAPYGVNIRLFDHPRLGKV* |
| Ga0075418_104199235 | 3300009100 | Populus Rhizosphere | EDEMRVFPEFLGKIRKRMAPWGVSIPFFDHPRLGRV* |
| Ga0075418_109288521 | 3300009100 | Populus Rhizosphere | EIDADRISCEAGLGGNTPEDEMRVFPEFLAKIRKRMAPWGVNIPMFDHPRLGKV* |
| Ga0105243_124834042 | 3300009148 | Miscanthus Rhizosphere | LGGTTPEDEMRIVPQFIKKIRARMAPWGVNLPMFDHPKLGKV* |
| Ga0126380_106725791 | 3300010043 | Tropical Forest Soil | ADRISCEAGLGGSTPEDEIRVFPQFLAKIRARMAPWGVNLPLYDHPRLGRI* |
| Ga0126384_100628462 | 3300010046 | Tropical Forest Soil | CEAGLGGNTPEDEMRVFPEFLRKIRKRMAPWGVNIPLFDHPRLGKV* |
| Ga0126384_100756812 | 3300010046 | Tropical Forest Soil | DEMRVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV* |
| Ga0126384_101790191 | 3300010046 | Tropical Forest Soil | DEMRVFPEFLRKIRKRMAPWGVNIPLFVHPRLGKV* |
| Ga0126384_114426402 | 3300010046 | Tropical Forest Soil | AEIDADRISCEAGLGGNTPEDEMRVFPEFLRKIRKRMAPWGVNIPMFQHPRLGQV* |
| Ga0126384_117098192 | 3300010046 | Tropical Forest Soil | GLGGSTPEDEMRVFPDFLKKIRKRMAPWGVAIPLFDHPRLGRV* |
| Ga0127490_10276061 | 3300010093 | Grasslands Soil | SATPAEIDADRISCEAGLGGNTPEDEMTVFPEFLKKIRRRMAPWGVSIPMFDHPLLGKV* |
| Ga0127491_10328681 | 3300010111 | Grasslands Soil | GLGGNTPEDEMTVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV* |
| Ga0127484_11338321 | 3300010134 | Grasslands Soil | DADRISCEAGLGGNTPEDEMTVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV* |
| Ga0127499_10836272 | 3300010141 | Grasslands Soil | EIDADRISCEAGLGGNTPADEMTVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV* |
| Ga0134070_102441421 | 3300010301 | Grasslands Soil | DRISCEAGLGGNTPEDEMTVFPEFLKKIRRRMAPWGVSIPMFDHPRLGKV* |
| Ga0134082_102198991 | 3300010303 | Grasslands Soil | TPAEIDADRISCEAGLGGNTPEDEMRVFPDFLKKIRKRMAPWGVSIPMFDHPRLGKV* |
| Ga0134084_104372542 | 3300010322 | Grasslands Soil | DRTSCEAGLGGNTPEDEMSVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV* |
| Ga0126372_122558421 | 3300010360 | Tropical Forest Soil | DRISCEAGLGGNTPEDEMQVFPEFLRKIRTRMAPWGVSLPMFDHPRLGKV* |
| Ga0126378_104761001 | 3300010361 | Tropical Forest Soil | AEIDADRISCEAGLGGNTPEDEMRVFPEFLRKIRKRMAPWGVNIPLFDHPRLGKV* |
| Ga0126377_118846921 | 3300010362 | Tropical Forest Soil | CEAGLGGNTPEDEMRVFPEFLRKIRNRMAPWGVTIPLFDHPRLGKV* |
| Ga0126381_1009069301 | 3300010376 | Tropical Forest Soil | DEMRVFPEFLRKIRKRMAPWGVTIPLFDHPRLGRV* |
| Ga0126381_1045189282 | 3300010376 | Tropical Forest Soil | CEAGLGGNTPDDEMRVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV* |
| Ga0136847_123399982 | 3300010391 | Freshwater Sediment | PAEVDADRISCEAGLGGSTPEDEMRVFPQFLAKIRARMAPWGVRIPMFDHPRLGKI* |
| Ga0134127_104781761 | 3300010399 | Terrestrial Soil | TPEDEMRVFPDFLKKIRKRMAPWGVGIPMFEHPRLGKV* |
| Ga0138112_11062281 | 3300010905 | Grasslands Soil | GNTPEDEMTVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV* |
| Ga0137391_101746564 | 3300011270 | Vadose Zone Soil | EDEMRIVPQFIKKIRARMEPWGVKLPLFDHPKLGKV* |
| Ga0137383_101299401 | 3300012199 | Vadose Zone Soil | EMTVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV* |
| Ga0137377_100714201 | 3300012211 | Vadose Zone Soil | SCEAGLGGNTPEDEMRVFPDFLKKIRTRMAPWGVSIPMFDHPRLGKV* |
| Ga0137387_111237582 | 3300012349 | Vadose Zone Soil | DADRVACEAGLGGTTPEDEMRVVPEFIKKIRARMAPWGVELPMFDHPKLGRV* |
| Ga0137385_100921624 | 3300012359 | Vadose Zone Soil | AEIDADRISCEAGLGGNTTEDEMTVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV* |
| Ga0137390_113989992 | 3300012363 | Vadose Zone Soil | GGTTPEDEMQIVPQFVRKIRARMIPWGVKLPMFSHPKLGQI* |
| Ga0134049_10778051 | 3300012403 | Grasslands Soil | ATPAETDADRISCEAGLGGNTPEDEMTVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV* |
| Ga0137373_104869982 | 3300012532 | Vadose Zone Soil | CEAGLGGTTPEDEMQIVPQFVRKIRARMIPWGVKLPMFSHPKLGQI* |
| Ga0137358_106618891 | 3300012582 | Vadose Zone Soil | CEAGLGGNTPEDEMAVFPEFLRKIRKRMAPWGVEIPMFDHPRMGKV* |
| Ga0137397_101652953 | 3300012685 | Vadose Zone Soil | TPEDEMTVFPEFLKKIRKRMAPWGVNLPMFDHPRLGKV* |
| Ga0157289_102033431 | 3300012903 | Soil | IDADRVACEAGLGGTTPEDEMRVVPQFIAKIRARMAPWGVALPMFDHPKLGRV* |
| Ga0137394_102789241 | 3300012922 | Vadose Zone Soil | STPEDEMAIFPDFLKKIRKRMAPYGVKLPLFDHPRLGKV* |
| Ga0137394_108853191 | 3300012922 | Vadose Zone Soil | RISCEAGLGGNTPEDEMRVFPEFLAKIRKRMAPWGVNLPMFEHPRLGTV* |
| Ga0137419_113099211 | 3300012925 | Vadose Zone Soil | DEMRIVPQFIKKIRARMAPWGVNLPMFDHPKLGKV* |
| Ga0137419_117612021 | 3300012925 | Vadose Zone Soil | EDEMAVFPEFLRKIRKRMAPWGVVIPMFDHPRMGKV* |
| Ga0137416_104130561 | 3300012927 | Vadose Zone Soil | LGGNTPEDEMAVFPEFLRKIRKRMAPWGVVIPMFDHPRMGKV* |
| Ga0137416_116025631 | 3300012927 | Vadose Zone Soil | SCEAGLGGNTPEDEMTVFPEFLKKIRKRMAPWGVNIPMFDHPRLGKV* |
| Ga0137407_105328411 | 3300012930 | Vadose Zone Soil | ADRISCEAGLGGNTPEDEMRVFPEFLAKIRKRMAPWGVNLPMFEHPRLGTV* |
| Ga0137407_122017431 | 3300012930 | Vadose Zone Soil | DEMQVFPEFLRKIRKRMAPWGVKLPMFDHPRLGTV* |
| Ga0153915_104017831 | 3300012931 | Freshwater Wetlands | TPLEIDADRVACEAGLGGTTPEDEMRIVPQFIAKIRARMAPWGVKLPMFDHPKLGKV* |
| Ga0134075_102330821 | 3300014154 | Grasslands Soil | CEAGLGGNTPEDEMQVFPEFLRKIRKRMAPWGVKLPMFDHPRLGTV* |
| Ga0075301_11741561 | 3300014262 | Natural And Restored Wetlands | STPEDEMRVFPDFLRKIRRRMAPWGVTIPLFDHPRLGLV* |
| Ga0157376_120705011 | 3300014969 | Miscanthus Rhizosphere | CEAGLGGNTPEDEMRVFPDFLKKIRKRMAPWGVSIPMFDHPRLGKV* |
| Ga0173478_104673661 | 3300015201 | Soil | IDADRVACEAGLGGTTPEDEMRVVPQFIAKIRARMAPWGVELPMFEHPKLGRV* |
| Ga0137418_112215752 | 3300015241 | Vadose Zone Soil | EDEMRVFPEFLAKIRKRMAPWGVNLPMFEHPRLGTV* |
| Ga0134072_103224402 | 3300015357 | Grasslands Soil | CEAGLGGNTPEDEMMVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV* |
| Ga0132255_1009861031 | 3300015374 | Arabidopsis Rhizosphere | THAEIDADRISCEAGLGGSTPEDEMRVFPEFLGKIRKRMAPWGVSIPFFDHPRLGRV* |
| Ga0132255_1050162212 | 3300015374 | Arabidopsis Rhizosphere | ADRISCEAGLGGSTPEDEMRVFPEFLGKIRKRMAPWGVNIPFFDHPRLGRV* |
| Ga0132255_1052441911 | 3300015374 | Arabidopsis Rhizosphere | CSAGLGASTPEDEMKVFPQFLAKMRARMGPWGVTIPTFDHPKLGKV* |
| Ga0182039_122795072 | 3300016422 | Soil | DADRISCEAGLGGNTPEDEMRVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV |
| Ga0134069_13842092 | 3300017654 | Grasslands Soil | DADRVSCEAGLGGSTPDDEMRIFPEFLRKIRQRMAPWGVDIPLFDHPHLGRV |
| Ga0187779_106194471 | 3300017959 | Tropical Peatland | STPEDEMRVFPEFLRKIRRRMAPWGVTIPFFDHPRLGRI |
| Ga0184623_104868941 | 3300018056 | Groundwater Sediment | DRISCEAGLGGSTPEDEMRVFPQFLAKIRARMAPWGVRIPMFDHPRLGKI |
| Ga0184632_102692042 | 3300018075 | Groundwater Sediment | LEIDADRVSCEAGLGGSTPEDEMRVFPQFLAKLRARMAPWGVTLPLYDHPRLGKI |
| Ga0066662_109894441 | 3300018468 | Grasslands Soil | DADRISCEAGLGGNTPEDEMTVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV |
| Ga0066669_118018202 | 3300018482 | Grasslands Soil | CEAGLGGNTPEDEIQVFPEFLKKIRRRMAPWGVDIPMFDHPRLGKV |
| Ga0222622_108218332 | 3300022756 | Groundwater Sediment | GLGGTTPEDEMRIVPQFIKKIRARMDPWGVKLPLFDHPKLGKV |
| Ga0207680_112810472 | 3300025903 | Switchgrass Rhizosphere | CEAGLGGSTPEDEMAVFPEFLTKIRKRMAPYGVTLPLFDHPRLGKV |
| Ga0207684_103440671 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | TPEDEMRVFPDFLKKIRTRMAPWGVGIPMFDHPRLGKV |
| Ga0207707_108394792 | 3300025912 | Corn Rhizosphere | EIDADRVACEAGLGGTTPEDEMRIVPQFIKKIRARMAPWGVNLPMFDHPKLGKV |
| Ga0207646_109890322 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PAEIDADRISCEAGLGGNTPEDEMEVFPEFLKKIRKRMAPWGVNLPMFDHPRLGTV |
| Ga0207704_115650701 | 3300025938 | Miscanthus Rhizosphere | LGGNTPEDEMQVFPDFLRKIRKRMAPWGVSIPMFEHPRLGKV |
| Ga0207668_107667431 | 3300025972 | Switchgrass Rhizosphere | AGLGGTTPEDEMRIVPQFIKKIRARMAPWGVELPMFDHPKLGKV |
| Ga0208532_10076911 | 3300026011 | Rice Paddy Soil | VACEAGLGGTTPEDEMRIVPQFIAKIRARMAPWGVTLPMFDHPKLGKV |
| Ga0207676_117294362 | 3300026095 | Switchgrass Rhizosphere | TTPEDEMRVVPQFIAKIRARMAPWGVALPMFDHPKLGRV |
| Ga0207675_1004882183 | 3300026118 | Switchgrass Rhizosphere | GGTTPEDEMRIVPQFIKKIRARMAPWGVELPMFDHPKLGKV |
| Ga0207675_1022040081 | 3300026118 | Switchgrass Rhizosphere | AGLGGNTPEDEMRVFPDFLKKIRKRMAPWGVGIPMFEHPRLGKV |
| Ga0209235_11319701 | 3300026296 | Grasslands Soil | DRISCEAGLGGNTPEDEMRVFPDFLKKIRTRMAPWGVGIPMFDHPRLGKV |
| Ga0209235_12207692 | 3300026296 | Grasslands Soil | ADRISCEAGLGGNTPEDEMTVFPEFLKKIRKRMAPWGVNLPMFDHPRLGKV |
| Ga0209237_11675562 | 3300026297 | Grasslands Soil | CEAGLGGNTPEDEMRVFPDFLKKIRKRMAPWGVSIPMFDHPRLGKV |
| Ga0209236_10824541 | 3300026298 | Grasslands Soil | RISCEAGLGGNTPEDEMRVFPDFLKKIRTRMAPWGVGIPMFDHPRLGKV |
| Ga0209801_10200995 | 3300026326 | Soil | RISCEAGLGGNTPEDEMRVFPEFLAKIRKRMAPWGVNLPMFEHPRLGTV |
| Ga0209375_11171502 | 3300026329 | Soil | AEIDADRISCEAGLGGNTPEDEMTVFPEFLKKIRRRMAPWGVSIPMFDHPRLGKV |
| Ga0257149_10086313 | 3300026355 | Soil | TPEDEMRIVPQFIKKIRARMAPWGVNLPLFDHPKLGKV |
| Ga0257157_10176743 | 3300026496 | Soil | DADRVACEAGLGGTTPEDEMRIVPQFIKKIRARMAPWGVNLPMFDHPKLGKV |
| Ga0209217_11761271 | 3300027651 | Forest Soil | PEDEMRIVPQFIKKIRARMAPWGVNLPLFDHPKLGKV |
| Ga0209074_105051111 | 3300027787 | Agricultural Soil | SATPAEIDADRISCEAGLGGNTPEDEMAVFPEFLKKIRKRMAPWGVNIPMFEHPRLGKV |
| Ga0209180_102418291 | 3300027846 | Vadose Zone Soil | GGSTPEDEMAIFPDFLKKIRKRMAPYGVKLPLFDHPRLGKV |
| Ga0209465_102419272 | 3300027874 | Tropical Forest Soil | DEMRVFPEFLKKIRKRMAPWGVDIPLFDHPRLGKV |
| Ga0209068_101233313 | 3300027894 | Watersheds | TTPEDEMRIVPQFIKKIRARMAPWGVNLPLFDHPKLGKV |
| Ga0268264_100276135 | 3300028381 | Switchgrass Rhizosphere | TTPEDEMRIVPQFIKKIRARMAPWGVELPMFDHPKLGKV |
| Ga0268264_108258911 | 3300028381 | Switchgrass Rhizosphere | PEDEMRVVPQFIAKIRARMAPWGVALPMFDHPKLGRV |
| Ga0247822_118708051 | 3300028592 | Soil | PLEIDADRVACEAGLGGTTPEDEMRIVPQFIKKIRARMAPWGVNLPMFDHPKLGKV |
| Ga0247820_101253501 | 3300028597 | Soil | RISCEAGLGGNTPEDEMQVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV |
| Ga0247819_104004922 | 3300028608 | Soil | ISCEAGLGGNTPEDEMQVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV |
| Ga0247825_107845222 | 3300028812 | Soil | GTTPEDEMRIVPQFIKKIRARMAPWGVELPMFDHPKLGKV |
| Ga0307495_102514852 | 3300031199 | Soil | AEIDADRISCEAGLGGNTPEDEMQVFPDFLRKIRKRMAPWGVTIPMFDHPRLGQV |
| Ga0318573_105443152 | 3300031564 | Soil | SCEAGLGGNTPEDEMRVFPEFLKKIRERMAPWGVDIPMFDHPRLGKV |
| Ga0318574_100133884 | 3300031680 | Soil | ISCEAGLGGNTPEDEMRVFPEFLKKIRERMAPWGVDIPMFDHPRLGKV |
| Ga0318574_100295683 | 3300031680 | Soil | SCEAGLGGNTPDDEMRVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV |
| Ga0318496_100130785 | 3300031713 | Soil | GGNTPEDEMRVFPEFLKKIRERMAPWGVDIPMFDHPRLGKV |
| Ga0307469_122215142 | 3300031720 | Hardwood Forest Soil | ATPLEVDADRVACEAGLGGTTPEDEMRIVPQFIKKIRARMAPWGVNLPLFDHPKLGKV |
| Ga0307468_1009753792 | 3300031740 | Hardwood Forest Soil | EAGLGGNTPEDEMQVFPEFLRKIRKRMAPWSVTIPMFDHPRLGKV |
| Ga0307468_1021406191 | 3300031740 | Hardwood Forest Soil | CEAGLGGTTPEDEMRVVPQFIVKIRARMAPWGVELPMFDHPKLGRV |
| Ga0307475_110346401 | 3300031754 | Hardwood Forest Soil | LGGTTPEDEMRIVPQFIKKIRARMAPWGVNLPLFEHPKLGKV |
| Ga0318568_107095171 | 3300031819 | Soil | VSCEAGLGGNTPEDEMRVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV |
| Ga0307473_103683561 | 3300031820 | Hardwood Forest Soil | AEIDADRISCEAGLGGNTPEDEMRVFPDFLKKIRKRMAPWGVTIPMFDHPRLGKV |
| Ga0310884_107684701 | 3300031944 | Soil | GLGGNTPEDEIRVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV |
| Ga0318530_103344671 | 3300031959 | Soil | AEIDADRISCEAGLGGNTPEDEMRVFPEFLRKIRQRMAPWGVNIPMFDHPRLGKV |
| Ga0306922_104183422 | 3300032001 | Soil | EIDADRISCEAGLGGNTPEDEMRVFPEFLKKIRERMAPWGVDIPMFDHPRLGKV |
| Ga0310890_103284851 | 3300032075 | Soil | GSATPAEIDADRISCEAGLGGNTPEDEIRVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV |
| Ga0318525_100143043 | 3300032089 | Soil | PASHEMRVFPEFLKKIRERMAPWGVDIPMFDHPRLGKV |
| Ga0307470_104077231 | 3300032174 | Hardwood Forest Soil | DRISCEAGLGGNTPEDEMRVFPDFLKKIRKRMAPWGVNIPMFEHPRLGQV |
| Ga0307471_1005168052 | 3300032180 | Hardwood Forest Soil | ATPAEIDADRISCEAGLGGNTPEDEMRVFPEFLAKIRKRMAPWGVNLPMFEHPRLGTV |
| Ga0307471_1016058491 | 3300032180 | Hardwood Forest Soil | SCEAGLGGNTPEDEMRVFPDFLKKIRKRMAPWGVSIPMFEHPRLGKV |
| Ga0307471_1018394562 | 3300032180 | Hardwood Forest Soil | PEDEMEIVPQFVRKIRARMLPWGVKLPMFSHPKLGQI |
| Ga0307472_1017623133 | 3300032205 | Hardwood Forest Soil | EDEMRVFPAFLAKTRKRMAPWGVTLPLFDHPRLGKV |
| Ga0247829_106779342 | 3300033550 | Soil | IACAAGLGASTPEDEMKVFPQFLAKMRAKMGPWGVTIPTFDHPKLGKV |
| ⦗Top⦘ |